30 octobre, 2018

Déclaration de Fidélité à l’ Enseignement immuable de l’Église sur le mariage

Classé dans : Non classé — andreadicaffa02 @ 10:55
Déclaration de Fidélité à l' Enseignement immuable de l'Église sur le mariage  top_tekst_fr
choisissez votre langue
en ancien président de l’IOR (Italie) Pr Massimo de Leonardis it archevêque émérite de Bologne es archevêque émérite de Riga (Lettonie) S. Exc. Mgr Athanasius Schneider fr B. cz choisissez votre langue Premiers signataires Pr Wolfgang Waldsteinde co-fondateur de la Société brésilienne pour la défense de la Tradition pt_2 directeur de la Société pour la protection de l’enfant à naître (Society for the Protection of Unborn Children-SPUC) et co-fondateur de Voice of the Family (Royaume Uni) Pr Ettore Gotti Tedeschi pt docteur en théologie pl économiste et banquier
3 évêque auxiliaire de Salzburg (Austria) S. Exc. Mgr Juan Rodolfo Laise6 évêque auxiliaire d’Astana (Kazakhstan) Pr Josef Seifert2 évêque émérite de San Luis (Argentine) R. P. Antonius Maria Mamsery6 Faculté de physique et mathématiques1 Famille et Propriété (TFP) et président de l’Institut Plinio Corrêa de Oliveira Institute (Brésil) John Smeaton
licznik_francuski fondateur
Premiers signataires
  • Pr Wolfgang Waldstein, professeur émérite de l’Université de Salzburg, membre de l’Académie pontificale pour la Vie (Autriche)
  • S. E. le Cardinal Jãnis Pujats, archevêque émérite de Riga (Lettonie)
  • S. Exc. Mgr Athanasius Schneider, évêque auxiliaire d’Astana (Kazakhstan)
  • Pr Josef Seifert, professeur de philosophie à l’Association internationale pour l’étude de la philosophie d’Édith Stein (IASPES), fondateur, recteur et professeur de l’Académie internationale de philosophie dans la Principauté de Liechtenstein (Autriche)
  • Dr Anca-Maria Cernea, présidente de la Fondation Ioan Barbus (Roumanie)
  • Dr Vincent-Jean-Pierre Cernea (Roumanie)
  • M. l’Abbé Efrem Jindráček, Vice doyen de la faculté de philosophie de l’Université St Thomas d’Aquin – Angelicum de Rome (Italie)
  • S. E. le Cardinal Carlo Caffarra, archevêque émérite de Bologne, Fondateur et premier président de l’Institut pontifical Jean Paul II pour les études sur le mariage et la famillefor (Italie)
  • S. E. le Cardinal Raymond Leo Burke, Patron de l’Ordre souverain et militaire de Malte (Vatican)
  • Mgr Nicola Bux, professeur à la faculté de théologie des Pouilles (Italie)
  • S. Exc. Mgr Andreas Laün, évêque auxiliaire de Salzburg (Austria)
  • S. Exc. Mgr Juan Rodolfo Laise, évêque émérite de San Luis (Argentine)
  • R. P. Antonius Maria Mamsery, Supérieur général des Missionnaires de la sainte Croix in Singida (Tanzanie)
  • R. P. Giovanni M. Scalese, B., Supérieur ecclésiastique de la mission sui iuris en Afghanistan
  • Abbé José María Iraburu, professeur émérite de théologie spirituelle de l’École de théologie d’Espagne du Nord ; président de la Gratis Date Foundation et éditeur du site InfoCatólica (Espagne)
  • Mgr Juan Claudio Sanahuja, docteur en théologie, professeur de théologie morale et des Sacrements, journaliste (Argentine)
  • Pr Alma von Stockhausen, professeur de philosophie et fondateur de l’Académie Gustav-Siewerth de Weilheim-Bielbronnen (Allemagne)
  • Pr Rudolf Hilfer, Faculté de physique et mathématiques, Institut de physique informatique à l’Université de Stuttgart (Allemagne)
  • Me Adolpho Lindenberg, co-fondateur de la Société brésilienne pour la défense de la Tradition, Famille et Propriété (TFP) et président de l’Institut Plinio Corrêa de Oliveira Institute (Brésil)
  • John Smeaton, directeur de la Société pour la protection de l’enfant à naître (Society for the Protection of Unborn Children-SPUC) et co-fondateur de Voice of the Family (Royaume Uni)
  • Pr Ettore Gotti Tedeschi, professeur, économiste et banquier, ancien président de l’IOR (Italie)
  • Pr Massimo de Leonardis, directeur du département de sciences politiques à l’Université catholique du Sacré Cœur – Milan (Italie)
  • Comte Giorgio Piccolomini (Italie)
  • Comtesse Felicitas Piccolomini (Italie)
  • Pr Tommaso Scandroglio, professeur d’éthique et bioéthique à l’Université européenne (Italie)
  • Pr Giovanni Turco, professeur de philosophie du droit public à l’Université d’ Udine (Italie)
  • S.A.I.R. le Prince Louis Gaston d’Orléans Bragance, Chef de la Maison impériale du Brésil
  • Pr Isobel Camp, professeur de philosophie à l’Université pontificale de St-Thomas d’Aquin – l’Angelicum de Rome (Royaume Uni)
  • S.A. le Duc Paul d’Oldenbourg (Allemagne)
  • S.A. la Duchesse Pilar d’Oldenbourg (Allemagne)
  • Prince Carlo Massimo (Italie)
  • Princesse Elisa Massimo (Italie)
  • Pr Paolo Pasqualucci, professeur émérite de philosophie du droit de la faculté de Jurisprudence, Université de Perugia (Italie)
  • Pr Corrado Gnerre, auteur et professeur de sciences religieuses (Italie)
  • S.A.I.R. le Prince Bertrand d’Orléans Bragance (Brésil)
  • Pr John Laughland, auteur, docteur en philosophie (Royaume Uni)
  • Pr Robert Lazu, auteur, docteur en philosophie (Roumanie)
  • David Magalhães, maître de conférence à la faculté de droit de l’Université de Coimbra (Portugal)
  • Pr Enrico Maria Radaelli, auteur, directeur de recherche au département de métaphysique du Beau de philosophie des Arts (Italie)
  • R. P. Brian Harrison, professeur émérite de théologie de l’Université pontificale catholique de Puerto Rico ; professeur-résident, Centre d’étude des Oblats de la Sagesse (États-Unis)
  • Pr Roberto de Mattei, professeur d’histoire moderne et contemporaine de l’Université européenne de Rome (Italie)
  • Abbé Marc Hausmann, docteur et professeur de philosophie (Autriche)
  • Abbé Alfredo Morselli, théologien et auteur (Italie)
  • S. Exc. l’Ambassadeur Emilio Barbarani (Italie)
  • S. Exc. l’Ambassadeur Héctor Riesle Contreras, ambassadeur émérite du Chili près le Saint Siège (Chili)
  • S. A. l’Archiduchesse Alejandra von Habsburg (Ambassadrice Hector Riesle Contreras) (Autriche, Chili)
  • Abbé Fernando Palacios, docteur en droit canon (Espagne)
  • Me James Bogle, avocat et président honoraire d’Una Voce International (Royaume Uni)
  • John-Henry Westen, co-fondateur et rédacteur en chef de LifeSiteNews.com (Canada)
  • Luis Fernando Pérez Bustamante, directeur d’InfoCatólica (Espagne)
  • Maria Guarini, directrice du site « Chiesa e Post Concilio » (Italie)
  • Me Caio Xavier da Silveira, co-fondateur de la Société brésilienne pour la défence de la Tradition, Famille et Propriété (TFP), président de la Fédération Pro Europa Christiana (France)
  • Pr Gianandrea de Antonellis, président de l’Institut européen de recherche, d’études et de formation (I.E.R.E.F.) (Italie)
  • Pr Mauro Faverzani, éditeur de « Radici Cristiane » (Italie)
  • Pr Federico Catani, auteur et docteur en sciences religieuses (Italie)
  • Guido Vignelli, auteur et chercheur sur la famille (Italie)
  • Maria Madise, coordinateur de Voice of the Family (Estonie)
  • Cristina Siccardi, écrivain et historienne (Italie)
  • Mario Navarro da Costa, directeur du Bureau Tradition, Famille, Propriété à Washington (États-Unis)
  • Mathias von Gersdorff, écrivain et conférencier (Allemagne)
  • Marquise Gabriella Spalletti Trivelli Coda Nunziante (Italie)
  • Virginia Coda Nunziante, présidente de Famiglia Domani (Italie)
  • Raúl del Toro, organiste et professeur d’orgue (Espagne)
  • María Arratíbel , professeur de musique (Espagne)
  • Daniel Iglesias Grèzes, secrétaire du Centre culturel catholique « Fe y Razón » (Uruguay)
  • Pedro Luis Llera Vázquez, directeur d’école catholique (Espagne)
  • David González Cea (pseudonyme Alonso Gracián), philosophe thomiste et écrivain (Espagne)
  • José Miguel Arráiz, catéchiste et fondateur d’ApologeticaCatolica.org (Venezuela)
  • Antonello Brandi, président de Pro Vita Onlus (Italie)
  • Suzanne Pearson, déléguée de l’Emperor Karl League of Prayer (États-Unis)
  • Paul N. King, président et fondateur du Paulus Institute for the Propagation of Sacred Liturgy (États-Unis)
  • Donna Fitzpatrick Bethell, président du conseil d’administration du Collège de Chrétienté, ancien sous secrétaire du ministère de l’Énergie (États-Unis)
  • Alessandra Nucci, écrivain et directrice de la revue Una Voce Grida (Italie)
  • Néstor Martínez, licencié en philosophie, professeur et écrivain, co-fondateur de « Fe y Razón » (Uruguay)
  • Pr Javier Paredes, professeur d’histoire contemporaine à l’Université d’Alcalà (Espagne)
  • Honorable magistrat Justin Shaw (Royaume Uni)
  • Madame Caroline Shaw (Royaume Uni)
  • Bruno Moreno, licencié en physique et études ecclésiastiques, écrivain et éditeur de Vita Brevis (Espagne)
  • Juan José Romero, éditeur et consultant en communication (Espagne)
  • Dr. Alberto Zelger, président du Centre culturel Nicolò Stenone (Italie)
  • Gianfranco Amato, président des Juristes pour la Vie, secrétaire national de Popollo della Famiglia (Italie)
Parmi les plusieurs milliers de signataires de la Déclaration de Fidelity, nous mentionnons ces noms:
  • The Most Reverend Taras Senkiv, Bishop of Stryi, UGCC, (Ukraine)
  • Prof. Don Roberto Spataro SDB, University Professor and Secretary of the Pontifical Academy for Latin (Italy)
  • Mary Clare Meney, National Assoc. of Catholic Families (Australia)
  • Dr. Thomas Ward, Vice-president and Founder of the National Association of Catholic Families, Corresponding member of the Pontifical Academy for life (UK)
  • Dr. Christopher J. Malloy, PhD, Professor of Theology, University of Dallas, Irving (USA)
  • The Honourable Gerhard Wallbank, Minister of the Eastern Caribbean Supreme Court (Virgin Islands)
  • Rev. Fr. Prof. Alberto Strumia, Professor of Mathematical Physics at the Universtiy of Bari (Italy)
  • Prof. Peter Kwasniewski, theologian and philosopher (USA)
  • Prof. Claudi Pierantoni, Professor of Medieval Philosophy at the University of Chile (Italy)
  • Rev. Fr. Claude Barthe, theologian and vaticanista (France)
  • Tatiana Osorio de Moscoso, Duchess of Montemar (Spain)
  • H.S.H. Princess Benigna Reuss (Spain)
  • Marquise Maria Negrotto Cambiaso (Italy)
  • Emanuele Amat di San Filippo (Italy)
  • Luisa of the Princes Colonna di Paliano (Italy)
  • Kevin Jones, Secretary of the Latin Mass Society – England & Wales (UK)
  • Rev. Fr. Mattia Tanel (Italy)
  • Rev. Fr. Vilmar Pavesi (Italy)
  • Giacomo Maria Prati (Italy)
  • Edoardo Mazzetti di Pietralata (Italy)
  • Rev. Fr. Mario Ramello (Italy)
  • Marta Piccolomini, Sesto al Reghena (Italy)
  • Rev. Fr. Stanislaus Maria Paradal (Italy)
  • Rev. Fr. Francesco M. Budani (Italy)
  • Piotr Sawicki, historian (Poland)
  • Rev. Fr. Addolorato Maria Kyeremeh (Cameroon)
  • Luka Popov, Director Association Pro Family (Croatia)
  • Rev. Fr. Kenneth Bolin, Army Chaplain, West Point (USA)
  • Rev. Fr. Dr. Martin Fohl (Germany)
  • Rev. Fr. Pedro Ruiz, Licentiate in Spiritual Theology (Spain)
  • Rev. Fr. Anthony Serviam Ball (UK)
  • Eric Puosi Ph.D., writer (Italy)
  • Francisco José Fernández de la Cigoña, writer (Spain)
  • Rev. Fr. Luis Joaquín Gómez Jaubert, Defender of the Bond (Tenerife, Spain)
  • Rev. Fr. Paul J. McDonald (Canada)
  • Rev. Fr. Nuno Serras Pereira, OFM (Portugal)
  • Rev. Fr. Paolo Siano (Italy)
  • Deacon Brian Burns (UK)
  • Rev. Fr. Sandro Carbone (Italy)
  • Rev. Fr. Alessandro Apollonio (Italy)
  • Rev. Fr. Dr. Athanasius McVay (Canada)
  • Rev. Fr. Anthony Pillari (UK)
  • Rev. Fr. Diego Baltz (Brazil)
  • Rev. Fr. Lucio Savogin, SDB (Italy)
  • Rev. Fr. Stefano Braconi (Italy)
  • Prof. Fabiano Anderson Pedroso (Brazil)
  • Rev. Fr. Vidko Podržaj (Slovenia)
  • Rev. Fr. Edmund Castronovo (USA)
  • Rev. Fr. Gianluigi Braga (Italy)
  • Rev. Fr. Mario Ramello (Italy)
  • Rev. Fr. Paolo Mazzoleni (Italy)
  • Rev. Fr. John Giglio Hawley (USA)
  • Rev. Fr. John Benedict Maria Ubuane (Nigeria)
  • Deacon Mark Harden (USA)
  • Rev. Fr. Seán Finnegan (USA)
  • Sister Marie Ignatius Clune (USA)
  • Rev. Fr. Justo Díaz Villarreal, OSA (Spain)
  • Rev. Fr. Adriano Bolognani (Brazil)
  • Rev. Fr. Donato Maria (Erik Maria) Donadello (Italy)
  • Rev. Fr. José-Apeles Santolaria de Puey y Cruells (Spain)
  • Borther Charles Anthony Jukes (UK)
  • Rev. Fr. Fabiano Montanaro (Italy)
  • Rev. Fr. Hernán Ducci (Chile)
  • Rev. Fr. Joseph Ganser (USA)
  • Rev. Fr. Paolo Crescini (Italy)
  • Rev. Fr. José Encarnación Losoya (USA)
  • Deacon Vincent Daigle (Canada)
  • Rev. Fr. Angelo Bisi, Motteggiana (Italy)
  • Rev. Fr. Francis Denton (Australia)
  • Rev. Fr. Steven Ledinich (Australia)
  • Rev. Fr. Steven Sanchez (USA)
  • Brother John Pail Ignatius Mary (USA)
  • Rev. Fr. Jaromir Gargos Oslavany (Czech Republic)
  • Rev. Fr. Dennis Gordon, FSSP (USA)
  • Rev. Fr. George Kocholickal (Kenya)
  • Rev. Fr. Antony Tumelty (UK)
  • Rev. Fr. Thierry Pluquet (Belgium)
  • Rev. Fr. Peter Morgan (UK)
  • Permanent Deacon René Duranson (France)
  • Rev. Fr. Thomas Achatz, ISPN (Austria)
  • Rev. Fr. Martin Michael Klein (Australia)
  • Prof. Loreno Lorenzon, Professor at the Superior Institute of Religious Science of Treviso and Vittorio Veneto (Italy)
  • Rev. Fr. Marco Begato (Italy)
  • Rev. Fr. Joseph Justice (USA)
  • Prof. Carlos Casanova, Professor of Law at the Catholic University of Chile (Venezuela)
  • Rev. Fr. Anders Hamberg, STL (Finland)
  • Rev. Fr. Tomáš Hajda (Czech Republic)
  • Christopher Ferrara, writer and lecturer (USA)
  • Rev. Fr. Antonín Damián Nohejl, III OP (Czech Republic)
  • Rev. Fr. Bartłomiej Koziej (Poland)
  • Brother Ambrogio Maria Canavesi (Italy)
  • Rev. Fr. Francisco de Assis de Souza, Itabaiana – SE (Brazil)
  • Deacon Edward Peitler, Ph.D. (USA)
  • Rev. Fr. Kenneth Riello (USA)
  • Rev. Fr. Donatello Iocco (Canada)
  • Deacon James Stanley (USA)
  • Rev. Fr. Fabio Castagnoli (Italy)
  • Sister Luisa De Vivo (Italy)
  • Rev. Fr. Dr. Kevin Bezner (USA)
  • James Lucier, Ph.D. (USA)
  • Rev. Fr. Alfonso Avilés Pérez (Ecuador)
  • Dom Marcello Cristofani della Magione (Italy)
  • Marco Sgroi, in charge of the Summorum Pontificum Pilgrimage, (Italy)
  • Rev. Fr. Junior Carlo Louisetti (Italy)
  • Countess Lucrezia Piccolomini Adami (Italy)
  • Roberto Marchesini, psychologist and writer (Italy)
  • Prof. Dr. Hans-Heribert Derix , university professor (Germany)
  • Rev. Fr. Claudio Girlanda (Italy)
  • Rev. Fr. Camillo Magarotto (Italy)
  • Rev. Fr. Joao Carlos Teodoro (Brazil)
  • Prof. Wojciech Dobiński, scientist (Poland)
  • Prof. Kalah Williams, Director of Religious Education (USA)
  • Prof. Piotr Wisniowski, university professor (Poland)
  • Rev. Fr. David Bechtel, Wellsboro (USA)
  • Deacon Alois Nespor, FSSP (Czech Republic)
  • Rev. Fr. Francesco Solazzo, C.P. (Italy)
  • Ann Farmer (MA), writer and researcher (UK)
  • Michael Fagge, Assistant Professor of Theology (USA)
  • Marek Ziaja, Theologian (Poland)
  • Prof. Alexander Frain, M.A.C.D. (USA)
  • Prof. Patrick Powers, professor of philosophy, (USA)
  • Prof. Joao Titta Maurício, university professor (Portugal)
  • Rev. Fr. John Rice (UK)
  • William Fahey, President of the Thomas More College of Liberal Arts (USA)
  • Rev. Father Markielowski (Poland)
  • Prof. Melchiorre Livoti (Italy)
  • Rev. Fr. Gary Dickson (UK)
  • Rev. Fr. David Evans (UK)
  • Prof. José Lago (Spain)
  • Prof. Paolo Rizza (Italy)
  • Rev. Fr. Pio M. Idowu (UK)
  • Prof. Dr. Stephan Ernst Baldus M.D. (Germany)
  • Prof. Claudio Buzzi Di Marco (Italy)
  • Prof. Elmar Große-Klönne, professor of Mathematics (Germany)
  • Rev. Fr. Bogdan Tyc (Poland)
  • Prof. Ryan Topping, Professor at the Thomas More College (USA)
  • Prof. Marcin Babicz, historian and journalist (Poland)
  • Marcin Bąk, seminarian (Poland)
  • Prof. John McCarthy, Professor at the University of Manchester (USA)
  • Prof. Timothy J. Williams, Professor at the Franciscan University of Steubenville (USA)
  • Rev. Fr. Mugurel Puia (Romania)
  • Rev. Fr. Eduardo Cuadrado (Brazil)
  • Matheus Spézia de Oliveira, seminarian (Brazil)
  • Rev. Fr. Bogdan Krol (Poland)
  • Modesto Fernandez, President of Droit de Naître (France)
  • César Félix Sánchez Martínez, Director of Studies at the Archdiocesan Seminary of Arequipa (Peru)
  • Rev. Fr. Luciano Micheli (Italy)
  • Rev. Fr. Mark Morris, Pastor and Chaplain to the Caledonian University (UK)
  • Rev. Fr. Piotr Wróbel, Pastor (Poland)
  • Therese Carolan, pastoral team member (USA)
  • Rev. Fr. Roman Adam Kneblewski (Poland)
  • Prof. Maurizio Brunetti, university professor (Italy)
  • Łukasz Kaszuba, seminarian (Poland)
  • Rev. Fr. Sebastian Gilbert Iavorschi (Romania)
  • Rev. Fr. Bruno Antonio Verduci (Italy)
  • Prof. Marek Stachowiak, university professor (Poland)
  • Rev. Fr. Lawrence Kutz (USA)
  • Rev. Canon John Anthony Pintabone, KHS, historian (USA)
  • Raymond Belair, catechist and writer (USA)
  • Rev. Fr. Matthew C. MacDonald Somers (USA)
  • Kamil Belling, seminarian (USA)
  • Paolo Gasperini, religious education teacher (Italy)
  • Rev. Fr. Grzegorz Papciak Piotrkowice (Poland)
  • Jacek Rządkowski, theologian and composer (Poland)
  • Joseph Parackal John, seminarian (India)
  • Rev. Fr. Frank Domen (The Netherlands)
  • Rev. Fr. Luciano Dalla Costa (Italy)
  • Rev. Fr. George Mary Roth (UK)
  • Theresa Fleming, activist for Life and parish assistant (UK)
  • Prof. Cristian Rodríguez Iglesias, professor of theology (Argentina)
  • Dominie-Mary Stemp, catechist (UK)
  • Rev. Fr. Carlos Hamel (France)
  • Prof. Michel Bastit, Professor of Philosophy at the University of Bourgogne (France)
  • Prof. Pablo Augusto Marini, writer, philosopher and theologian (Argentina)
  • Reinhard Dörner, President of Kardinal-von-Galen-Kreis (Germany)
  • Rev. Fr. Juan Carlos Angulo Karam (Spain)
  • Rev. Fr. Joseph D. Santos Jr. (USA)
  • Rev. Fr. Luigi Re Cecconi (Italy)
  • Rev. Fr. Dr. Robert Farrell (UK)
  • Rev. Fr. Aaron N. Pribil, clerical oblate (Germany)
  • Rev. Fr. Salvatore Vitiello, university professor – Roma (Italy)
  • Rev. Fr. Damiano Cavallaro (Italy)
  • Rev. Fr. Angel Francisco Casabon Vicente (Brazil)
  • Prof. Antonio Toniolo, professor of Medicine (Italy)
  • Rev. Fr. Luciano Tiso (Italy)
  • Dr. Francesco Domaschio, President of Associazione Città e Famiglia (Italy)
  • Prof. Alberto Bosi, university professor (Italy)
  • Sister Maria Teresa Bator (Italy)
  • Michael Rocha, seminarian (USA)
  • Rev. Fr. Michael Sellers (UK)
  • Rev. Fr. Pierpaolo Cilla (Italy)
  • Rev. Fr. Michael Brown (UK)
  • Rev. Fr. Marino Ramadori (Italy)
  • Sister Costanza Salbego (Italy)
  • Rev. Fr. Christian Bünnigmann (Germany)
  • Rev. Fr. Petru Sescu (Romania)
  • Rev. Fr. Carlo Radrizzani, pastor (Italy)
  • Sister Mary Joseph Maling (UK)
  • Prof. Domenico del Nero, teacher and writer (Italy)
  • Rev. Fr. Richard Duncan, C.O. (UK)
  • Rev. Fr. Mario Piatti (Italy)
  • Rev. Fr. Andrew Johnson, pastor (USA)
  • Prof. Marcos Luis Blanco y Centurión, emeritus professor of Canon Law (Uruguay)
  • Rev. Fr. Joseph Matlak (USA)
  • Ana Pavelić, theologian (Croatia)
  • Rev. Fr. Gian Paolo Bretti (Italy)
  • Rev. Fr. Clemens of Saint Gabriel, OCD (Sweden)
  • Rev. Fr. Matthew Kauth, STD, Rector of St Joseph College Seminary (USA)
  • Rev. Fr. Massimo Macalli (Italy)
  • Prof. Giovanni (Gianni) Fochi, chemist and scientific journalist (Italy)
  • Prof. Mauro Giacomini, university professor (Kazakhstan)
  • Rev. Fr. Giovanni De Checchi (France)
  • Rev. Fr. Jan Franta (Germany)
  • Prof. Nicola Liberio, professor of religious education (Italy)
  • Rev. Fr. Giuseppe Tagliareni (Italy)
  • Prof. Kolos Ágoston, associate university professot (Hungary)
  • Anna Buoncristiani, journalist (Italy)
  • John Vennari, Director of Catholic Family News (USA)
  • Giorgio Nicolini, Director of Tele Maria (Italy)
  • Prof. Joaquín Reyes, Professor of Law at the Catholic University of Santiago (Chile)
  • Rev. Fr. Krzysztof Irek (Poland)
  • Prof. Ignacio Maria Gallo Ingrao, professor of philosophy (Argentina)
  • Dr. Richard Fitzgibbons, psychiatrist (USA)
  • Rev. Fr. Jorge Miguel Martínez Florentín (Paraguay)
  • Patryk Piotr Kostera, seminarian (Poland)
  • Daniele Caci, catechist (Italy)
  • Rev. Fr. Vernon F Clark, JCL (USA)
  • Rev. Fr. Richard Yevchak (USA)
  • Rev. Jan Mazur Monaco (Poland)
  • Rev. Padre Tomàs Alfonso Paz Pérez (Venezuela)
  • Kathy Sinnott, EWTN Radio Host (Ireland)
  • Prof. Vittorio Bertolini, professor of philosophy (Italy)
  • Paul Danello, Doctor in Civil and Canon Law (USA)
  • Rev. Fr. Thomas Crean, O.P., theologian (UK)
  • Rev. Fr. Alessandro Coniglio (Italy)
  • Rev. Fr. Ignacio Palacios Blanco, Professor of Philosophy at the San Ildefonso Centre for Theological Studies of Toledo (Spain)
  • Piotr Korycki, President of Genealogia Polska LLC (USA)
  • Prof. Jorge Horacio de la Calle, professor of Philosophy (Argentina)
  • Jiří Hanuš, Co-director of the Philarmonic Orchestra of Hradec Králové (Czech Republic)
  • Prof. Anna Hanušová, professor at Charles University (Czech Republic)
  • Rev. Fr. Simon Heans (UK)
  • Rev. Fr. Matthew Goddard (UK)
  • Joseph-Henri Fradet, Founder and Director of Christendom Restoration Society (USA)
  • Rev. Fr. Stanislaw Morawski (Italy)
  • Sarah Jirak, professor of theology (USA)
  • Rev. Fr. Didier Baccianti (Switzerland)
  • Rev. Fr. Rafael Gonzalez Bustillos (France)
  • Carmela Spuria, religious education teacher (Italy)
  • Deacon Nick Donnelly, journalist and writer (UK)
  • Rev. Fr. Godofroy Upartho Unega (Congo)
  • David Pietrusza, historian and writer (USA)
  • Rev. Fr. Michał Woźnicki, SDB (Poland)
  • Brother Bruno Cassalibus, hermit (Canada)
  • Rev. Fr. Michael T. Barry (USA)
  • Sister Weruska Caterina Luna, O.S.S. (Italy)
  • Rev. Fr. Miguel Galvez (USA)
  • Rev. Fr. Ninian Doohan (UK)
  • Prof. Mario Correa Bascuñán, Professor of Law and former university rector (Chile)
  • Rev. Fr. Raymond Blake, pastor (UK)
  • Rev. Fr. Diego Rodrigo Pildain (The Netherlands)
  • Rev. Fr. John Lawrence M. Polis (Italy)
  • Phillip Bellini, Director of Religious Education (USA)
  • Carlos Gonzalez-Chavez, religious education teacher (USA)
  • Rev. Fr. James Clark (UK)
  • Prof. Paul Crawford, university professor (USA)
  • Rev. Fr. Alex Hill (UK)
  • Dr. Judith Marie Gentle, theologian (USA)
  • Rev. Fr. David R. Belland (USA)
  • Oyvind Iustinus Lone, theology student (Italy)
  • Rev. Fr. Steven Scherrer, MM, ThD (USA)
  • Prof. Alonso Jaramillo de Andrade, ecclesiastical historian (Colombia)
  • Ted Huerena, Headmaster of the St. Louis de Montfort Academy (USA)
  • Rev. Fr. John Paul Mount (Australia)
  • Rev. Fr. Acton (Canada)
  • Rev. Fr. Paulino Toral (Equador)
  • Maria Amelia Volz, theologian (USA)
  • Francesco De Gol, seminarian (Italy)
  • Angelica Saldaña, theologian (USA)
  • Paolo Gulisano, doctor and writer (Italy)
  • Rev. Fr. Kevin Kinchang Anak Chundi (Malaysia)
  • Brother Andrea Ingribello (Italy)
  • Rev. Fr. Maycon Zaidan Alves Lopes (Brazil)
  • Rev. Fr. Xavier Ryckeboer, professor of theology (Argentina)
  • Rev. Fr. Miguel Ángel Saiz Cerreda (Spain)
  • Rev. Fr. Zdenko Králik, Chaplain (Slovakia)
  • Rev. Fr. Otto Michael Schneider, pastor (Sweden)
  • Mendonça Correia, canonist (Portugal)
  • Rev. Fr. Srećko Rimac (Croatia)
  • Sister M. Cecilia Pia Manelli, religious (Italy)
  • Prof. Brad Miner, Faith & Reason Institute (USA)
  • Rev. Fr. Hernán Gabriel Barreto (Argentina)
  • Lucrecia Rego de Planas, writer, Founder of the portal Catholic.net (Mexico)
  • Prof. Martin Brown, former professor of philosophy (Canada)
  • Rev. Fr.. Francis Butler, Josephite Fathers (USA)
  • Prof. Nelson Tepedino, Professor at the Department of Philosophy at Simón Bolívar University (Venezuela)
  • Filip Mazurczak, Catholic journalist (USA)
  • Rev. Fr. Robert Adriano Brisman Polanco (Dominican Republic)
  • Rev. Fr. Siegfried M. Lang (Austria)
  • Very Rev. Msgr. John Fritz, FSSP, pastor (USA)
  • Prof. Carlos Freile, Director of the Academy of Ecuadorian Ecclesiastical History (Ecuador)
  • Brother André Marie Villarrubia, Prior (USA)
  • Francesca Pannuti, philosopher and writer (Italy)
  • Adam Miller, writer (USA)
  • Rev. Fr. Sergio Demartini, monk (USA)
  • Rev. Fr. Milan Tisma (Chile)
  • Pierre de Lauzun, writer and economist (France)
  • Prof. Jean Barbey, University Professor for Medieval Law (France)
  • Mrs. Catherine Barbey (France)
  • Prof. Jacopo Parravicini, Physicist at the University of Milano-Bicocca (Italy)
  • Dr. Oscar Botta, Doctor, Director for La Vida y la Familia (Argentina)
  • Rev. Fr. Robert Dodaro, O.S.A., Professor of Patristic Theology at the Pontifical Lateran University (Cidade do Vaticano)
  • Rev. Fr. Horacio Bojorge, S.J., Professor of Theology and writer (Uruguay)
  • Raffaele Tiscar, Vice-Secretary General to the President of the Council of Ministers (Italy)
  • Claudio Circelli, President of the Associazione Casa Mariana Editrice (Italy)
  • Gianpaolo Barra, Editor of Novate Milanese (Italy)
  • Miguel Ángel Fuentes, Doctor of Moral Theology, specialising in Marriage and Family (Argentina)
  • Rev. Fr. Bryan W. Jerabek, J.C.L., Parish priest, marriage tribunal judge for the Diocese of Birmingham, AL (USA)
  • Jacopo Parravicini, Physicist at Milano-Bicocca University (Italy)
  • Prof. Eric E. Puosi, Ph.D, Professor of Fundamental Theology and History of the Reformation (Italy)
  • Jason Adkins, Executive Director & General Counsel Minnesota Catholic Conference (USA)
  • Sister Noemi Pedrotti (Italy)
  • Tomas Rochford, High School teacher and Catechist (Canada)
  • Rev. Fr. Francesco Gaetta (Italy)
  • Rev. Fr. Juan Valdéz Solowij (Argentina)
  • Rev. Fr. Andrew Michael Walter, Pastor in the Diocese Of Bridgeport, CT (USA)
  • Amanda Peter, Pharmacist and author (UK)
  • Rev. Fr. Roberto Castiglione, S.D.B., missionary, teacher of philosphy (Nigeria)
  • Rev. Fr. Ricardo Cardoso (Portugal)
  • Rev. Fr. Leonard F. Villa, Pastor (USA)
  • Prof. Angelo Maria Vitale, Professor of Philosophy at the University of Salerno (Italy)
  • Patrick Delaney, High School teacher of Theology (USA)
  • Rev. Fr. Edwin Vissers (The Netherlands)
  • Rev. Fr. Juan Antonio Gómez Medina (Spain)
  • Timothy Capps, Author (USA)
  • Alberto Mensi, Professor of Philosophy (Argentina)
  • Rev. Fr. Jose Manuel Villanueva (Uruguay)
  • Prof. Hugo Alberto Verdera, University professor and journalist (Argentina)
  • Rev. Fr. Juan Fernando García Budinich, Priest (Chile)
  • Sister Maria Angelica Celocia, S.F.I. (Italy)
  • Rev. Fr. Thomas Joseph Hennigan (Spain)
  • Rev. Fr. Francisco Perez (Venezuela)
  • Sister Maria Teresina Custodio Ancona (Italy)
  • Prof. Massimo Mallucci De Mulucci, lawyer, Professor of Family Law (Italy)
  • Sister Suzette Cortes (Italy)
  • Rev. Fr. Duarte Sousa Lara (Portugal)
  • Sister Amanda Khoo (UK)
  • Edmundo Gelonch Villarino, Professor and writer (Argentina)
  • Rev. Fr. Daniel Katacic, monk (Croatia)
  • Rev. Fr. Christian Vegna, O.F.M. (Italy)
  • Rev. Fr. Gabriele Mangiarotti, in charge of Culturacattolica.it (Italy)
  • Rev. Fr. Terrence Brennan (USA)
  • Rev. Fr. Miroslav Cerny, univeristy professor (Czech Republic)
  • Prof. Alessandro Manzani, Professor of History at the Luigi Paolini Superior Institute (Italy)
  • Prof. John Rao, Associate Professor of History (USA)
  • Prof. Marco di Matteo, Professor of Italian and Latin Literature (Italy)
  • Matthew Zamoyski, Writer (Poland)
  • Rev. Fr. Jerzy Pikulinski (USA)
  • Rev. Fr. Samuel Weber, O.S.B. (USA)
  • Brian McCauley, Director of Religious Education (USA)
  • Rev. Fr. Stefano Tartabini (Italy)
  • Rev. Fr. Mugurel Puia (Romania)
  • Rev. Fr. Ronald Piepmeyer (USA)
  • Rev. Fr. Giuseppe Privitera (Italy)
  • Rev. Fr. David Palmer (UK)
  • Matthew Smith, Seminarian (USA)
  • Rev. Fr. Nick Wichert (USA)
  • Rev. Fr. Francisco Godinez (USA)
  • Br. Ryan Carnes, O.F.S. (USA)
  • Carol Goodson, Catechist for RCIA (USA)
  • Joseph Rubio, Catechist (USA)
  • Benedikt Timpe, Seminarian (German)
  • Rev. Fr. Matt McAuslin (New Zealand)
  • Matteo Baldan, Consecrated, Fiesso d’Artico (Italy)
  • Rev. Fr. James Torpey (USA)
  • Rev. Fr. Patrick Fixsen (USA)
  • Rev. Fr. Dr. Franz Ehgartner (Austria)
  • Rev. Fr. Jessie Martinez, O.C.D.S. (USA)
  • Andrew Mcgovern, M.T.S., theology teacher (USA)
  • Rod Treat, Webmaster/Social Media Manager – Diocese of Tulsa (USA)
  • Deacon Christopher Baker, Cathedral of St. Joseph, Jefferson City (USA)
  • Henri Courivaud, conference organiser at the Faculty of Law at the University of Lyon III (France)
  • Sister Claudia Lo Sterzo (UK)
  • Prof. Antonio De Santi, thelogy and religious education (Italy)
  • Constance Louise Taylor, retired RN catechist (USA)
  • Sheryl Collmer, Writer and speaker (USA)
  • Rev. Fr. Riccardo Vaninetti, Pastor (Italy)
  • Javier Castillo, theology teacher (USA)
  • Adam Pittman, Seminarian (USA)
  • Tobias Kokot, Theologian (Germany)
  • Dawn McGinley, Director of Catholic Campus Ministry at Mississippi State University (USA)
  • Rev. Fr. Giorgio Bellei, Pastor (Italy)
  • Very Rev. Canon Paolo Piccoli (Italy)
  • Rev. Fr. Todd Petersen (USA)
  • Rev. Fr. Dwight Campbell (USA)
  • Rev. Fr. Domingos Miguel da Fonseca Coelho (Portugal)
  • Br. Mauricio Rangel Huerta (Mexico)
  • Prof. Fausto Zamboni, Professor and author (Brazil)
  • Juan Ignacio Moreno-Luque Casariego, Judge of the Superior Tribunal of Justice of the Canary Islands (Tenerife, Spain)
  • Rev. Fr. Timothy Sauppe, S.T.L., Pastor (USA)
  • Anthony Gal, teology student (Australia)
  • Rev. Fr. Jesús Fernández Rodríguez (Spain)
  • Prof. Antonio Ramón Peña Izquierdo, Professor of History and Religion (Spain)
  • Rev. Fr. Donald Bauer (USA)
  • Rev. Fr. Sean Thornton (UK)
  • Michele Ciapetti, Religious (Italy)
  • Rev. Fr. Eusebio Capel, Licentiate in Law (Spain)
  • Very Rev. Canon Gérard Trauchessec (France)
  • Rev. Fr. Gustavo Carlavan (Argentina)
  • Rev. Fr. Daniel Sánchez, pychologist (USA)
  • Patrick Craine, Journalist (Canada)
  • Rev. Fr. Rubén Eduardo Martínez-Cordero (Ecuador)
  • Edgardo Juan Cruz Ramos, President of Una Voce Puerto Rico (Puerto Rico)
  • Rev. Fr. Salvatore Mangatia (Italy)
  • Rev. Fr. Duarte Filipe Andrade Gomes (Portugal)
  • Rev. Fr. Tiziano Trenti (Italy)
  • Prof. Adelia De Miguel, Professor of Psychology at the University of La Laguna (Tenerife, Spain)
  • Stefano Branz, relisgious education teacher (Italy)
  • Rev. Fr. Custodio Ballester (Spain)
  • Andrew Roelands, Seminarian (Canada)
  • Michele Antonelli, Religious (Italy)
  • Rev. Msgr. Raymond Goehring, canon lawyer (USA)
  • Count Francesco Zucchini (Italy)
  • Werner Rothenberger, high scool rector (Germany)
  • Mary Agnew, catholic school teacher (USA)
  • Rev. Fr. Marcello Stanzione, Parish priest (Italy)
  • S.E. Mons. Adriano Langa, OFM, Bishop of Inambane (Mozambique)
  • S.E. Mons. Jonas Kauneckas, Bishop of Panevezys (Lithuania)
  • S.E. Mons. Anthony Lee Kok Hin, Emeritus Bishop of Miri (Malesia)
  • Rev. Don Andrew Pinsent, Priest, Professor and Writer Oxford (UK)
  • Rev. Fr. Štěpán Maria Filip, OP, Theologian, University Professor Olomouc (Czech Republic)
  • Prof. Hermes Rodrigues Nery, President of National Pro-life and Pro-family Association São Bento do Sapucaí – SP (Brazil)
  • Constance Louise Taylor ofs, Catechist Ormond Beach Fl. (USA )
  • Antonio Jesús Rodriguez Cruz , Ombudsman Baesa (Spain)
  • María Carmen Cátedra Rascón, Ombudsman Baesa (Spain)
  • Rev. Fr. Jean Susini, Priest Monaco (Monaco)
  • Prof. Oliver Gottschalk, Religion and Latin Professor Trumau (Austria )
  • Rev. Fr. Simon Ascherl, Parish Priest Ellmau (Austria)
  • Rev. Don Michael Pritz, Parish Priest Ellmau (Austria )
  • ev. Fr. Jaroslav Broz, Theology Professor University of Prague (Czech Republic)
  • Rev. Fr. Vivien Somda Domebeimwin, Priest Innsbruck (Austria)
  • Sister Maria Veronica Lasca , Nun FI Rome (Italy)
  • Rev. Fr. Joseph Galea, Priest Zabbar (Malta)
  • Sister Maria Angelica Pia Ruzzenenti , Nun Verona (Italy)
  • Rev. Fr. Settimio Maria Manelli, Priest Albenga (Italy)
  • Rev. Fr. Robert Farrell, Priest Manchester (UK)
  • Rev. Fr. Prof. Franz Schlegl, Priest Vienna (Austria)
  • Rev. Fr. Parinya Samerpitak , Priest Rome (Italy)
  • Rev. Fr. Antonio Riva, Priest Mazzo di Rho (Mi) (Italy)
  • Prof. Seamus Kane, Religion Professor Glasgow (UK)
  • Rev. Fr. Philipp Faschinger, Priest Thalwil (Swiss)
  • Rev. Fr. Gerhard Schrafstetter, Parish Priest Sonntag (Austria)
  • Rev. Fr. Gerhard Henning, Priest Juscimeira (Brazil)
  • Rev. Fr. Rainer Geuder, Priest Unterlamm (Austria)
  • Rev. Fr. Dr. Adolf Fugel, Priest Kreuzlingen (Swiss)
  • Hans-Jürgen Reichhardt, Catechist Neukirchen an der Enknach (Austria)
  • Rev. Br. Giuseppe Aringoli OFM, Religious Brother Narni (Italy)
  • Rev. Fr. Georg Josef Erhart, Priest Weyarn (Germany)
  • Deacon Johannes (Hans) Reintjes, Deacon Haelen (Netherlands )
  • Prof. Luca Pignataro, Philosophy and History Professor Rome (Italy)
  • Franz Ripplinger, Pastoral Assistant Vorderweidenthal (Germany)
  • Prof. J. Hans Benirschke, Philosophy Professor Ellwangen (Germany)
  • Prof. Marie-Agnès Vrignaud, Professor Fontaine-Simon (France)
  • Deacon Michael Krämer, Religious man Eichstätt (Germany)
  • Rev. Fr. Laurent Koch, Priest Monheim (Germany)
  • Rev. Fr. Theo Irrgang STD, Spiritual Director Cologne (Germany)
  • Deacon Diether Hofmacher, Religious man Nassenfels (Germany)
  • Sister Maria Carmela Mussi , Religious woman FI Frattocchie (Italy)
  • Sister Monica Tan, Religious woman FI Frattocchie (Italy)
  • Sister Maria Gemma Nazareno , Religious woman FI Frattocchie (Italy)
  • Rev. Fr.Vincenzo Pawlos, Priest Alessandria (Italy)
  • Rev. Fr. Roger Ibounigg, Parish Priest Pöllau (Austria)
  • Mark Retter, University Student – Cambridge University Cambridge (UK)
  • Rev. Fr. Peter Irving, Priest Long Beach (USA )
  • Rev. Fr. Stefan Haimerl, Priest Regensburg (Germany)
  • Prof. Ladislav Starek, Technology University of Bratislava Bratislava (Slovakia )
  • Felizitas Küble, Journalist Münster (Germany)
  • Rev. Fr. Ladis Cizik, Priest Pittsburgh (USA )
  • Prof. Matteo Salonia, University Professor Liverpool UK (UK)
  • Deacon Dr. Martin Hofer, Religion Professor Melk (Austria)
  • Sister Maria Maximiliana Kama, Religious woman FI Avellino (Italy)
  • Sister Maria Michela Cozzolino , Religious woman FI Roma (Italy)
  • Sister Maria Gemma Faiella , Religious woman FI Roma (Italy)
  • Prof. Arturo López Quintela, University Chemistry-Physics Professor Compostella Santiago d.C. (Spain)
  • Rev. Fr. Michele Capodiferro, Priest Gravina in Puglia (Italy)
  • Alessandro Calderoni, Seminarian Tulsa (USA )
  • Prof. Derik Castillo Guajard , Metropolitan Autonomous Univ. Toluca (Mexico)
  • Rev. Fr. Felice Prosperi, Priest San Ginesio (Italy)
  • Mauro Visigalli, Lawyer Codogno (Italy)
  • Sister Maria Assumpta Rodriguez , Religious woman FI Roma (Italy)
  • Rev. Fr. Leonardo Sacco, S. Maria Assunta Archipriest Pietrabbondante (Italy)
  • Sister Maria Pia Chiara Bosco , Religious woman FI Rome (Italy)
  • Rev. Fr. Erich Markus Kuen, Priest Tulln (Austria )
  • Prof. Francesca Romana Poleggi, Teacher and Writer Fregene (Italy)
  • Prof. Natividad Nebot Calpe, Spanish Language and Literature Valenzia (Spain)
  • Rev. Fr. Jack Geudens, Priest Landsgraaf (Netherlands )
  • Rev. Fr. Norbert van der Sluis, Priest Sint Anthonis (Netherlands)
  • Rev. Fr. Eros Mario Pellizzari , Hospital Chaplain San Donà di Piave (Italy)
  • Prof. Maike Hickson, Professor and Journalist Front Royal (USA )
  • Prof. Robert Hickson , University Professor, Army Officer Ret. Front Royal (USA )
  • Cathleen L. Maley, Consecrated Life Saint Louis Missouri (USA)
  • Prof. Samuel Azasu , Associated University Professor Johannesburg (South Africa)
  • Rev. Fr. Raphaël Granges, Priest Menzingen (Swiss)
  • Jeanne Rudbeck, Editor and Writer Stockholm (Sweden)
  • Rev. Fr. Thomas Dorn, Cincinnati Archdiocese Priest Covington (USA)
  • Rev. Fr. Alfred Kronshage Bäcker , Priest Irndorf (Germany)
  • Michelle Kaufman, Family Life International NZ Auckland (New Zealand)
  • Sister Maria Pia Peluso, Religious woman FI Alassio (Italy)
  • Rev. Fr. Teodulo Esguerra, Priest Malolos (Philippines)
  • Rev. Fr. Giovanni Ferrara , Padova Diocese Priest Marino (Rm) (Italy)
  • Prof. Ivo Kerže, Philosophy Professor Slovenska Bistrica (Slovenia)
  • Rev. Fr. Christopher Markellos , Priest Somers Point (USA)
  • Kimberly Walters , Sacred Music Director Irving (USA)
  • Sister M. Daniella Pia Potot, Religious woman FI Cebu City (Philippines)
  • Rev. Fr. Juan Benjamín Castro Zavalía, Priest Santiago del Estero (Argentina)
  • Prof. Gianni Borgo, History and Philosophy Professor Milan (Italy)
  • Rev. Fr. Marc Massaer, Priest Dreumel (Netherlands)
  • Rev. Fr. Paolo Pirlo, Priest Manila (Philippines)
  • Rev. Fr. Martin Slaughter, Priest Los Angeles (USA)
  • Rev Brother Jardel Maciel dos Santos, Religious man Varjota (Brazil)
  • Sister M. Santina Pia Labastida, Religious woman FI Agusan del Sur (Philippines)
  • Sister M. Gabriella Avila, Religious woman FI Cebu City (Philippines)
  • Sister Florence Wahome, Religious woman London (UK)
  • On. Nathalie Roy, Writer and journalist Montréal (Canada)
  • Rev. Fr. Martin Laird , Priest Plaucheville (USA)
  • Rev. Fr. Jack Geudens, Priest Landgraaf (Netherlands )
  • Rev. Fr. Louis Di Rocco, Priest Westport (Canada)
  • Rev. Fr. Tam Tran, Priest Silver Spring (USA)
  • Rev. Fr. Daniel Augustine Oppenheimer, CRNJ, Canons Prior of New Jerusalem Charles Town (USA)
  • Sister M. Regina Mietitore, Religious woman FI Alassio (Italy)
  • Sister M. Teresa Ortega, Religious woman FI Naga City (Philippines)
  • Sister M. Consolatrice Scozzare, Religious woman FI Red BanK (USA)
  • Mr. Antoni Bańkowski, Film Director Writer Łódź (Poland)
  • Rev. Fr. Fernando Pascual, Priest, Philosophy Professor Rome (Italy)
  • Rev. Fr. Ladislav Šofranko SJ, Priest Bratislava (Slovakia )
  • Rev. Fr. Francisco Javier Sánchez Pereira, Priest El Valle, Melegís (Spain)
  • Sister Maria Maddalena di Gasparro , Religious woman Rome (Italy)
  • Rev. Fr. Giuseppe Mascanzoni, Priest Verona (Italy)
  • Rev. Fr. Jaime Zegarra, Priest Tacna (Peru )
  • Rev. Fr. Jan Lamparski, Parish Priest Velburg (Germany )
  • Mrs. Jeanine Gilis, “31 years faithful divorced” Kontich (Belgium)
  • Conductor Humberto Jorge Aguilera, Lyric Singer and University Professor Aguascalientes (Mexico)
  • Prof. Ricardo Lara Colón, Science Professor Aguascalientes (Mexico)
  • Rev. Fr. Timothy Hufffman, Priest Steubenville (USA)
  • Rev. Fr. Bradley Greer, Priest Steubenville (USA)
  • Rev. Fr. Gilberto Díaz Alvarez , Priest San Luis Potosí (Mexico)
  • Rev. Anastasie Duma, Monk Giroc (Romania)
  • Sister M. Jesusa Ordineza, Religious woman FI Cebu (Philippines)
  • Sister M. Joan Grace Quisio , Religious woman FI San Isidro Leyte (Philippines)
  • Mr. Georges Buscemi, Presidente Québec-Vie Montréal (Canada)
  • Prof. Paulo Roberto Andrada Pacheco , University Professor, Psychologist Sao Paulo (Brazil)
  • Rev. Fr. Walmor Zucco, Dehonian Priest Sao Paulo (Brazil)
  • Rev. Don Carlos Ruiz, Priest Cadalso de los Vidrios (Spain)
  • Rev. Fr. Carlos Valerio Batista de Aguiar, Priest Saquarema (Brazil)
  • Prof. Márcio Andrade, University Professor Belo Horizonte (Brazil)
  • Prof. Rodrigo Konrath, University Professor São Carlos-SC (Brazil )
  • Jean Pierre Moreau, Writer and Journalist Troyes (France )
  • Prof. Augusto Merino, University Professor Santiago (Chile)
  • Prof. Diego Quiñones Estévez, Religion and Catholic Moral Professor, Writer Malaga (Spain)
  • Rev. Fr. Alessandro Fini, Priest Marano sul Panaro (Italy)
  • Prof. Maria José Batista Arenales, University Professor Presidente Prudente (Brazil)
  • Marcos Aurélio Câmara Portilho Castellanos , Federal Attorney São José dos Campos (Brazil)
  • Rev. Fr. Tobias Unnerstål, Parish Priest Gothenburg (Sweden)
  • Rev. Benedict Hardy, Monk Elgin (UK )
  • Prof. Pablo Ramos de Sá, Professor Brasilia (Brazil )
  • Rev. Fr. Robert Pasley, Priest Berlin, NJ (USA)
  • Prof. Mauricio Rohrer, Pedagogy Professor Concordia (Argentina)
  • Rev. Fr. Algirdas Dauknys, Parish Priest Panevezys (Lithuania )
  • Rev. Don Disán Vázquez, Priest Chihuahu (Mexico )
  • Prof. Richard Fell, University Professor, Physics Burlington (USA)
  • Alicia Bruno, Youth Pastoral Coordinator Barnegat (USA)
  • Rev. Fr. Dariusz Pudelko, Priest Snowidza (Poland)
  • Rev. Madre Maria Urdaneta , Religious woman Baybay, Leyte (Philippines)
  • Sister Maria Augustine Fernandez , Religious Lapu-Lapu City (Philippines)
  • Suor Rey-Ann Lourdes Agravante , Religious woman Bicol (Philippines)
  • Wolfgang Goderski, Religion Professor Brilon (Germany)
  • Rev. Fr. Adolphus Iroegbu , Priest Luxemburg (Luxemburg )
  • Religious Community “Mount Thabor Opus Maria (OMTOM)” , Akure, Ondo State (Nigeria)
  • Rev. Fr. Markus Schwald, Priest Candelaria (Philippines)
  • Sister Maria Edith Renfrew, Diocesan Hermit Arisaig (UK)
  • Prof. Maria Polo y Callejo , University Professor Perugia (Italy)
  • Prof. John Heard, Universitario Professor Kirksville (USA)
  • Mr. Dominick Azzara, Pastoral Assistant Clarksville ( USA)
  • Rev. Fr. Giampaolo Garatti, Priest Gallarate (Italy)
  • Prof. Ana Maria Jurado, Catechist and History Professor B.A. Cap.Fed. (Argentina)
  • Deacon William Strathmann , Deacon Pittsburgh (USA)
  • Maria Schultz, Pastoral Coordinator Lake City (USA)
  • Rev. Fr. Raimondo Sanfilippo , Priest Palermo (Italy)
  • Sister M. Coronacion Tigley, Religious woman FI Cebu City (Philippines)
  • Madre Viola Katalin Hegyi, Discalced Carmelite Budapest (Hungary)
  • Danja Kloibhofer , Religion Professor Neumarkt an der Ybbs (Austria)
  • Rev. Friar Rosarrio Joseph Mary Anbessa-Ebanks, Friar Gosport (UK)
  • Rev. Fr. Valero Martínez San Miguel, Priest Lima (Peru )
  • Rev. Fr. Francis Sasinowski, Priest St Aubin-Jersey (UK)
  • Rev. Fr. Daniel Hesko, Parish Priest Middletown (USA)
  • Rev. Canon Adrian Sequeira, Priest Rome (Italy)
  • Sister Maria Fatima Djegui, Religious woman Thio (Benin)
  • Rev. Fr. Carlos Augusto Mesa Posada, Priest Medellin (Colombia)
  • Mr. Alber Frick, Religion Professor Freiburg im Breisgau (Germany)
  • Deacon Thomas Voigt, Deacon Großharthau (Germany)
  • Rev. Don Yves-Marie Couët, Priest Loué (France)
  • Rev. Fr. Vaughn Treco, Priest-Chaplain Plymouth (USA)
  • Sister Maria of the Annunciation OCD, Carmelite Rydebäck (Sweden)
  • Rev. Fr. Lucas Simonutti, Priest Santa Fe (Argentina)
  • Rev. Friar Francis of Sorrowful and Immaculate Heart of Mary , Franciscan Hermit St. Mary’s (USA)
  • Rev. Fr. Andrew Knapik, Priest Cleveland, OH. (USA)

29 avril, 2018

Exorciste Exorcismes Où trouver en France un prêtre exorciste orthodoxe oriental ?

Classé dans : Non classé — andreadicaffa02 @ 9:31

 

http://exorciste87.over-blog.com/o%C3%B9-trouver-en-france-un-pr%C3%AAtre-exorciste-orthodoxe-oriental

 

Où trouver en France un Prêtre exorciste Orthodoxe Oriental ?

 

Publié le 10 Juin 2013 par Servus in Exorcismes, Prières de délivrance, prières de guérison, combat spirituel

Comment recourir aux services de prêtres compétents, formés et expérimentés appartenant à l’un ou l’autre Monastère d’une Eglise Orthodoxe-Orientale.(Tradition Syriaque Orthodoxe des Indes/ Malankare)

 

Comment recourir aux services de prêtres compétents, formés et expérimentés appartenant à l’un ou l’autre Monastère d’une Eglise Orthodoxe-Orientale.(Tradition Syriaque Orthodoxe des Indes/ Malankare)

 

 

 

Pour recourir aux Services pastoraux d’un Prêtre-exorciste de l’Eglise Syriaque-Orthodoxe- Francophone* en:

 

 

 

*Région Parisienne:

 

Relais Paroissial Ste Geneviève – Mar Thomas,

 

 

¤ Permanence d’un prêtre exorciste lors des Messes en Region Parisienne

¤Possibilité de visites à domicile en semaine et sur Rendez-vous.

 

Adresse de référence:

 

Monastère Syriaque de la Bse Vierge Marie, Mère de Miséricorde,

 

Brévilly

 

61300 CHANDAI.

 

Tel: 02.33.24.79.58

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Normandie et Nord-Ouest:

 

 

¤ Permanence d’un prêtre exorciste tous les weekend, le 22 et 29 de chaque mois.Pèlerinage à Notre-Dame de Miséricorde les premiers dimanches du mois.

¤Possibilité de visites à domicile en semaine et sur Rendez-vous.

 

Adresse:

 

Monastère Syriaque de la Bse Vierge Marie, Mère de Miséricorde,

 

Brévilly

 

61300 CHANDAI.

 

Tel: 02.33.24.79.58

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

Relais Paroissial St Michel

 

¤En fin de mois sur Rendez-vous à partir du 29

 

Adresse :

S/C Mme Henriette MARIE

45 Rue de la Marne CAEN

 

Tel: 02.33.24.79.58

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Bretagne et Pays de Loire:

 

Relais paroissial St Charbel,

 

¤Tous les jeudis suivant le 1er dimanche du mois, permanence d’un prêtre exorciste à NANTES de 9h à 17 h . Messe à 18h au

 

Groupe de Prière Saint Charbel,

 

46 Rue de la Fauvette. NANTES

 

¤Possibilité de visites à domicile en semaine et sur Rendez-vous.

 

Adresse de référence:

 

Association Inter-paroissiale N-D de la Très Ste Trinité

 

Maison Notre-Dame

 

Le Bourg

 

16560 JAULDES

 

Tel: 05.45.37.35.13

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Limousin, Poitou-Charente:

 

Paroisse Notre-Dame des Grâces / St Ubald

 

¤ Permanence d’un prêtre exorciste tous les

 

-2èmes et

 

-4èmes dimanches

 

du mois.

 

¤Possibilité de visites à domicile en semaine et sur Rendez-vous.

 

Adresse:

 

Maison Notre-Dame

 

Le Bourg

 

16560 JAULDES

 

Tel: 05.45.37.35.13

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Dordogne et Gironde:

 

Sanctuaire marial N-D de la Très Ste Trinité

 

 

 

¤ Permanence d’un prêtre exorciste tous les

 

-4èmes samedis du mois.

 

¤Possibilité de visites à domicile en semaine et sur Rendez-vous.

 

Adresse:

 

Ermitage St Colomban

 

Puyroudrier

 

24530 LA CHAPELLE FAUCHER

 

Tel: 05.45.37.35.13

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Midi Pyrénées:

 

Relais Paroissial Mar Grégorios de Parumala

 

¤ Permanence d’un prêtre exorciste lorsqu’il y a un

 

-5ème dimanche dans le mois.

 

¤Possibilité de visites à domicile autour de ce weekend et sur Rendez-vous.

 

 

 

Adresse de référence:

 

Maison Notre-Dame

 

Le Bourg

 

16560 JAULDES

 

Tel: 05.45.37.35.13

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Est de la France:

 

Relais Paroissial Sainte Odile

 

¤ Permanence d’un prêtre exorciste en alternance avec le Sud Est de la France un mois sur deux les

 

-3èmes dimanches du mois.(Appeler ou envoyer un mail pour obtenir les dates)

 

¤Possibilité de visites à domicile autour de ce weekend et sur Rendez-vous.

 

Adresse de référence:

 

Monastère Syriaque de la Bse Vierge Marie, Mère de Miséricorde,

 

Brévilly

 

61300 CHANDAI.

 

Tel: 02.33.24.79.58

 

ou: 06.48.89.94.89

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

*Sud-Est de la France

 

Relais paroissial St Irénée de Lyon,

 

¤ Permanence d’un prêtre exorciste en alternance avec l’Est de la France un mois sur deux les

 

-3èmes dimanches du mois.(Appeler ou envoyer un mail pour obtenir les dates)

 

¤Possibilité de visites à domicile autour de ce weekend et sur Rendez-vous.

 

Adresse de référence:

 

Maison Notre-Dame

 

Le Bourg

 

16560 JAULDES

 

Tel: 05.45.37.35.13

 

ou: 06.48.89.94.89

 

 

 

 

 

 

 

Pour nous écrire, toujours vous adresser à notre

 

Monastère Métropolitain:

 

Monastère Syriaque de la Bse Vierge Marie, Mère de Miséricorde,

 

Brévilly

 

61300 CHANDAI.

 

Tel: 02.33.24.79.58

 

Adresse courriels: asstradsyrfr@laposte.net

 

 

 

Pour rejoindre le Blog Généraliste de l’Eglise et, si vous le désirez, recevoir chaque jour prières et méditations , vous pouvez y accéder en un clic sur l’adresse suivante:http://paris.syro-orthodoxe-francophone.over-blog.fr/

 

et vous abonner à la « Newsletter »

 

 

 

*l’Eglise Syro-Orthodoxe- Francophone est une Eglise

 

Orthodoxe-Orientale, les services pastoraux de ses prêtres ne

 

sont pas payants. Les offrandes des fidèles sont libres et non

 

obligatoires. Toute toute offrande faite à l’Eglise donne droit à

 

une déduction des impôts à raison de 66°/° du revenu imposable.

Où trouver en France un Prêtre exorciste Orthodoxe Oriental ?

Partager cet article

0Enregistrer

Repost 0

 

4 juin, 2015

Vouloir guérir pensée de Frère Gérard Biron de l’ Ordre des Servites de Marie

Classé dans : Non classé — andreadicaffa02 @ 11:57

             Quand on est malade, il est normal de vouloir guérir. Cela est naturel. On utilise tous les moyens, on accepte tous les soins et tous les médicaments qui peuvent aider à la guérison.

En sachant qu’ils vont soutenir toutes les forces du corps qui travaillent à nous guérir de la maladie. De plus, il est fondamental d’apprendre à dynamiser ces forces de manière consciente.

Vouloir guérir est normal, puisqu’il est possible de guérir et que notre corps veut guérir. Le Seigneur Jésus, qui guérissait toute maladie ( Matthieu 4, 23 ), nous a révélé que Dieu veut toujours notre guérison. Il est Dieu de la vie. Vouloir guérir, c’est donc croire que tout notre corps tend vers la guérison.

C’est s’ouvrir à toutes les forces de vie qui sont en nous.  S’ouvrir à la force de guérison des traitements.  S’ouvrir à la force que nous donnent l’affection et le soutien de ceux et celles qui nous aiment et veulent que nous retrouvions la santé.

 S’ouvrir à la force que nous donnent la présence et le soutien de la communion des saints,  en particulier à la force et au soutien qui nous viennent de sainte Marie, la Mère du Seigneur et notre Mère,  et de saint Pérégrin, le Serviteur de Marie, qui a été guéri parce qu’il a cru que Jésus voulait et pouvait le guérir. Prier pour sa guérison, c’est donc naturel et normal.

Cela tient à notre foi dans la vie et dans l’amour du Christ pour nous.

Prier pour sa guérison, c’est croire qu’immense est la force de Jésus et de son Esprit. C’est croire que si on s’ouvre vraiment à cette force de Jésus, nous recevons une aide extraordinaire. Celle-ci s’ajoute à toutes les autres forces de vie qui luttent en nous et avec nous contre la maladie.

 Frère Gérard M. Biron servite de Marie

29 mars, 2015

Eglise catholique en Alsace

Classé dans : Non classé — andreadicaffa02 @ 4:54

 

pentecote 2015

rechercher sur le site :
Information de votre paroisse :
——– Choisissez votre paroisse ——–ACHENHEIMADAMSWILLERALBEALLENWILLERALTECKENDORFALTENACHALTENHEIMALTENSTADTALTKIRCHALTORFALTWILLERAMMERSCHWIHRAMMERTZWILLERANDLAUANDOLSHEIMAPPENWIHRARTOLSHEIMARTZENHEIMASCHBACHASPACHASPACH LE BASASPACH LE HAUTASSWILLERATTENSCHWILLERAUBUREAUENHEIMAVENHEIMAVOLSHEIMBAERENDORFBALBRONNBALDENHEIMBALDERSHEIMBALGAUBALLERSDORFBALSCHWILLERBALTZENHEIMBAN DE LA ROCHEBANTZENHEIMBAREMBACHBARRBARTENHEIMBARTENHEIM LA CHAUSSEEBASSEMBERGBATTENHEIMBATZENDORFBEBLENHEIMBEHLENHEIMBEINHEIMBELLAMAGNYBENDORFBENFELDBENNWIHRBERENTZWILLERBERG ET THALBERGBIETENBERGHEIMBERGHOLTZBERGHOLTZ-ZELLBERNARDSWILLERBERNARDVILLEBERNOLSHEIMBERNWILLERBERRWILLERBERSTETTBERSTHEIMBETSCHDORFBETTENDORFBETTLACHBETTWILLERBIBLISHEIMBIEDERTHALBIESHEIMBIETLENHEIMBILTZHEIMBILWISHEIMBINDERNHEIMBIRKENWALDBIRLENBACHBISCHHEIM CHRIST ROIBISCHHEIM ST LAURENTBISCHHOLTZBISCHOFFSHEIMBISCHWIHRBISCHWILLERBISELBISSERTBITSCHHOFFENBITSCHWILLER THANNBLAESHEIMBLANCHERUPTBLIENSCHWILLERBLODELSHEIMBLOTZHEIMBOERSCHBOESENBIESENBOLLWILLERBOLSENHEIMBOOFZHEIMBOOTZHEIMBOSSELSHAUSENBOSSENDORFBOURBACH LE BASBOURBACH LE HAUTBOURG BRUCHEBOURGHEIMBOUXWILLER 67BOUXWILLER 68BRECHAUMONTBREITENAUBREITENBACHBREITENBACH (68)BREMMELBACHBRETTENBREUSCHWICKERSHEIMBRINCKHEIMBRUEBACHBRUMATHBRUNSTATT S GEORGESBRUNSTATT STE ODILEBUETHWILLERBUHLBUHLBURBACHBURNHAUPT LE BASBURNHAUPT LE HAUTBUSCHWILLERBUSTBUSWILLERBUTTENCARSPACHCERNAYCHALAMPECHATENOISCHAVANNES SUR L’ETANGCLEEBOURGCLIMBACHCOLMAR – SAINT ANTOINECOLMAR – SAINT JOSEPHCOLMAR – SAINT LEONCOLMAR – SAINT PAULCOLMAR – SAINTE MARIECOLMAR – ST MARTINCOLMAR ST FRANCOIS D’ASSISECOLMAR-ST VINCENT DE PAULCOLROY LA ROCHECOSSWILLERCOURTAVONCRASTATTCROETTWILLERDACHSTEINDAHLENHEIMDAHLUNDENDAMBACHDAMBACH LA VILLEDANGOLSHEIMDANNEMARIEDAUBENSANDDAUENDORFDEHLINGENDESSENHEIMDETTWILLERDIDENHEIMDIEBOLSHEIMDIEDENDORFDIEFFENBACH AU VALDIEFFENBACH L. WOERTHDIEFFENTHALDIEFMATTENDIEMERINGENDIETWILLERDIMBSTHALDINGSHEIMDINSHEIM SUR BRUCHEDOLLERENDOMFESSELDONNENHEIMDORLISHEIMDOSSENHEIMDOSSENHEIM/ZINSELDRACHENBRONNDRULINGENDRUSENHEIMDUNTZENHEIMDUPPIGHEIMDURLINSDORFDURMENACHDURNINGENDURRENBACHDURRENENTZENDURSTELDUSENBACHDUTTLENHEIMEBERBACHEBERBACH SELTZEBERSHEIMEBERSMUNSTERECKARTSWILLERECKBOLSHEIMECKWERSHEIMEGLINGENEGUISHEIMEICHHOFFENELBACHELSENHEIMEMLINGENENGWILLERENSISHEIMENTZHEIMEPFIGERCKARTSWILLERERGERSHEIMERNOLSHEIMERNOLSHEIM-LES-SAVERNEERSTEINESCHAUESCHBACHESCHBACH AU VALESCHBOURGESCHENTZWILLERESCHWILLERETEIMBESETTENDORFEYWILLERFALKWILLERFEGERSHEIMFELDBACHFELDKIRCHFELLERINGFERRETTEFESSENHEIMFESSENHEIM LE BASFISLISFLAXLANDENFLEXBOURGFOLGENSBOURGFORSTFELDFORSTHEIMFORT LOUISFORTSCHWIHRFOUCHYFRANKENFRECONRUPTFRELANDFRIEDOLSHEIMFRIESENFRIESENHEIMFROENINGENFROESCHWILLERFROHMUHLFULLERENFURCHHAUSENFURDENHEIMGALFINGUEGAMBSHEIMGEISHOUSEGEISPITZENGEISPOLSHEIMGEISPOLSHEIM GAREGEISWASSERGEISWILLERGERSTHEIMGERTWILLERGEUDERTHEIMGILDWILLERGIMBRETTGINGSHEIMGOERLINGENGOERSDORFGOLDBACHGOMMERSDORFGOTTENHOUSEGOTTESHEIMGOUGENHEIMGOXWILLERGRANDFONTAINEGRASSENDORFGRAUFTHALGRENDELBRUCHGRENTZINGENGRESSWILLERGRIESGRIESBACHGRIESBACH AU VALGRIESHEIM PRES MOLSHEIMGRIESHEIM SUR SOUFFELGRUNENWALDGRUSSENHEIMGUEBERSCHWIHRGUEBWILLER – NOTRE-DAMEGUEBWILLER – SAINT LEGERGUEMARGUEVENATTENGUEWENHEIMGUMBRECHTSHOFFENGUNDERSHOFFENGUNDOLSHEIMGUNGWILLERGUNSBACHGUNSTETTHABSHEIMHACHIMETTEHAEGENHAGENBACHHAGENTHAL LE BASHAGENTHAL LE HAUTHAGUENAU – SAINT-GEORGESHAGUENAU – SAINT-JOSEPHHAGUENAU – SAINT-NICOLASHANDSCHUHEIMHANGENBIETENHARSKIRCHENHARTHOUSEHARTMANNSWILLERHATMATTHATTENHATTSTATTHAUSGAUENHECKENHEGENEYHEGENHEIMHEIDOLSHEIMHEIDWILLERHEILIGENBERGHEILIGENSTEINHEIMERSDORFHEIMSBRUNNHEITERENHEIWILLERHELFRANTZKIRCHHENFLINGENHENGWILLERHERBITZHEIMHERBSHEIMHERMERSWILLERHERRLISHEIMHERRLISHEIM P/COLMARHERSBACHHESINGUEHESSENHEIMHETTENSCHLAGHILSENHEIMHINDISHEIMHINDLINGENHINSBOURGHINSINGENHINTERFELDHIPSHEIMHIRSCHLANDHIRSINGUEHIRTZBACHHIRTZFELDENHOCHFELDENHOCHSTATTHOCHSTETTHOELSCHLOCHHOENHEIMHOERDTHOFFENHOHATZENHEIMHOHENGOEFTHOHFRANKENHEIMHOHRODHOHWILLERHOLTZHEIMHOLTZWIHRHOMBOURGHORBOURG WIHRHOUSSENHUNAWIHRHUNDSBACHHUNINGUEHUNSPACHHURTIGHEIMHUSSEREN LES CHATEAUXHUSSEREN WESSERLINGHUTTENDORFHUTTENHEIMICHTRATZHEIMILLFURTHILLHAEUSERNILLKIRCH GRAFF N DAMEILLKIRCH GRAFFENSTADENILLZACHIMBSHEIMINGENHEIMINGERSHEIMINGOLSHEIMINGWILLERINNENHEIMIRMSTETTISSENHAUSENISSENHEIMITTERSWILLERITTLENHEIMJEBSHEIMJETTERSWILLERJETTINGENJUNGHOLTZ-THIERENBACHKAIDENBOURGKALTENHOUSEKAPPELENKATZENTHALKAUFFENHEIMKAYSERSBERGKEFFENACHKEFFENDORFKEMBSKEMBS LOECHLEKERTZFELDKESKASTELKESSELDORFKIENHEIMKIENTZHEIMKIFFISKILSTETTKINDWILLERKINGERSHEIM – S. ADELPHEKINGERSHEIM – STE ELISABETHKINTZHEIMKIRCHBERGKIRCHHEIMKIRRBERGKIRRWILLERKLEINFRANKENHEIMKLEINGOEFTKLINGENTHALKNOERINGUEKNOERSHEIMKOESTLACHKOETZINGUEKOGENHEIMKOLBSHEIMKRAUTERGERSHEIMKRAUTWILLERKRIEGSHEIMKRUTHKUHLENDORFKUNHEIMKURTZENHOUSEKUTTOLSHEIMKUTZENHAUSENLA BROQUELA CLAQUETTELA PETITE PIERRELA VANCELLELA WALCKLA WANTZENAULABAROCHELALAYELAMPERTHEIMLAMPERTSLOCHLANDERSHEIMLANDSERLANGENSOULTZBACHLAPOUTROIELARGITZENLAUBACHLAUTENBACHLAUTENBACH-ZELLLAUTERBOURGLAUWLE BONHOMMELE HOHWALDLEIMBACHLEITERSWILLERLEMBACHLEUTENHEIMLEVONCOURTLEYMENLICHTENBERGLIEBENSWILLERLIEBSDORFLIEPVRELIGSDORFLIMERSHEIMLINGOLSHEIM S JEAN BAPTISTELINGOLSHEIM STE CROIXLINSDORFLINTHALLIPSHEIMLITTENHEIMLIXHAUSENLOBSANNLOCHWILLERLOGELBACH-WINTZENHEIMLOGELHEIMLOHRLORENTZENLUCELLELUEMSCHWILLERLUPSTEINLUTRANLUTTENBACH PRES MUNSTERLUTTERLUTTERBACHLUTZELHOUSEMACKENHEIMMACKWILLERMAENNOLSHEIMMAGNYMAGSTATT LE BASMAGSTATT LE HAUTMAISONSGOUTTEMALMERSPACHMANSPACHMARCKOLSHEIMMARIENTHALMARLENHEIMMARMOUTIERMASEVAUXMATTSTALLMATZENHEIMMEISTRATZHEIMMELSHEIMMEMMELSHOFFENMENSCHHOFFENMERKWILLER PECHELBRONNMERTZENMERTZWILLERMERXHEIMMETZERALMEYENHEIMMICHELBACHMICHELBACH LE BASMICHELBACH LE HAUTMIETESHEIMMINVERSHEIMMITSCHDORFMITTELBERGHEIMMITTELHAUSBERGENMITTELHAUSENMITTELSCHAEFFOLSHEIMMITTELWIHRMITTLACHMITZACHMODENHEIMMOERNACHMOLLAUMOLLKIRCHMOLSHEIMMOMMENHEIMMONSWILLERMONT STE ODILEMONTREUX JEUNEMONTREUX VIEUXMOOSCHMOOSLARGUEMORSBRONNMORSCHWILLERMORSCHWILLER LE BASMORTZWILLERMOTHERNMUESPACHMUESPACH LE HAUTMUHLBACH SUR BRUCHEMUHLBACH SUR MUNSTERMULHAUSENMULHOUSE – SACRE-COEURMULHOUSE – SS.PIERRE & PAULMULHOUSE BOURTZWILLERMULHOUSE DORN  S.FRANC.D’ASSISEMULHOUSE DORN S BARTHELEMYMULHOUSE DORN S LUCMULHOUSE DORNACH STE THERESEMULHOUSE ST ETIENNEMULHOUSE ST FRIDOLINMULHOUSE ST JEAN BOSCOMULHOUSE ST JOSEPHMULHOUSE STE GENEVIEVEMULHOUSE STE JEANNE D’ARCMULHOUSE STE MARIEMUNCHHAUSENMUNCHHOUSEMUNDOLSHEIMMUNSTERMUNTZENHEIMMUNWILLERMURBACHMUSSIGMUTTERSHOLTZMUTZENHOUSEMUTZIGNAMBSHEIMNATZWILLERNEEWILLERNEHWILLERNEUBOISNEUF BRISACHNEUGARTHEIMNEUHAEUSELNEUNHOFFENNEUNKIRCHNEUVE EGLISENEUWILLERNEUWILLER LA ROCHENEUWILLER LES SAVERNENIEDERALTDORFNIEDERBRONN LES BAINSNIEDERBRUCKNIEDERENTZENNIEDERHASLACHNIEDERHAUSBERGENNIEDERHERGHEIMNIEDERLAUTERBACHNIEDERMODERNNIEDERMORSCHWIHRNIEDERNAINIEDERROEDERNNIEDERSCHAEFFOLSHEIMNIEDERSEEBACHNIEDERSOULTZBACHNIEDERSTEINBACHNIFFERNORDHEIMNORDHOUSENOTHALTENOBENHEIMOBERBRONNOBERBRUCKOBERDORF (67)OBERDORF (68)OBERENTZENOBERHASLACHOBERHAUSBERGENOBERHERGHEIMOBERHOFFENOBERHOFFEN SUR MODEROBERKUTZENHAUSENOBERLARGOBERLAUTERBACHOBERMODERNOBERMORSCHWIHROBERMORSCHWILLEROBERNAIOBERROEDERNOBERSAASHEIMOBERSCHAEFFOLSHEIMOBERSOULTZBACHOBERSTEINBACHODERENODRATZHEIMOERMINGENOFFENDORFOFFENHEIMOFFWILLEROHLUNGENOHNENHEIMOHNHEIMOLTINGUEOLWISHEIMORBEYORBEY LES HUTTESORBEY PAIRISORSCHWIHRORSCHWILLEROSENBACHOSTHEIMOSTHOFFENOSTHOUSEOSTWALDOTTERSTHALOTTERSWILLEROTTMARSHEIMOTTROTTOTTWILLERPETERSBACHPETIT LANDAUPFAFFENHEIMPFAFFENHOFFENPFALZWEYERPFASTATTPFETTERHOUSEPFETTISHEIMPFULGRIESHEIMPLAINEPLOBSHEIMPREUSCHDORFPRINTZHEIMPUBERGPULVERSHEIMQUATZENHEIMRAEDERSDORFRAEDERSHEIMRAMMERSMATTRANGEN-MITTELKURTZRANRUPTRANSPACHRANSPACH LE BASRANSPACH LE HAUTRANTZWILLERRATZWILLERRAUWILLERREGUISHEIMREICHSFELDREICHSHOFFENREICHSTETTREIMERSWILLERREINHARDSMUNSTERREININGUEREIPERTSWILLERREITWILLERRETSCHWILLERRETZWILLERREUTENBOURGREXINGENRHINAURIBEAUVILLERICHTOLSHEIMRICHWILLERRIEDHEIMRIEDISHEIM – ST J. BAPTISTERIEDISHEIM – STE. AFRERIEDISHEIM N DAME PERP SECORIEDSELTZRIEDWIHRRIESPACHRIMBACH PRES GUEBWILLERRIMBACH PRES MASEVAUXRIMBACH-ZELLRIMSDORFRINGELDORFRINGENDORFRIQUEWIHRRITTERSHOFFENRIXHEIMRIXHEIM ILE NAPOLEONRODERENRODERNROESCHWOOGROGGENHOUSEROHRROHRWILLERROMAGNYROMANSWILLERROMBACHROMBACH LE FRANCROPPENHEIMROPPENTZWILLERRORSCHWIHRROSENAUROSENWILLERROSENWILLERROSHEIMROSSFELDROSTEIGROTHAUROTHBACHROTTROTTELSHEIMROUFFACHROUNTZENHEIMRUEDERBACHRUELISHEIMRUMERSHEIMRUMERSHEIM LE HAUTRUSSRUSTENHARTSAALESSAASENHEIMSAESSOLSHEIMSAINT AMARINSAINT BERNARDSAINT COSMESAINT HIPPOLYTESAINT JEAN SAVERNESAINT LOUIS – N.D. DE PAIXSAINT LOUIS – ST-LOUISSAINT LOUIS BOURGFELDENSAINT MARTINSAINT MAURICESAINT NABORSAINT PIERRESAINT PIERRE BOISSAINT ULRICHSAINTE CROIX EN PLAINESAINTE MARIE AUX MINESSALENTHALSALMBACHSANDSARRE UNIONSARREWERDENSAULXURESSAUSHEIMSAVERNESCHAEFFERSHEIMSCHAFFHOUSESCHAFFHOUSE SUR ZORNSCHALKENDORFSCHARRACHBERGHEIMSCHEIBENHARDSCHERLENHEIMSCHERWILLERSCHILLERSDORFSCHILTIGHEIM – STE FAMILLESCHILTIGHEIM IMM. CONCEPTIONSCHIRLENHOFSCHIRMECKSCHIRRHEINSCHLEITHALSCHLIERBACHSCHNERSHEIMSCHOENAUSCHOENBOURGSCHOENENBOURGSCHOPPERTENSCHWABWILLERSCHWARTZBACHSCHWEBWILLERSCHWEIGHOUSESCHWEIGHOUSE PRES THANNSCHWEIGHOUSE S/MODERSCHWENHEIMSCHWINDRATZHEIMSCHWOBENSCHWOBSHEIMSEEBACHSELESTAT NOTRE DAME DE PAIXSELESTAT ST GEORGESSELTZSENGERNSENTHEIMSEPPOIS LE BASSEPPOIS LE HAUTSERMERSHEIMSESSENHEIMSEWENSICKERTSIEGENSIERENTZSIEWILLERSIGOLSHEIMSILTZHEIMSINGRISTSONDERNACHSONDERSDORFSOPPE LE BASSOPPE LE HAUTSOUFFELWEYERSHEIMSOUFFLENHEIMSOULTZSOULTZ LES BAINSSOULTZ SOUS FORETSSOULTZBACH LES BAINSSOULTZERENSOULTZMATTSPACHBACHSPECHBACH LE BASSPECHBACH LE HAUTST BLAISE LA ROCHEST LOUIS LA CHAUSSEE S PIERRESTAFFELFELDENSTAFFELFELDEN ROSSALMENDSTAMPOUMONTSTATTMATTENSTE CROIX AUX MINESSTE MARIE MINES – ST LOUISSTEIGESTEINBACHSTEINBOURGSTEINBRUNN LE BASSTEINBRUNN LE HAUTSTEINSELTZSTEINSOULTZSTERNENBERGSTETTENSTILLSTORCKENSOHNSTOSSWIHRSTOTZHEIMSTRASBOURG – BON PASTEURSTRASBOURG – CATHEDRALESTRASBOURG – ELSAUSTRASBOURG – N.D. LOURDESSTRASBOURG – SACRE COEURSTRASBOURG – ST CHRISTOPHESTRASBOURG – ST JEAN BAPTISTESTRASBOURG – ST JEAN BOSCOSTRASBOURG – ST LOUISSTRASBOURG – ST VINCENT PAULSTRASBOURG – STE MADELEINESTRASBOURG – T. STE TRINITESTRASBOURG CHRIST RESSUSCITESTRASBOURG ROB. – ST LOUISSTRASBOURG ST ALOYSESTRASBOURG ST AMANDSTRASBOURG ST ANTOINESTRASBOURG ST ARBOGASTSTRASBOURG ST BENOITSTRASBOURG ST BERNARDSTRASBOURG ST FLORENTSTRASBOURG ST IGNACESTRASBOURG ST JOSEPHSTRASBOURG ST LEONSTRASBOURG ST MAURICESTRASBOURG ST PIERRE LE JEUNESTRASBOURG ST PIERRE VIEUXSTRASBOURG ST URBAINSTRASBOURG STE BERNADETTESTRASBOURG STE JEANNE D’ARCSTRUETHSTRUTHSTUNDWILLERSTUTZHEIMSUNDHOFFENSUNDHOUSESURBOURGTAGOLSHEIMTAGSDORFTHALTHANNTHANNENKIRCHTHANVILLETIEFFENBACHTRAENHEIMTRAUBACH LE BASTRAUBACH LE HAUTTRIEMBACH AU VALTRIMBACHTROIS EPISTRUCHTERSHEIMTURCKHEIMUBERACHUEBERSTRASSUFFHEIMUFFHOLTZUHLWILLERUHRWILLERUNGERSHEIMURBEISURBESURMATTURSCHENHEIMUTTENHEIMUTTENHOFFENUTTWILLERVALFFVENDENHEIMVIEUX FERRETTEVIEUX THANNVILLAGE NEUFVILLEVOEGTLINSHOFFENVOELLERDINGENVOGELGRUNVOLGELSHEIMVOLKSBERGWACKENBACHWAHLBACHWAHLENHEIMWALBACHWALBOURGWALDHAMBACHWALDIGHOFFENWALDOLWISHEIMWALHEIMWALTENHEIMWALTENHEIM SUR ZORNWANGENWANGENBOURG-ENGENTHALWASSELONNEWASSERBOURGWATTWILLERWECKOLSHEIMWEGSCHEIDWEILERWEINBOURGWEISLINGENWEITBRUCHWEITERSWILLERWENGELSBACHWENTZWILLERWERENTZHOUSEWESTHALTENWESTHOFFENWESTHOUSE MARMOUTIERWESTHOUSE PRES BENFELDWETTOLSHEIMWEYERWEYERSHEIMWICKERSCHWIHRWICKERSHEIMWIDENSOLENWIHR AU VALWILDENSTEINWILDERSBACHWILLERWILLER SUR THURWILLGOTTHEIMWILSHAUSENWILWISHEIMWIMMENAUWINGENWINGEN SUR MODERWINGERSHEIMWINKELWINTERSHOUSEWINTZENBACHWINTZENHEIMWINTZENHEIM (68)WINTZFELDENWISCHESWISSEMBOURGWITTELSHEIM – S. MICHELWITTELSHEIM AMELIE II CH ROWITTELSHEIM GRAF. N.D. ROS.WITTELSHEIM LANGENZUGE J.BOSWITTENHEIM – SAINTE BARBEWITTENHEIM – SAINTE MARIEWITTENHEIM FERN. ANNA S.CHRWITTENHEIM JEUNE BOISWITTERNHEIMWITTERSDORFWITTERSHEIMWITTISHEIMWIWERSHEIMWOELLENHEIMWOERTHWOLFERSDORFWOLFGANTZENWOLFISHEIMWOLFSKIRCHENWOLSCHHEIMWOLSCHWILLERWOLXHEIMWUENHEIMZAESSINGUEZEHNACKERZEINHEIMZELLENBERGZELLWILLERZELSHEIMZILLISHEIMZIMMERBACHZIMMERSHEIMZINSWILLERZITTERSHEIMZOEBERSDORFZUTZENDORF
AGENDA DES MANIFESTATIONS
Mars2015
L Ma Me J V S D
23 24 25 26 27 28 1
2 3 4 5 6 7 8
9 10 11 12 13 14 15
16 17 18 19 20 21 22
23 24 25 26 27 28 29
30 31 1 2 3 4 5
NOTRE ÉMISSION RADIO
btn radio rencontre 2

Écoutez Rencontre Catholique dans son intégralité
Retrouvez les anciennes émissions

btn webtv

btn projet diocesain2014

1000ans-cathedrale

maladies curie

Eglise catholique en Alsace btn_actualites

Déclarations de l'Evêque

Don en ligne

Newsletter

btn messesinfos

Partez en pélerinage

Église Catholique en France

www.eglise.catholique.fr

www.eglisse.catholique.fr

btn rencontrer-jesus

btn findevie

btn_blogBioethique

www.eglisse.catholique.fr

Vous êtes ici : Accueil

banniere-a-la-une

Prions aux intentions de l’Église Universelle :
- Prions pour que, en cette année dédiée à la vie consacrée, les religieuses et les religieux redécouvrent la joie de suivre le Christ et s’engagent avec zèle au service des pauvres.

Prions pour l’évangélisation :
- Prions pour que tous les croyants et tous les hommes de bonne volonté collaborent à la paix.

Mgr Martin Bogner, vicaire général, est décédé subitement

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 13:28 Publié le vendredi 27 mars 2015 10:08

martin bogner webMgr Martin Bogner, vicaire général du diocèse de Strasbourg, est décédé subitement jeudi 26 mars aux environs de 17h, victime d’un arrêt cardiaque, alors qu’il trouvait dans la salle d’attente de son cardiologue pour un rendez-vous médical. Les pompiers appelés d’urgence n’ont pas réussi le sauver.

Mgr Grallet, archevêque de Strasbourg actuellement à Lourdes pour la Conférence des évêques de France a appris avec énormément de tristesse la nouvelle, perdant un compagnon fidèle et précieux, portant la responsabilité, entre autre, des ressources humaines du diocèse.

Les obsèques de Mgr Bogner seront présidées par Mgr Grallet le mercredi 1er avril à 14h30 en la cathédrale de Strasbourg. L’inhumation suivra au cimétière de Aschbach.

Monseigneur Martin BOGNER, né le 27 janvier 1949 à Aschbach, de parents cultivateurs.

Messe chrismale : le mardi 31 mars à 18h30

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:46 Publié le vendredi 27 mars 2015 14:15

messechrismaleLa messe chrismale sera célébrée le mardi 31 mars à 18h30 en la cathédrale de Strasbourg.

Bernard Xibaut en précise la signification.

Parmi les célébrations de la Semaine Sainte figure à une place originale celle de la Messe chrismale. Elle a ceci de particulier qu’elle est unique dans chaque diocèse et qu’elle doit être célébrée en principe le matin du Jeudi Saint, sachant qu’il est possible, pour des raisons pastorales, de l’anticiper à un autre jour de la Semaine Sainte. Dans notre diocèse, elle est célébrée le soir du Mardi Saint.

Trois points méritent d’être particulièrement éclaircis car ils sont souvent mal compris :

5è centenaire de la naissance de Sainte Thérèse d’Avila

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:57 Publié le vendredi 27 mars 2015 09:52

thérès davilaL’Ordre du Carmel déchaussé célèbre le samedi 28 mars le cinquième centenaire de la naissance de sa fondatrice, Sainte Thérèse de Jésus, Docteur de l’Eglise, plus connue sous le nom de Sainte Thérèse d’Avila.

Le Carmel de Marienthal invite à fêter cet anniversaire lors d’une célébration eucharistique au Carmel le samedi 28 mars à 8h15.

Vivre les jours saints avec les séminaristes

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:40 Publié le vendredi 27 mars 2015 14:40

triduum seminaireTu es un jeune homme de plus de 17 ans et souhaites vivre durant les trois jours les plus importants de l’année chrétienne un moment fort de prière d’enseignement et de vie fraternelle joyeuse en compagnie des futurs prêtres du diocèse de Strasbourg. Viens rejoindre les séminaristes du jeudi saint au dimanche de Pâques.

Ce temps fort se déroule au Grand Séminaire Sainte Marie Majeure de Strasbourg et les offices sont célébrés à la cathédrale Notre-Dame de Strasbourg autour de notre archevêque.

Du jeudi 2 avril à 18h au dimanche 5 avril après le déjeuner. Libre participation aux frais

Inscription auprès du P. Didier Dehan 2 rue des Frères à Strasbourg. Tél : 03 88 36 03 28

Après un tiers de millénaire, demeurer ensemble

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:56 Publié le vendredi 27 mars 2015 14:44

respirePour le vendredi Saint, 3 avril, les deux communautés proposent un chemin de croix oecuménique à 12h départ de Saint-Pierre-le -Jeune protestant, étape au temple Neuf et arrivée à la cathédrale à 13h. Ce même jour à 18h30 Respire, une heure ailleurs propose une médiattion sur le vendredi saint, le déchirement du monde.

Ecouter l’interview de Rudi Popp, pasteur du temple Neuf

Méditation autour de la Semaine Sainte

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 16:00 Publié le vendredi 27 mars 2015 14:24

semainesainteEn ouverture de la Semaine Sainte, nous vous proposons la méditation de François Wernert, curé de Saint-Nicolas et de Saint Joseph à Haguenau :

26 décembre, 2014

l’ouvrage de Bernard Vignot un gps très utile …pour ne pas se tromper de chemin

Classé dans : Non classé — andreadicaffa02 @ 10:06
www.religion.info : Religioscope
 
News.Conferences.Archives.FAQ.Site Map.Mailing List.Contact
English Homel'ouvrage de Bernard Vignot un gps très utile ...pour ne pas se tromper de chemin  horizontalblueFrançais: Accueil
pixelConférences.Archives.FAQ.Plan.Liste de Diffusion.Liens.Contact

french:Articles
Livre: le phénomène des évêques indépendants
pixel
Jean-François Mayer
10 Apr 2011

A l’occasion de la récente parution du nouveau livre de Bernard Vignot sur les «Eglises parallèles», un compte rendu de celui-ci et quelques réflexions sur les communautés épiscopales indépendantes, en élargissant le regard vers le monde anglophone.

0527_vignot

Tous les chercheurs de langue française qui s’intéressent aux groupes religieux constitués autour d’évêques indépendants des Eglises historiques, connaissent le nom de Bernard Vignot. Et les responsables de ces communautés aussi! Depuis plusieurs dizaines d’années, Bernard Vignot prête attention aux évolutions (en France) de ce petit milieu dont il a acquis une connaissance encyclopédique. Dès les années 1970, il a publié, sous forme polycopiée et à compte d’auteur, plusieurs répertoires de «petites Eglises catholiques non romaines», puis également orthodoxes, bien utiles pour les curieux en quête de renseignements sur ces groupes.

En 1991, Bernard Vignot avait publié un petit volume introductif sur Les Eglises parallèles aux Editions du Cerf. C’est chez le même éditeur qu’est paru un nouvel ouvrage de même nature,Le phénomène des Eglises parallèles. Celui-ci s’inscrit dans la ligne de ses publications antérieures. Il s’ouvre par quelques anecdotes pour faire entrer le lecteur dans le petit monde des évêques indépendants qui sont au coeur de ces initiatives — puisque le principe de la succession apostolique est fortement mis en avant dans ces groupes: seul un évêque consacré par d’autres évêques et pouvant ainsi, en théorie, faire remonter leur ligné jusqu’aux apôtre du 1er siècle de l’ère chrétienne peut validement ordonner des prêtres, et seuls des prêtres validement ordonnés peuvent ensuite, selon la compréhension traditionnelle des Eglises catholiques et orthodoxes, célébrer l’Eucharistie.

Evêques indépendants et succession apostolique

Ce qui frappe souvent, dans ces communautés épiscopales indépendantes, est une compréhension de la succession apostolique et des consécrations épiscopales dans un sens que des observateurs qualifient de «mécanique»: du moment que la lignée existe et que la consécration de l’évêque a été effectuée en respectant toutes les formes rituelles, elle est «valide»; tous les actes qui en découleront (ordinations de prêtres, etc.) seront donc également valides. Ce qui devient crucial, dans cette perspective, est la solidité «formelle» de la succession apostolique: cela a conduit certains évêques indépendants à se faire reconsacrer plusieurs fois, sub conditione, afin de cumuler des successions et de créer ainsi une succession incontestable (il explique même des cas d’ordinations sub conditione réciproques). Illustration pittoresque: l’évêque indépendant américain Lewis Keizer, évêque président du Home Temple et promoteur d’approches assez originales, a excommunié Benoît XVI en 2010 (en raison des condamnations de ce dernier contre les ordinations de femmes) et, procédant à cet acte dans sa chapelle, souligne: «Je suis un évêque indépendant avec vingt-deux lignages de succession apostolique valides, même plus de lignages de succession que le Pape, car les miens incluent des lignages dit hérétiques.»

A l’opposé, dans les Eglises historiques, les critiques de cette approche de la succession apostolique estiment qu’elle réduit celle-ci à une automaticité liée uniquement aux formes, voire en font une opération « magique »: ils soutiennent que la succession apostolique n’a de sens que dans la communion de l’Eglise et au service de celle-ci, un épiscopat à l’usage d’un individu et « propriété » de celui-ci se trouvant dénué de toute valeur. L’approche de bien des évêques indépendants est liée à une notion de l’épiscopat et du sacerdoce comme conférant des «pouvoirs» (cf. pp. 74-75), un aspect important pour des évêques et prêtres indépendants exerçant des activités d’exorcistes et guérisseurs.

0527_vilatte
Mgr Joseph-René Vilatte (1854-1929)

Quoi qu’il en soit, par suite de diverses circonstances dans le détail desquelles nous ne pouvons entrer ici, des évêques ont, à différents moments de l’histoire, pris l’initiative de consacrer à l’épiscopat des personnages qui, par la suite, ont entamé des carrières indépendantes et ont, dans certains cas, eu une abondante progéniture épiscopale, chacun de ces évêques en créant d’autres à leur tour. L’un des cas les plus connus a été celui, de Mgr Joseph-René Vilatte (1854-1929), auquel Bernard Vignot consacre légitimement une section (pp. 49-60), à côté de la biographie de deux autres figures importantes de l’histoire de ces courants. Il émigre au Canada, se rapproche du protestantisme, puis adhère au courant vieux-catholique (né en opposition aux orientations dominantes du catholicisme romain de l’époque et à la proclamation de l’infaillibilité pontificale à l’époque du concile Vatican I), y est ordonné prêtre, puis est sacré évêque en 1892 à Ceylan par un évêque syro-jacobite, avant de se lancer dans des tentatives de création de mouvements catholiques indépendants et de procéder à la consécration de plusieurs évêques.

Il arrive que des évêques catholiques romains procèdent à des consécrations indépendantes: un cas connu a été celui de Mgr Pierre Martin Ngo Dinh Thuc (1897-1984), ancien archevêque de Hué (Vietnam), qui a sacré plusieurs personnages appartenant à des mouvances traditionalistes, ceux-ci ayant à leur tour une postérité épiscopale.

Quelques traits caractéristiques des «Eglises parallèles»

Pour en venir à l’ouvrage de Vignot, certaines parties sont écrites dans un style plus fluide que d’autres (par exemple le chapitre IV). Dans les premières pages, les divisions des paragraphes ne semblent pas toujours des plus logiques. La construction aurait probablement pu être pensée plus rigoureusement. La bibliographie est abondante (pp. 117-127), mais aurait pu être organisée plus clairement. Quant à la liste non exhaustive des Eglises parallèles (pp. 99-105), elle offre un joli florilège de dénominations, mais il aurait été judicieux de préciser que certains des groupes cités n’existent plus.

Cela n’ôte rien à l’intérêt des anecdotes et réflexions que Bernard Vignot partage avec nous, car elles reposent sur une expérience sans équivalent dans le monde francophone. Le ton de l’ouvrage montre qu’il est notamment pensé par rapport à des préoccupations pastorales: c’est d’ailleurs un évêque catholique qui en donne la préface (Bernard Vignot, pour sa part, est prêtre de l’Eglise vieille-catholique - Union d’Utrecht). Les observations partagées par Vignot sont cependant utiles également pour une approche plus sociologique.

Bernard Vignot souligne l’insistance de beaucoup de ces groupes sur le fait que leurs ordinations sont valides, à défaut d’être licites (pp. 68-73). Mais licites ou illicites par rapport à qui? Par rapport à l’Eglise catholique romaine, prise comme référence. Il ne manque pas, en effet, d’évêques indépendants qui rêvent d’être intégrés par Rome, avec reconnaissance de leur épiscopat et sacerdoce. Rêve difficilement réalisable — mais il existe des cas de figures du monde des évêques indépendants qui ont réussi à être intégrés dans des Eglises historiques: l’on se souvient par exemple du cas de Mgr Johannes Van Assendelft (1923-2008), qui se rallia, après une longue carrière dans le milieu des «Eglises parallèles» (y devenant évêque dans les années 1950), à l’Eglise copte, dans laquelle il fut consacré évêque en 1974. Mais de tels cas sont rares.

La dépendance psychologique par rapport à une référence romaine à l’aune de laquelle l’on juge de la validité de son propre épiscopat semble étrange — même s’il est vrai qu’il existe aussi quelques cas d’Eglises épiscopales indépendantes qui s’engagent délibérément dans un chemin propre, sans rêve d’union avec Rome. Mais dans nombre d’entre elles, en France notamment, le visiteur peut même trouver une photographie du Pape bien en évidence: autant dire qu’une personne peu informée ne se rendra pas vraiment compte du statut du groupe (p. 85). Vignot y voit une manière de «calmer les inquiétudes de leurs fidèles» (p. 69): la plupart de ceux-ci ne viennent pas dans de telles chapelles, en effet, parce qu’ils voudraient rompre avec l’Eglise romaine, mais parce qu’ils sont en quête d’un lieu où ils seront écoutés, où ils pourront recevoir des bénédictions, éventuellement un exorcisme, ou encore en quête d’un prêtre disposé à célébrer le remariage de personnes divorcées.

Il s’agit donc rarement de groupes avec une doctrine originale, ni d’ailleurs un clergé bien formé: Vignot souligne qu’il ne manque pas, dans ces milieux, d’hommes qui avaient aspiré à devenir prêtres, mais, pour différentes raisons, n’ont pu réaliser cette aspiration, et ayant plus d’une fois exercé des professions sans qualifications élevées. Là encore, bien sûr, il y a des exceptions.

En outre, le milieu des évêques indépendants est loin d’être homogène. Il convient de veiller à ne pas les réduire à un modèle unique. Il en est qui souhaitent avant tout cultiver un type de piété populaire. D’autres groupes se forment autour de visions ou messages (c’est le cas de l’Eglise catholique palmarienne, en Espagne, autour d’un pape espagnol, et maintenant de son successeur, pour ne citer que cet exemple). Certains «prélats» indépendants manifestent un goût prononcé pour l’occultisme et autres doctrines secrètes (ainsi, à l’enseigne de «spécialiste et conseil en exorcisme», l’un — très actif — donne des cours sur la Kabbale, le magnétisme personnel, la bio-respiration, et même la création d’un élémental servant ou «esprit familier»…).

Un autre point à noter: il existe des groupes qui attirent un nombre de fidèles substantiels, comme l’Eglise Sainte-Marie du Mont-Saint-Aignan, près de Rouen, dirigée par Mgr Maurice Cantor, un ancien bénédictin et prêtre de paroisse catholique romain, dont la communauté se veut «une Eglise autocéphale de tradition catholique au service d’un accueil pastoral pour tous»; bien d’autres, en revanche, restent très petits (ce qui n’empêche pas de multiplier les ordinations), et ont parfois plutôt un public de «clients», en quête de bénédictions et exorcismes.

La question que l’on peut poser, en refermant le livre de Bernard Vignot et en réfléchissant à ce monde dans lequel il nous fait entrer, est de savoir s’il y a d’autres angles d’approche possibles? Et aussi dans quelle mesure le terrain français est semblable, ou se distingue au contraire, du milieu des évêques indépendants dans d’autres pays?

Evêques indépendants… Eglises parallèles… quelle étiquette?

Avant d’aller plus loin, quelques remarques rapides sur le vocabulaire. Dans les cercles francophones spécialistes des minorités religieuses, l’on avait d’abord parlé d’Eglises et évêque catholiques non romains, selon le titre d’un ouvrage publié en 1962 par Ivan Drouet de la Thibauderie, lui-même évêque indépendant. Quant au P. Chéry, un dominicain qui mena dans les années 1950 une remarquable et vaste enquête sur les mouvements religieux minoritaires en France, il parlait semblablement, mais avec un adjectif, de «petites Eglises françaises ‘catholiques non romaines’» (L’Offensive des Sectes, 3e éd., Paris, Ed. du Cerf, 1961, p. 471). L’expression de «petites Eglises catholiques non romaines» fut consacrée par la publication de l’érudit article de Jean-Michel Hornus utilisant cette expression comme titre de son article en deux parties dans la Revue d’histoire et de philosophie religieuse (50/2 et 3, 1970).

Dans ses répertoires polycopiés des années 1980, Vignot parlait de «petites Eglises catholiques non romaines et orthodoxes non canoniques», tenant compte d’un nombre croissant de groupes se référant à l’héritage orthodoxe. Son livre de 1991 introduit dans le discours sur le sujet le terme d’Eglises parallèles, qui présente l’avantage de la concision. Il ne l’utilise cependant pas comme titre de ses fascicules, Dans les années 1990, une nouvelle série de répertoires utilise l’expression neutre d’«Eglises et communautés indépendantes d’origine catholique». Puis les répertoires des années 2000, préparés en coopération avec Marc Béret-Allemand, parlent d’Eglises et de communautés sans liens canoniques avec les Eglises catholiques et orthodoxes.

Chacune de ces expressions met l’accent sur une facette du sujet, tout en soulignant le rapport généalogique de ces groupes (ou plus exactement de leur épiscopat, à l’origine) avec les grandes Eglises historiques à structure épiscopale. Chacune révèle aussi des efforts pour essayer d’adopter une désignation si possible «neutre». Bien entendu, chaque étiquette pourrait aussi être soumise à discussion.

Dans le présent compte rendu, l’expression «évêques indépendants» a été utilisée à plusieurs reprises, comme une tentative de plus de cerner le sujet de façon adéquate et n’impliquant pas d’emblée un jugement de valeur; dans la même ligne, l’on pourrait parler de communautés (ou Eglises) épiscopales indépendantes. Il n’est pas sûr que ce soit la meilleure solution. Mais elle a été inspirée par les travaux de John P. Plummer, un évêque indépendant américain, qui a produit quelques intéressants ouvrages pour essayer d’analyser les mouvements qui retiennent ici notre attention — à partir d’un contexte américain, religieusement pluraliste au départ, ce qui permet de proposer un angle un peu différent d’une approche française. Plummer a également parlé de «mouvement sacramentel indépendant»: un indice de plus d’une étiquette adéquate qui se cherche.

Regard comparatif sur le monde anglophone

Dans un petit volume intitulé Who Are the Independent Catholics? An Introduction to the Independent and Old Catholic Churches (Berkeley, Apocryphile Press, 2006), John Plummer et un co-auteur, John R. Mabry, ont voulu répondre au besoin d’une introduction simple et pour un large public, à un moment où, selon eux, le mouvement catholique indépendant se développe aux Etats-Unis. Ils distinguent quatre types de catholiques indépendants: les libéraux, les traditionalistes, les ésotéristes et les syncrétistes. Ce qui fait une Eglise catholique, selon eux, est l’adhésion aux confessions de foi historiques (bien qu’ils reconnaissent qu’il peut en exister des interprétations variées), la pratique des sept sacrements, un clergé avec des diacres, des prêtres et des évêques, et enfin une succession apostolique ininterrompue. Les groupes catholiques indépendants répondraient à ceux qui se sentent éloignés des grandes Eglises ou rejetés par elles. Selon sa sensibilité, un public souhaitant des formes liturgiques d’inspiration catholique pourrait donc trouver chez tel ou tel prêtre indépendant la réponse à ses besoins ou la célébration d’une cérémonie. Les auteurs soulignent qu’il faut aussi savoir exercer discernement et prudence en s’adressant à des membres de clergés «catholiques indépendants», mais comme on le ferait dans n’importe quel autre cadre: l’image qui ressort est avant tout celle de personnes désireuses de servir les fidèles. L’impression donnée paraît donc différente de celle transmise par Bernard Vignot, tout en laissant le lecteur désireux d’en savoir un peu plus. Mais voyons cela de plus près.

Plummer avait écrit précédemment un autre ouvrage, The Many Paths of the Independent Sacramental Movement. A National Study of Its Liturgy, Docrtine and Leadership (Berkely, Apocryphile Press, 2005). Etude plus volumineuse et de type universitaire, elle permet, avec le récit de nombreuses visites dans des communautés indépendantes américaines, de pénétrer dans leur atmosphère, avec des développements qui mènent à vrai dire parfois assez loin du catholicisme classique. Il reconnaît que le milieu indépendant n’a pas encore beaucoup développé une réflexion théologique propre, mais, en mettant l’accent sur les groupes les plus innovateurs, notamment dans un sens gnostique ou ésotérique, il soutient qu’il contient des éléments potentiellement originaux. Comme Vignot, Plummer reconnaît que beaucoup de membres du clergé indépendant n’ont pas eu de véritable formation et ont acquis leurs connaissances aux côtés d’un mentor, prêtre ou évêque, qu’ils ont assisté. Mais cela n’a pas empêché certains d’entre eux d’avoir une action pastorale de valeur, estime-t-il. L’impression qui se dégage de son étude est celle d’une «diversité anarchique», selon sa propre expression, mais en même temps d’un espace créatif: il resterait à voir si cette évaluation est liée aux différences du contexte américain, ou au regard plutôt sympathique que Plummer porte sur la mouvance à laquelle il appartient lui-même.

0527_strange_vocation

Il existe un autre livre fascinant sur le milieu des évêques indépendants américains: celui d’Alistair Bate, A Strange Vocation. Independent Bishops Tell Their Stories (Berkeley, Apocryphile Press, 2009). Comme l’indique le titre, Alistair Bate, lui-même «évêque indépendant», a pris l’initiative de donner la parole à dix-sept évêques indépendants (la plupart aux Etats-Unis) pour leur permettre de raconter leur histoire. Le recueil n’a pas de prétention représentative: les personnages aux inclinations ésotériques y sont probablement surreprésentés, mais il est éclairant par la richesse de ces itinéraires.

L’éclectisme ressort de beaucoup de témoignages, à commencer par celui de Bate lui-même: il est élevé dans un milieu anglican irlandais, a ensuite des aspirations monastiques, fréquente une variété peu commune des groupes religieux; tout en étant évêque de l’Eglise catholique apostolique libérale, il lui arrive d’exercer un ministère dans une communauté unitarienne (des chrétiens qui n’acceptent pas le dogme de la Trinité et se signalent par des orientations très libérales) ou de donner des cours sur la spiritualité druidique et celtique. Mais il accorde à titre personnel une forte importance à la dimension sacramentelle. Il explique vivre — modestement — de son ministère en Grande-Bretagne, surtout de la célébration de funérailles. Il est peu probable que beaucoup d’évêques indépendants en France puissent dire la même chose. Quoi qu’il en soit, avec Bate et nombre de ses collègues, nous nous trouvons face à de typiques itinéraires de seekers, de chercheurs spirituels — itinéraires qui ne sont d’ailleurs probablement pas encore terminés.

Dans la même ligne de réflexion, plusieurs de ces évêques s’étaient doctrinalement éloignés des interprétations du christianisme telles qu’on les trouve dans le catholicisme romain, les Eglises orthodoxes ou l’anglicanisme traditionnel, mais ressentaient en même temps la nostalgie ou le besoin d’un cadre liturgique ou sacramentel: la voie choisie leur permet de combiner ce qui resterait sinon inconciliable. L’épiscopat indépendant permet de choisir une voie «sur une mesure», en quelque sorte.

Un autre aspect qui frappe est le nombre de ces évêques qui admettent être homosexuels et pour lesquels l’orientation sexuelle a quelques liens avec la voie choisie. L’on sait depuis longtemps que les cas d’homosexuels ne sont pas rares dans le milieu des évêques indépendants, mais aujourd’hui, surtout en contexte nord-américain, l’admettre n’est plus un obstacle dans certains milieux. Dans le contexte français, il est bien connu qu’il en existe plusieurs cas aussi, mais ils semblent généralement plus enclins à cultiver une certaine discrétion sur leurs «préférences sexuelles». Au fur et à mesure de l’évolution du statut public des homosexuels, cependant, cela va probablement changer: dans le dernier Annuaire d’Eglises et de communautés sans liens canoniques avec les Eglises orthodoxes(2009) de Bernard Vignot et Marc Béret-Allemand, on trouve une annexe de Jean Vilbas à ce sujet, sous le titre « En quête d’une pleine catholicité: catholiques indépendants et inclusivité » (texte dans lequel il admet d’ailleurs que ce thème occupe encore peu de place ouvertement dans les «petites Eglises» en France).

L’on observe à travers les témoignages recueillis par Bate une grande fluidité dans les appartenances: nombre de ces évêques passent successivement par plusieurs Eglises indépendantes, voire participent à plusieurs d’entre elles. Assez naturel dans des milieux de petits groupes, et des phénomènes semblables s’observent en Europe: chacun tend finalement à avoir «son» groupe, mais les collaborations avec d’autres évêques sont de rigueur, ne serait-ce que pour procéder à des consécrations épiscopales.

0527_anson

L’intérêt du livre de Bate est de permettre de suivre, à travers leurs propres descriptions, les itinéraires d’une variété d’évêques indépendants (également quelques femmes évêques, et au moins l’un d’eux né dans une Eglise épiscopale indépendante): des itinéraires parfois assez compliquées, dans lesquels transparaissent aussi hésitations et aspirations spirituelles.

A bien des égards, avec d’inévitables différences dans les accents en fonction des contextes culturels, le phénomène des «Eglises parallèles» ou «évêques indépendants» présente des ressemblances quel que soit l’angle d’approche choisi: les observations de Plummer ou des interlocuteurs de Bate confirment — bien que sur un ton différent — nombre d’observations de Vignot, à commencer par le fait que ces groupes trouvent des fidèles ou «clients» en bonne partie auprès d’un public qui n’a pas le sentiment de recevoir dans les paroisses de «grandes Eglises» les réponses à certaines demandes, d’ailleurs souvent plus pratiques (sacrements, bénédictions…) que théologiques. Même si, une fois de plus, il y a des exceptions.

0527_brandreth

Tout cela n’est pas vraiment nouveau, malgré des changements liés à des époques différentes: il suffit de relire ce qu’écrivait Henry R.T. Brandreth,Episcopi Vagantes and the Anglican Church(Londres. SPCK, 1961) ou Peter F. Anson, Bishops at Large (Londres, Faber and Faber, 1964), tous deux réédités récemment par Apocryphile Press et qui demeurent des lectures pleines d’intérêt sur des figures parfois pittoresques.

Les approches de Vignot, d’une part, et des auteurs-acteurs du milieu «sacramentel indépendant» anglophone que nous venons de citer, d’autre part, aboutissent cependant à des évaluations divergentes du potentiel de cette petite mouvance très fragmentée. Sans doute n’y a-t-il d’ailleurs aucun sens à vouloir donner une réponse d’ensemble. Entre une chapelle indépendante où l’on offre avant tout des services en parallèle à ceux des paroisses classiques, mais en s’efforçant de rappeler autant que possible ceux-ci, d’une part, et des groupes — plus rares — théologiquement ou liturgiquement novateurs, d’autre part, les perspectives ne sont pas les mêmes. Pour les uns et pour les autres, cependant, et pour leur perpétuation au delà de l’initiative d’un homme, pour ancrer des fidèles, se pose tôt ou tard la question soit de réussir à grandir suffisamment pour atteindre une masse critique garantissant leur pérennité, soit de trouver d’autres moyens de briser l’isolement: les tentatives occasionnelles d’organiser des ententes entre plusieurs «petites Eglises» en témoignent.

Jean-François Mayer

Bernard Vignot, Le phénomène des Eglises parallèles, Paris, Ed. du Cerf, 2010, 128 p.

Les répertoires et annuaires d’Eglises et communautés établis par Bernard Vignot et Marc Béret-Allemand peuvent être commandés chez l’auteur: 206 rue Léonard de Vinci, F-76960 Notre Dame de Bondeville.


articles récents

pixel English: Home
Articles
Interviews
Documents

Francais: Accueil
Articles
Entretiens
Documents

Print This

28 août, 2014

Communauté des soeurs Servites de Marie

Classé dans : Non classé — andreadicaffa02 @ 19:03

L’Eglise catholique en Haute-Marne Jeudi 28 Août 2014
Diocése de langres L église catholique en Haute-Marne L église catholique en Haute-Marne L église catholique en Haute-Marne L église catholique en Haute-Marne

L´Eglise en Haute-Marne

L´évêque et ses proches collaborateurs
Les conseils
Officialité
Chancellerie
Nominations 2013
Mgr Joseph De Metz-Noblat

Prêtres
Liste des Prêtres
Ordination de Grégory Vallon
Décès de Mgr Léon Taverdet
Décès de Mgr Lucien Daloz
Témoignages de prêtres
Année sacerdotale

Diacres
Liste des diacres
Mission dans le domaine de l´insertion par le travail…
en retraite… et visiteur de malades !
Alain et la fraternité diaconale
Mission dans les chantiers du bâtiment et de l´Eglise !
Solidaire de tous ceux que la vie a marginalisé !
Le diaconat, image d’une Eglise servante !

Missionnaires…
Nouvelles de Madgascar…
Nouvelles du Niger…
Nouvelles du Brésil
Nouvelles de Taïwan

Religieuses(x)
congrégations religieuses
Jeunes religieux de la Province de Reims
Au coeur de la vie religieuse

Equipes de coordination paroissiale (ECP)
Formation

Administration et finances
LEGS
DENIER DE L EGLISE
Répartition des dons
ISF

SERVICES & MOUVEMENTS
SERVICES DIOCESAINS
Aumôneries
Communauté Mission de France
Mouvements d´action catholique
Mouvements éducatifs
Mouvements du monde de la santé
Mouvements ayant trait à la famille
Mouvements du monde de la solidarité
Mouvements de spiritualité

Diocésain Accueil Langres L’Eglise en Haute-Marne Evéché Renseignements ? langres Foi, culture et société langres Espace Jeunes Diocésain Prier

Mots clé :

> L´Eglise en Haute-Marne > Religieuses(x) > congrégations religieuses > Servites de Marie
| Nos origines | Pélerinage à Notre Dame des Ermites |

Communauté des soeurs Servites de Marie

Qui sont les Servites de Marie ?

©M Pia
non loin de la gare, notre maison !

C’est d’abord un Ordre religieux de Frères, un ordre mendiant dont le style de vie ressemble à celui des Franciscains ou des Dominicains et c’est aussi une Congrégation de Sœurs à laquelle appartient la communauté des Sœurs Servites de Chaumont.

L’esprit des Servites de Marie se caractérise par la dimension importante de la vie fraternelle en communauté, le service, l’inspiration constante auprès de la Vierge Marie, en plus de la prière personnelle et de la célébration de la Liturgie des Heures.

>>> Nos origines

>>> Site de l´ordre des servites de Marie

A Chaumont, que vivons nous ?

©M Lise
la communauté de Chaumont

A l’exemple de la Vierge Marie notre communauté a pour mission d’être une présence de prière, de service, de compassion vécue entre nous, dans nos relations de travail et d’apostolat, dans toutes les rencontres de la vie quotidienne.

Nous sommes cinq.

Notre vie en communauté s’exprime par la prière personnelle et la prière des Heures célébrée ensemble, par le partage des tâches dans la maison, le partage de nos différences, de nos compétences, de notre recherche de Dieu.

La communion fraternelle est notre manière de témoigner de l’Evangile, elle est à construire jour après jour, pour devenir ensemble un lieu de réconciliation et de concorde…

>>> La congrégation internationale

>> voir le pélerinage à Notre Dame des Ermites de Cuves 2010…

Notre insertion apostolique

©M Lydie
Mme Mallet, amie de Cuves

Le domaine du service est très vaste, chacune de nous prend sa part selon son âge et ses capacités.

Deux sœurs ont un service apostolique qui est une activité professionnelle, enseignante en cours préparatoire à l’Ecole Sainte Marie, travailleuse sociale à l’Aide sociale à l’enfance.

Les trois autres sœurs sont bénévoles dans les lieux suivants : participation au Service Evangélique des Malades, à l’aumônerie de la Maison de retraite de Riaucourt, à l’accueil des familles des détenus, au Monastère invisible, à la vie liturgique paroissiale, à l’équipe des funérailles, au soutien scolaire……

Toutes, là où nous sommes, nous essayons d’avoir une attention plus grande à ceux qui en ont le plus besoin.

La miséricorde et la compassion ont toujours été des caractéristiques de notre vie religieuse, trait inspiré de la contemplation de la Vierge Marie, telle que nous la voyons à Cana et au pied de la Croix.

C’est un idéal, jamais atteint mais toujours désiré, de prolonger un peu sa présence et sa tendresse dans nos relations personnelles et notre accueil communautaire.

Communautés Religieuses
SERVITES DE MARIE
2 Avenue Emile-cassez
52000 CHAUMONT
Tél : 03 25 03 19 69
>> osm.chaumont@wanadoo.fr
Plus d’infos >> En savoir plus

27 juillet, 2014

Frati Servi di Maria Costruire un Mondo Nuovo scritto Conrad Borntrager OSM

Classé dans : Non classé — andreadicaffa02 @ 13:35

Conrad M. Borntrager, OSM
Costruire un Mondo Nuovo

Commento alla Regola di Vita

dell’Ordine secolare dei Servi di Maria

Indice articoli della RdV

 

PARTE PRIMA

L’ORDINE DEI SERVI DI MARIA

Obiettivo di questa prima parte è offrire un’ idea generale dell’Ordine dei Servi di Maria e della sua spiritualità. I capitoli che seguiranno applicheranno questi principi alle situazioni proprie dei laici. I quattro articoli di questo capitolo sono presi direttamente dal primo capitolo delle Costituzioni dei frati. Essi sono stati scritti per i frati (sacerdoti e fratelli dell’Ordine); ma, col metterli all’inizio della Regola di Vita dell’Ordine Secolare si intende offrirli a chiunque desidera vivere la spiritualità servitana nello stile proprio dei laici, uomini e donne, e non come religiosi.

I quattro articoli sviluppano questo pensiero: identità dei Servi di Maria; per servire, i Servi si dedicano a Maria; questa dedicazione a Maria li porta a servire gli altri in una maniera particolare; la vita dei frati ha ispirato altri a vivere secondo gli stessi ideali.
ARTICOLO 1

Il primo articolo della Regola di Vita è anche il primo articolo nelle Costituzioni dei frati. Esso cerca di descrivere le caratteristiche più importanti dell’ Ordine dei Servi di Maria.

Art. 1. L’Ordine dei frati Servi di Maria, sorto come espressione di vita evangelico-apostolica, è una comunità di uomini riuniti nel nome del Signore Gesù. Mossi dallo Spirito, si impegnano, come i loro Primi Padri, a testimoniare il Vangelo in comunione fraterna e ad essere al servizio di Dio e dell’uomo, ispirandosi costantemente a Maria, Madre e Serva del Signore.

Anzitutto, l’articolo colloca l’Ordine nel contesto delle sue origini. Il termine “vita evangelico-apostolica” si riferisce allo stile di vita tipico del Movimento Mendicante del secolo XIII, di cui gli esempi più conosciuti sono quelli dei frati Francescani e Domenicani. “Evangelico” richiama l’intenzione dei Mendicanti di modellare la loro vita sul Vangelo. L’ideale era seguire Cristo così come il Vangelo lo presenta. In questo modo la spiritualità servitana si colloca nella cornice della spiritualità cristiana.

“Apostolico” contiene uno speciale riferimento alla forma di vita degli apostoli così come è narrata negli Atti degli Apostoli (2, 42-47; 4, 32-37). In questi versetti, i membri della prima comunità cristiana di Gerusalemme sono descritti come persone dedite agli insegnamenti degli apostoli, alla vita comune, alla frazione del pane e alla preghiera. Essi mettevano tutto in comune. La comunità dei credenti era – si diceva – “un cuore solo e un’anima sola”. Quest’ultima espressione fu presa alla fine del secolo IV dal santo vescovo africano Agostino d’Ippona, che la usò come introduzione alla sua Regola di Vita, adesso conosciuta come la Regola di Sant’Agostino. Fu tale Regola che i Sette Santi Fondatori dell’Ordine dei Servi scelsero come norma fondamentale della vita che intendevano attuare.

Una parte essenziale di questa vita evangelica, vissuta dagli apostoli, è la sua impostazione comunitaria. L’articolo citato descrive l’Ordine come una “comunità di uomini” che erano stati accomunati da un proposito molto specifico: vivere “nel nome del Signore Gesù”. I Sette Santi Fondatori si impegnarono in una vita comune e nel servizio a Dio e agli altri. Questa scelta colloca la spiritualità Servitana nelle motivazioni del Movimento Mendicante del secolo XIII.

In secondo luogo, l’articolo trasferisce queste caratteristiche, proprie dei Sette Fondatori, a tutti i loro seguaci di oggi, i frati, sacerdoti e fratelli, che costituiscono l’Ordine nel tempo presente. Come i Fondatori, i Servi di oggi formano una comunità nel nome di Gesù, vivono la vita del Vangelo, e si ispirano all’esempio dei primi cristiani riuniti intorno agli apostoli. Anch’essi sono al servizio di Dio e di tutti.

Infine, la vita intera dei Fondatori e dei loro seguaci è oggi vissuta “ispirandosi costantemente a Maria, Madre e Serva del Signore”. I Servi condividono una spiritualità cristiana comune a tutti quelli che seguono Gesù, una spiritualità Mendicante ispiratrice dei gruppi sorti nel secolo XIII, e una spiritualità mariana che ha dato il nome all’Ordine: Servi di Maria.

Fra Ignazio M. Calabuig, OSM, ha commentato in modo esauriente e profondo queste ultime parole, “ispirandosi costantemente a Maria, Madre e serva del Signore”, in un suo articolo “La figura di Maria nelle nuove Costituzioni”, che fa parte di un libretto intitolato La Vergine Maria, edito a cura della Commissione per lo Studio delle Costituzioni (Rovato, 1976). Non ci resta che citarlo interamente per capire il senso pieno di questa frase.

“Ispirandoci, che nel contesto ha funzione logica modale, indicando lo stile con cui i Servi debbono agire, designa l’atteggiamento dei Servi che volgono lo sguardo della mente e del cuore alla Vergine, per trarre dall’ esempio della sua vita impulsi e suggerimenti per la loro condotta, per le loro scelte evangeliche, per i loro atti di servizio. Lo “ispirarsi”, quale atteggiamento religioso, comporta sia la consapevolezza dell’altissima perfezione morale e santità del modello, sia la gioia di sentirsi da esso attratti. L’ispirazione non si risolve mai in riproduzione mimetica, ma consiste in una adesione che non mortifica, ma suscita l’impulso creatore.

Non è il caso che io mi attardi qui nel produrre gli argomenti teologici per cui la Vergine di Nazareth “rifulge come modello di virtù davanti a tutta la comunità degli eletti” (Lumen Gentium, 65) e viene ritenuta “la prima e la più perfetta discepola di Cristo” (Marialis Cultus, 35); rimando per questo alla sintesi conciliare e ad altri documenti del Magistero pontificio, che abbondano nella dottrina sull’esemplarità di Maria.

Costantemente. L’avverbio sta ad indicare come per i Servi rivolgere lo sguardo alla Vergine non sia atto episodico ma atteggiamento permanente, che caratterizza e qualifica il loro agire in ogni campo.

Madre e Serva del Signore. Sono i primi appellativi che il testo costituzionale attribuisce al nome della Vergine: appellativi senza dubbio attentamente scelti, (se pure, come dirò in seguito, nel loro abbinamento offrano il fianco a qualche rilievo). Ambedue contengono un riferimento essenziale della Vergine al Signore. Il primo, dicendo Maria Madre del Signore, ne esalta la dignità sublime e singolare, il secondo – Serva del Signore – mutuato direttamente dal vangelo di Luca (1, 38), ritrae con evidenza quasi plastica l’atteggiamento della Vergine di fronte al Signore. Madre e Serva: l’accostamento sorprendente di un titolo di gloria alla qualificazione di uno stato umile definisce bene il mistero della Vergine.

A noi interessa soprattutto il termine Serva del Signore, di cui l’esegesi biblica contemporanea ha messo in luce un ricchissimo contenuto religioso e cultuale, che suscita echi nella nostra condizione di Servi e consente di arricchire la nostra spiritualità.

Collocato nel contesto dell’ annuncio di Gabriele a Maria – pagina così importante per la storia della salvezza e così densa di suggerimenti cultuali – l’epiteto ci conduce a rievocare un momento iniziale della nostra storia, legato ai luoghi dove sorgerà il santuario fiorentino della Santissima Annunziata con la veneratissima immagine della Vergine, che al di là del suo valore artistico, esprime pittoricamente un atteggiamento cultuale particolarmente caro ai Servi. Sul valore esemplare della Vergine nell’atto di pronunziare il ‘fiat” dovrò ritornare in seguito. (Accennavo dinanzi a un piccolo rilievo a cui sembra prestarsi l’espressione Madre e Serva del Signore. Anzitutto sarebbe stato forse più opportuno invertire l’ordine dei termini e dire – rispecchiando la successione dei fatti – “Serva e Madre del Signore “. Poi, dato che l’epiteto Serva del Signore si richiama direttamente a Luca 1, 38, la parola Signore, nel testo costituzionale, “copre” due persone distinte: nell’ epiteto Serva del Signore, il Signore è evidentemente Yahveh (p. 2 7-29)”.

Fra Ignazio conclude le sue considerazioni su questa frase sottolineando che “essa esprime e ribadisce il legame vitale esistente tra i Servi e la loro Signora e l’impegno di vita che ne deriva “.

ARTICOLO 2

Il secondo articolo è formato dai primi due paragrafi dell’articolo 6 delle Costituzioni dei frati. Vi si presenta il rapporto fra la dedicazione a Maria e il servizio agli altri.

Art. 2. Per servire il Signore e i loro fratelli e sorelle, i Servi si sono dedicati fino dalle origini alla Madre di Dio, la benedetta dell’Altissimo. A Lei si sono rivolti nel loro cammino verso Cristo e nell’ impegno di comunicano agli uomini. Dal “fiat” dell’umile Ancella del Signore hanno appreso ad accogliere la Parola di Dio e ad essere attenti alle indicazioni dello Spirito; dalla partecipazione della Madre alla missione redentrice del Figlio, Servo sofferente di Yahveh, sono stati indotti a comprendere e sollevare le umane sofferenze.

L’articolo colloca la nostra dedicazione (o servizio o consacrazione, come può essere più comunemente chiamata oggi) verso Nostra Signora la Madonna dentro il più vasto contesto di un metodo per raggiungere un obiettivo più alto, il servizio a Dio e alle nostre sorelle e fratelli. I Servi si dedicano a Maria precisamente per servire il Signore e gli altri in maniera più efficace. E stato così fin dalla fondazione dell’ Ordine quando i Sette Santi Fondatori presero il nome di “Servi di Santa Maria” in una esperienza di penitenza o conversione e tradussero il servizio a Maria nel servizio ai poveri e malati dell’ospizio che aveva il nome di Santa Maria.

Fra Ignazio spiega più esaurientemente la frase introduttoria “Per servire il Signore e i loro fratelli e sorelle” nella forma seguente.

“La finalità e il senso della vita dei Servi sono qui energicamente posti. Ho detto prima che il carisma “sociale” dell’ Ordine è visto dalle costituzioni, in modo inequivocabile, nel servizio. Quanto le Costituzioni affermano, del resto, non è che un ‘eco di ciò che emerge dalla ricerca storica sulle origini e lo sviluppo della spiritualità dell’ Ordine.

L’ambito del servizio abbraccia Dio e gli uomini, visti come fratelli. L’ideale di vita dei Servi traduce dunque in chiave di umiltà e di servizio il precetto evangelico dell’amore: “Diliges Dominum Deum tuum … et proximum tuum sicut te ipsum” (Amerai il Signore Dio tuo … e il prossimo tuo come te stesso Lc 10, 27), e in questo esso trova la sua grandezza (“La figura di Maria nelle nuove Costituzioni”, p. 30)”.

Fra Ignazio ricorda che il termine “si sono dedicati” indica il vincolo vitale fra le Comunità servitane e Maria. Questo è a un tempo un’espressione medioevale e liturgica. Dedizione è un termine che indica un’ offerta caratterizzata dalla totalità e perpetuità del dono stesso. Sottolinea pure che quando questo articolo fu formulato nel Capitolo Generale di Madrid del 1968, il Capitolo Generale scelse l’espressione “si sono dedicati” invece di “si sono consacrati” perché, pur essendo l’ultima un’espressione certamente valida, sembrava che fosse “impoverita di significato e banalizzata dall’uso frequente”.

“Anche la “dedicazione” – aggiunge – concorre a dare al nostro servizio una caratteristica mariana. E stato già rilevato come essa sia atteggiamento spirituale risalente alle origini dell’ Ordine e fatto sentito anche dai Servi del nostro tempo. Ora, la dedicatio assume alla luce dell’interpretazione del termine in se stesso e della lettera del testo costituzionale, alcune caratteristiche: la relatività – essa è chiaramente finalizzata al servizio di Dio e degli uomini; la perpetuità; la totalità.

Probabilmente nel contenuto spirituale espresso dalla parola dedicatio va cercata l’origine e la giustificazione del genitivo di appartenenza: (Servi) di Maria; e della dedicatio, che è essa stessa atto cultuale, discende una serie di espressioni di culto, ossequi e riverenze, resi alla Domina, i quali originariamente recavano una impronta conforme al senso che si attribuiva al termine.
Quindi in virtù della dedicazione ogni nostro servizio ha una impronta mariana e, per converso, diviene esso stesso un ossequio reso alla Domina (“La figura di Maria nelle nuove Costituzioni”, p. 36).

Esplora poi le implicazioni dell’immagine della vita come pellegrinaggio verso Cristo. Rileva che l’immagine è antica e biblica, ma anche ricca di significato per il nostro tempo. Essa vede l’esistenza come un pellegrinaggio. Quando questa immagine viene applicata ai Servi, riflette l’atteggiamento di penitenza e il cammino di conversione verso Cristo, e “nel contempo, colloca tutta la proposizione sullo sfondo Paolino della corsa per il raggiungimento di Cristo, al quale è diretta la tensione spirituale del cristiano” (“La figura di Maria nelle nuove Costituzioni “, p.
32-33)”.

Per capire la frase “a lei si sono rivolti…” ci dà diversi esempi da scritti medioevali.

“Sullo sfondo dello sguardo che si “rivolge” possiamo vedere diverse immagini. Anzitutto quella bernardiana, così diffusa e sentita nel Medio Evo, di Maria, stella luminosa nella tenebra che avvolge il cammino dell’uomo. Poi, l’immagine, pure medioevale, fissata nel celebre inno Ave, Maris Stella della “Domina” protettrice dalle insidie del cammino: “iter para tutum” (dispone un cammino sicuro), invoca con fiducia l’uomo del Medio Evo che aveva presenti i pericoli materiali degli impervi sentieri ed invoca l’uomo di oggi angosciato da altre non meno gravi minacce al suo incedere. Ancora: l’immagine della Donna, cara ai poeti del ‘200 e ‘300, che con la sua bellezza e le sue virtù conduce a Cristo; o l’immagine della Regina di misericordia, dato che il servo si sente soprattutto peccatore in cammino di conversione verso Cristo. O, infine, l’immagine di colei che è “exemplar virtutum “, modello evangelico, maestra di vita spirituale, che insegna all’uomo il cammino, cioè il modo di riprodurre in sé l’immagine di Cristo.

La prospettiva storica chiaramente individuata nell’articolo quinto sfocia, per così dire, nella vita dei Servi del nostro tempo. L’espressione fino dalle origini i Servi si sono rivolti alla Vergine, implica necessariamente che ad essa si rivolgono tuttora. Il loro rivolgersi a lei si colora di atteggiamenti molteplici: sguardo di chi cerca ispirazione per l’agire cristiano; lode di chi è ammirato del santo splendore dell’altissima creatura; supplica e invocazione di chi sente bisogno della sua misericordiosa intercessione. Questi atteggiamenti i Servi assumono nel loro cammino verso Cristo, nel processo, cioè, di conversione, sempre attuale, mai definitivamente compiuta; e, nell’impegno – prosegue il testo – di comunicare Cristo agli uomini. (“La figura di Maria nelle nuove Costituzioni “, p. 33-34)”.

Il titolo di Maria, Benedetta dell’Altissimo, ci ricorda che tutte le generazioni la chiameranno beata perché Dio, suo Salvatore, ha guardato alla sua umiltà (Lc 1,48).

Le due frasi seguenti dell’articolo mostrano come la dedicazione a Maria sia stata e sia un aiuto nel nostro pellegrinaggio verso Cristo e nel nostro annunziarlo al mondo. I Servi hanno considerato la figura di Maria particolarmente in due momenti centrali della sua vita, la nascita di Gesù (l’Incarnazione) e la morte di Gesù (la Redenzione).

Dagli avvenimenti che circondano la nascita di Gesù, l’articolo sottolinea due insegnamenti che vanno appresi da Maria. Primo, dal fiat (parola latina per “si compia in me”), dalla risposta affermativa di Maria all’angelo, per cui ella accettava di accogliere la Parola di Dio nel suo grembo, noi impariamo a ricevere la Parola di Dio nel nostro vivere quotidiano e ad essere attenti, come Maria, ai segni dello Spirito.

Secondo, i Servi di Maria devono imparare dal ruolo redentivo di Maria durante la morte del Figlio, che è lui il “Servo sofferente del Signore”. Questo richiama i quattro “Canti del Servo” nel libro del profeta Isaia dove si afferma che il Servo del Signore soffrirà e porterà redenzione. Vediamo, ad esempio, Isaia 53, 11: “dopo il suo intimo tormento vedrà la luce e si sazierà della sua conoscenza; il giusto mio servo giustificherà molti, egli si addosserà la loro iniquità.” In particolare, l’articolo stabilisce che guardando a Maria, i suoi servi impareranno a capire e ad alleviare la sofferenza umana. Tutto ciò viene affermato anche nella terza lettura della Vigilia de Domina rivolta alla Vergine ai piedi della Croce: “insegnaci a sostare con te presso le infinite croci dove il tuo Figlio è ancora crocifisso; a vivere e testimoniare l’amore cristiano, accogliendo in ogni uomo un fratello e una sorella.” A sua volta, il testo è preso all’epilogo (articolo 319) delle Costituzioni dei frati. Perciò questi saranno i pensieri e gli atteggiamenti che impregneranno tutta la vita dei Servi. Il tema ritornerà nell’articolo 42 dove si applicherà specificamente ai membri dell’ Ordine Secolare.

ARTICOLO 3

L’ articolo 2 sottolinea l’atteggiamento interiore del Servo/a verso la sua Signora Santa Maria. Un’attitudine a imparare a ricevere la Parola di Dio per essere attenti allo Spirito Santo nella propria vita per capire la sofferenza umana.

L’articolo 3 ci porta più avanti, fuori di noi stessi, nel mondo, dove l’esempio di Maria diventa azione.

Art. 3. Sensibili alle istanze della Chiesa i Servi approfondiscono la conoscenza di Maria, Madre di Dio e nostra e della sua missione nel mistero della salvezza. Vedendo in Lei “il frutto più eccelso della redenzione “, assecondano con le loro energie le esigenze liberatrici dei singoli e della società.

Consapevoli della divisione tra j cristiani, si adoperano perché la Figlia di Sion divenga per tutti segno di unità. Agli uomini insicuri propongono quale esempio di fiducia dei figli di Dio, la donna umile che ha posto nel Signore la sua speranza.

Il terzo articolo è stato preso, con alcune modifiche di stile, dal terzo paragrafo dell’articolo settimo delle Costituzioni dei frati. Ci dà suggerimenti su come mettere in pratica il servizio a Maria nel nostro tempo. Il primo passo, ovviamente, è conoscere meglio Maria e il suo ruolo di unione a Gesù nella redenzione del mondo. Questo sarà presentato specificamente ai membri dell’ Ordine Secolare nell’articolo 13.

Vengono dati tre esempi. In ogni caso il titolo dato a Maria suggerisce il modo con cui dobbiamo guardarla e che cosa dobbiamo imparare da lei, per fare una azione significativa nel mondo attuale.

1. Il primo impegno consiste nel sostenere le persone e la società nel loro sforzo di essere liberi. Poiché Maria è chiamata qui “il frutto più eccelso della redenzione”, la prima libertà considerata in questo articolo è la libertà spirituale, dal peccato e da tutto ciò che il peccato comporta nella vita dell’individuo e della società. In secondo luogo non si sbaglierebbe nel comprendere in questa libertà tutte le umane liberazioni dalle oppressioni che oggi schiavizzano la gente. Giacché Maria è totalmente libera perché è completamente redenta, libera dal peccato, può guidarci a uscire dalle oppressioni e dalla schiavitù che sperimentiamo nella nostra vita e in quella di chi è intorno a noi.

2. Il secondo impegno consiste nel superare le divisioni che esistono nello stesso Cristianesimo. Qui Maria è chiamata la Figlia di Sion per ricordarci la sua origine ebraica. In tante circostanze, Maria è stata fonte di controversia e divisione, specialmente fra le tradizioni cattolica e protestante. Si tratta, perciò, di una sfida per scoprire le cose che abbiamo in comune e progettare la vita su di esse insieme ai nostri amici e parenti non cattolici.

3. Infine, l’agire dei Servi li proietta “nell’ insicuro”. L’insicurezza può essere dovuta alla mancanza di beni materiali come il cibo sufficiente, la casa, vestiti, o alla mancanza di beni spirituali come l’incertezza nel futuro, l’incertezza in Dio o sul nostro rapporto personale con Dio. Gesù osservò che la gente era come pecore senza pastore; senza una adeguata guida spirituale era disorientata. L’insicurezza può riguardare altre cose come il lavoro, la salute, ecc. L’immagine di Maria è quella della donna umile che ha posto tutta la sua speranza nel Signore. Il Signore è la Roccia sulla quale possiamo trovare la sicurezza di cui abbiamo bisogno per dirigere sulla via giusta la nostra vita. Maria ci offre un modello di donna comune che è stata capace di fare questo e di trovare così la direzione, il senso e la sicurezza nella sua vita in mezzo ad apparenti insicurezze.
ARTICOLO 4

I tre primi articoli, presi come sono dalle Costituzioni dei frati, presentano l’ideale che i frati si sforzano di realizzare. Il quarto articolo spiega come, storicamente, diversi Gruppi siano arrivati ad associarsi all’Ordine dei Servi.

Art. 4. Ispirandosi costantemente a Maria, Madre e Serva del Signore, numerose Congregazioni religiose e Gruppi laici sono sorti intorno alle comunità dei Servi di Maria, costituendo espressioni particolari di vita consacrata o laicale. Altre Famiglie e Gruppi già esistenti, attratti dallo stesso ideale dei Servi, sono stati associati all’Ordine. Ognuno di loro, sia religiosi sia laici, esprime nel proprio modo l’unica vocazione comune a tutti noi.

L’articolo è introdotto da una frase presa dall’articolo 1 della Regola di Vita, che è pure il primo articolo delle Costituzioni dei frati: “ispirandosi costantemente a Maria, Madre e Serva del Signore”. Come è stato detto nell’articolo 1, questa frase non costituisce l’ideale dei Servi di Maria, ma piuttosto la forma in cui l’ideale (vita evangelico-apostolica, comunione fraterna, servizio a Dio e a tutti) è vissuto. Storicamente, individui e gruppi sono stati ispirati dall’ideale dei Servi di Maria e hanno voluto condividere questo ideale secondo quanto era loro possibile, tenendo conto della loro situazione. L’articolo presenta allora le due modalità primarie nelle quali il tutto è stato vissuto in passato.

All’inizio, Gruppi sorgevano intorno alle Comunità dei frati e volevano condividere la loro spiritualità nella misura di quanto fosse compatibile con la loro forma di vita di laici, di suore o monache. Un esempio è quello delle suore di Ladysmith. Il Gruppo iniziale di giovane donne fu dapprima accolto nel Terz’Ordine Servitano; poi esse andarono ad insegnare in una parrocchia Servitana a Ladysmith, Wisconsin, USA; là diventarono una Comunità religiosa. L’istituto Secolare Servitano fece nascere un Gruppo dell’Ordine Secolare a Londra circa 50 anni fa. Le suore in Swaziland furono fondate da Servi missionari in quella nazione.

Ma c’è anche una seconda forma di aggregazione, quella di Gruppi, già formati, che erano attratti dall’ ideale di vita dell’ Ordine dei Servi e chiedevano di associarsi a loro. Un esempio di ciò è la Congregazione delle Suore Serve di Maria in India, fondate da un gesuita. Non c’erano Servi in India alla metà del secolo XIX, quando esse furono fondate. Ma a motivo della loro devozione verso la Vergine Addolorata, chiesero di essere associate all’ Ordine. Molti Gruppi del Terz’ Ordine furono fondati in Messico da Gesuiti e da Francescani alla fine del ‘700 e nell’ 800 per promuovere la devozione all’ Addolorata. Una volta fondati, chiesero anche loro l’affiliazione all’Ordine dei Servi in modo da ottenere le indulgenze concesse dall’ Ordine per le pratiche devote in onore della Vergine Addolorata.

[In Italia alcune Congregazioni di Suore Serve di Maria costituiscono lo sviluppo di un inizio nell’ Ordine Secolare o sono frutto di fondatori ‘Terziari’.

Erano ‘Terziarie’ Filomena Rossi e Giovanna Ferrari, coloro che iniziarono nel 1861 la Congregazione della Mantellate Serve di Maria di Pistoia, aggregate all’Ordine nel 1868 (Comunità primitiva di Treppio) e 1879.

Da un gruppo di ‘Terziarie’ sbocciarono le Serve di Maria SS. Addolorata di Firenze — prime di esse Giuditta Antonia Signorini che prese il nome di suor M. Giuliana di S. Anna — nel 1854, aggregate all’Ordine nel 1876.

Figlia e madre, Elisa Andreoli e Margherita erano ‘Terziarie’ quando ebbe inizio la Congregazione delle Serve di Maria Riparatrici, a Vidor (Treviso) nel 1900, aggregate all’Ordine dieci anni dopo.

‘Terziario’ era don Ferdinando M. Baccilieri, parroco a Galeazza Pepoli (Bologna), fondatore delle Serve di Maria di Galeazza: la sua beatificazione il 3 ottobre 1999, onora, tra l’altro, un sacerdote ‘Terziario’ e fondatore nel 1862 della Congregazione aggregata all’Ordine nel 1883 e ancora nel 1932.

Anche il canonico Ludovico Rossi di Lucca era ‘Terziario’ quando si prodigò per la regolare aggregazione all’ Ordine (1916) delle Prime Sette Fondatrici della Congregazione Suore dell’Addolorata Serve di Maria di Pisa, ‘Terziarie’ Serve di Maria dal 1896.

Pure Costanza Starace, poi suor M. Maddalena della Passione, era ‘Terziaria’ (insieme ad altre quattro coetanee che vivevano in Comunità), quando fondò nel 1869 a Scanzano (Napoli) la Congregazione Suore Compassioniste Serve di Maria, coadiuvata dal ‘Terziario’ Mons. Vincenzo M. Sarnelli, Arcivescovo di Napoli (allora Vescovo di Castellammare di Stabia); aggregata all’Ordine nel 1893.

Anche la Congregazione delle Suore Serve di Maria di Modugno (Bari) è stata fondata dalla ‘Terziaria’ Maria Gaetana Romita (poi suor Giuliana delle Cinque Piaghe); la Comunità fu riconosciuta dall’Ordine nel 1899 e nel 1920 ebbe la formale aggregazione; poi, nel 1970 la Congregazione venne fusa con le Compassioniste Serve di Maria.

La fecondità vocazionale dell’Ordine Secolare è testimoniata anche da tali ed altre fioriture, le quali hanno portato nella propria istituzione l’ispirazione mariana e una priorità di servizio verso poveri e bisognosi, soprattutto l’infanzia.

Ma è anche da segnalare la reciprocità: pure in Italia accanto e per opera di Comunità delle Serve di Maria sono germinate Fraternità dell’Ordine Secolare.

Occorre segnalare un altro paio di esempi della comunione di beni in Italia. L’Istituto Secolare Regnum Mariae maturò come prosecuzione della vocazione servitana da parte della componente giovanile dell’ Ordine Secolare di Ancona nel 1959. Nel 1976 l’Istituto è stato aggregato all’Ordine; nel 1983 eretto in Istituto Secolare di diritto diocesano dall’Arcivescovo di Ancona.

Dall’Ordine Secolare di Verona partì nel 1956 la Pia Unione “Terziarie Regolari Serve di Maria Pro Clero”, nel 1964 approvata dal vescovo diocesano, e nel 1968 dal Priore Provinciale OSM di Lombardia e Veneto.]

Infine, l’articolo rileva che ciascuno di questi Gruppi, siano essi Gruppi di suore, di monache, o di laici, sono espressioni particolari della vocazione servitana condivisa da tutti. Tutti condividiamo la stessa vocazione servitana, ma l’esprimiamo in modi diversi, in conformità allo stile di vita e allo stato matrimoniale. La questione della vocazione sarà maggiormente approfondita negli articoli 8 e 9.

PARTE II

L’ORDINE SECOLARE DEI SERVI DI MARIA

E LA VITA DI FRATERNITÀ

CAPITOLO PRIMO

L’ORDINE SECOLARE DEI SERVI DI MARIA

La prima parte della Regola ci ha dato una prospettiva generale della spiritualità dell’Ordine dei Servi. La seconda parte applica questa spiritualità specificamente all’ Ordine Secolare. Il primo capitolo offre i principi generali che regolano la vita secolare servitana e sviluppa gradualmente gli aspetti più specifici di questo tipo di vita. Quasi tutte le idee qui presentate, sono trattate in forma particolareggiata nei capitoli successivi.
Diamo qui di seguito lo schema dei dieci articoli (5-14) che formano il primo capitolo della Regola.

1. Seguaci dei Sette Santi Fondatori (art. 5) e testimoni dell’ origine laicale dell’Ordine (art. 7)
2. Caratteristiche della comune vocazione (art. 6)
3. La vocazione o chiamata nell’Ordine Secolare (art. 8-9)
4. Descrizione dell’Ordine Secolare; alcune delle caratteristiche più importanti (art. 10):
Fraternità (art. 11)
Preghiera (art. 12)
Rapporto con la Chiesa (art. 13)
La Beata Vergine Maria (art. 13)
5. La ragione e il ruolo della Promessa (art. 14)

Prima di approfondire in particolare ciascuno degli articoli, è necessario chiarire tre termini che si useranno in questo commento: Comunità; clericale/laicale e religioso/secolare; Ordine dei Servi.

1. La Regola di Vita del 1995 sostituisce il termine “Comunità”, utilizzato nell’ anteriore edizione, con quello di “Fraternità”. Il termine “Fraternità” ha il vantaggio di indicare che la relazione fra i membri dell’Ordine Secolare deve essere simile a quella che esiste tra fratelli e sorelle, deve costituire cioè un rapporto di famiglia. “Comunità” potrebbe non rendere bene tale connotazione. Perciò ogni volta che viene usato il termine “Comunità”, bisogna tener presente che esso ha un significato più profondo.

2. Un secondo gruppo di termini che hanno bisogno di essere approfonditi sono “clericale/laicale” e “religioso/secolare”. In una nota la Regola di Vita ci dice: “il termine ‘secolare’ è usato qui nel senso della radice originale latina ‘saeculum’, e distingue uno che vive nel secolo, cioè ‘nel mondo’, da quello che vive in una casa religiosa”. Nel documento sulla Chiesa (Lumen Gentium, 43), il Concilio Vaticano II ci aiuta a capire le differenze fra “chierico”, “laico”, “secolare” e “religioso”. Lo stato religioso, “se si tien conto della divina e gerarchica costituzione della Chiesa, non è un intermediario tra la condizione dei chierici e quella dei laici, ma da entrambe le parti alcuni fedeli sono chiamati da Dio a fruire di questo speciale dono nella vita della Chiesa e ad aiutare, ciascuno a suo modo, la missione salvifica di essa”.

Potremmo tracciare il seguente diagramma:

Struttura Gerarchica In relazione alla vita religiosa

Clericale Religioso (vita consacrata)

Laicale Secolare (non religioso)

Ognuno ha il suo posto dentro ambedue queste categorie: in relazione alla struttura gerarchica della Chiesa, l’individuo può essere chierico o laico; in relazione alla vita religiosa, l’individuo

può essere religioso o secolare. Ne derivano implicazioni pratiche; per esempio, un laico può essere membro di una Congregazione religiosa (es. frate o una suora) o “secolare”, non un membro di un Ordine religioso. Un chierico (diacono, prete, vescovo) può essere membro di un Ordine religioso o membro del clero diocesano ‘secolare’.

In conclusione un Ordine religioso (come quello dei Servi) può avere sia membri clericali (sacerdoti) che membri laici (fratelli non ordinati); e l’Ordine Secolare dei Servi può ugualmente avere chierici e laici. In passato ci sono stati preti, vescovi e almeno un papa, il beato Innocenzo XI, che hanno fatto parte dell’Ordine Secolare.

Attualmente preti diocesani sono membri dell’Ordine Secolare. Da questo possiamo vedere che in senso tecnico “laico” e “secolare” non sono sinonimi: l’uno significa “non chierico” e l’altro “non religioso”.

Ma in un senso meno tecnico, usiamo spesso “laico” e “secolare” come se volessero dire la stessa cosa. Lo stesso Vaticano Il confonde le acque usando “laicità” per indicare quelli che non sono né chierici né religiosi (Lumen Gentium, 31). Anche la Regola di Vita usa a volte i due termini come sinonimi.

3. Un altro termine da considerare è “Ordine dei Servi di Maria” o “Ordine Servitano”. A volte sembra che questo termine indichi soltanto l’Ordine dei Frati Servi di Maria (cioè i sacerdoti e i fratelli), mentre a volte sembra indicare la grande realtà di tutti i Gruppi che condividono la stessa spiritualità e sono chiamati “Famiglia Servitana”. Il contesto ci dirà a quale significato ci si riferisce.
ARTICOLO 5

L’articolo 5 riporta materiale di articoli anteriori e presenta alcuni concetti che saranno considerati più avanti in questo stesso capitolo.

Art. 5. L’Ordine Secolare dei Servi di Maria è formato da laici, uomini e donne che, uniti dal battesimo cristiano e guidati dallo Spirito Santo nella via della santità, desiderano allinearsi e unirsi nel servizio di Cristo, delle loro sorelle e dei loro fratelli nel mondo, ispirandosi a Maria Madre e Serva del nostro Salvatore Gesù Cristo.

Nell’ Ordine Secolare si impegnano come laici a seguire nella loro vita familiare e sociale le orme dei Sette Santi Fondatori dei Servi di Maria.

[L’edizione italiana della Regola ha precisato la nota n. 11 “Membri del clero diocesano possono essere accolti come membri dell’Ordine Secolare dei Servi di Maria”, aggiungendo in appendice il comma seguente: “L’Ordine Secolare dei Servi di Maria accoglie diaconi, sacerdoti, vescovi diocesani. Nella spiritualità dell’Ordine Secolare essi trovano un sostegno per la propria vocazione ministeriale. Le indicazioni della Regola li impegnano in quanto sono in sintonia con lo stato clericale”.]

La prima frase di questo articolo è quasi identica alle prime righe dell’articolo seguente. Identifica i membri dell’Ordine Secolare come uomini e donne laici. L’articolo seguente è più inclusivo in quanto parla di “uomini e donne”: come abbiamo visto, infatti, anche i chierici possono far parte dell’Ordine Secolare. Essi sono riuniti in forza del battesimo e a loro volta vogliono orientarsi al servizio di Cristo e dei fratelli.

L’articolo prende in prestito la frase già utilizzata nell’articolo 1 e poi ripetuta nell’articolo 4, cioè che il tutto avviene ispirandosi a Maria. C’è tuttavia una novità. In questo articolo Maria è chiamata Madre e Serva del nostro Salvatore Gesù Cristo. Nel primo articolo i titoli dati a Maria sono stati quelli di Madre e Serva del Signore. Come è già stato notato, “Signore” indica Gesù in relazione al titolo di “Madre”, ma “YHWH” in relazione a “Serva”. In questo articolo Maria riceve il titolo biblico di Madre di Cristo, benché Maria non sia mai stata chiamata Serva di Cristo nella Bibbia. Veramente Paolo si definisce servo o schiavo di Gesù Cristo, come nei versetti di apertura della lettera ai Filippesi e ai Romani. Maria è chiamata tuttavia serva di Gesù, solo a cominciare

dal secolo VII negli scritti di Sant’ Ildefonso da Toledo. Così dalla sobrietà del titolo scritturistico “Madre e Serva del Signore”, arriviamo ad un titolo più esteso che riflette lo sviluppo del pensiero teologico di epoche posteriori.
L’articolo, infine, stabilisce che i membri dell’Ordine Secolare si impegnano come “laici” ovvero “secolari”.
Il pensiero centrale di questo articolo è quello di mettere in chiaro che i membri dell’Ordine Secolare sono seguaci dei Sette Santi Fondatori dei Servi di Maria. I membri dell’Ordine Secolare perciò devono impegnarsi in una maggiore conoscenza dei Sette Santi Fondatori. Un libro potrebbe servire per un approfondimento di tale argomento: “Fratelli e Servi: i Sette Santi Fondatori dell’Ordine dei Servi” di Franco Andrea Dal Pino.
ARTICOLO 6

L’articolo 6 parla del rapporto tra l’Ordine Secolare e le altre Componenti della Famiglia dei Servi: frati, monache, suore, membri degli Istituti Secolari, Diaconie laiche, membri degli altri Gruppi Laici. Spiega in forma particolareggiata l’affermazione dell’articolo 4 secondo cui tutti questi Gruppi hanno una vocazione comune.

Art. 6. L’Ordine Secolare dei Servi di Maria, formato da uomini e donne che vivono la loro consacrazione battesimale nel mondo, è una delle espressioni dell’unica vocazione dei Servi di Maria, ne condivide lo stesso ideale, gli impegni di vita evangelico-apostolica, la pietà verso la Madre di Dio e costituisce con essi una sola Famiglia.

L’articolo presenta almeno tre aspetti significativi.

1. L’articolo quarto ha dichiarato in forma generica che molte Congregazioni religiose e Gruppi Laici condividono l’unica vocazione, che è comune a tutti. Adesso, questo articolo applica tale affermazione all’Ordine Secolare e spiega che l’Ordine Secolare è appunto una delle espressioni della comune vocazione dell’ Ordine dei Servi.

2. Un secondo punto di questo articolo è l’elencazione di tre caratteristiche della comune vocazione condivise da tutti i vari Gruppi di Servi di Maria. Questo elenco è preso direttamente dalle Costituzioni dei frati, art. 305. Tutti i vari Gruppi di Servi di Maria condividono lo stesso ideale, lo stesso impegno di vita evangelico-apostolica e la stessa pietà o devozione verso la Madre di Dio. Vediamo ora, separatamente ciascuna di queste caratteristiche.

* Stesso ideale. L’articolo non spiega la natura di tale ideale. Le Costituzioni dei frati, da cui questa affermazione è presa, spiegano che l’ideale dei frati “è il giungere alla perfetta statura di Cristo” (art. 105 e 319), un concetto preso dalla lettera di Paolo agli Efesini 4, 13. Così, l’ideale dei Servi di Maria — frati, monache, suore, membri Secolari dell’Ordine… — è lo stesso ideale che si trova in ogni autentica spiritualità cristiana: una perfetta sequela di Cristo, la quale comporta che dalla vita di Cristo, che abita in noi, otteniamo la pienezza di vita in Cristo.

* Stesso impegno di vita evangelico-apostolica. Mentre la prima caratteristica mette i Servi di Maria all’interno della più ampia tradizione spirituale cristiana, questa seconda caratteristica specifica come “evangelico” e “apostolico” il tipo di vita seguito dai Servi di Maria. Come abbiamo già accennato, quando questi termini sono stati usati nel primo articolo, essi collocano i Servi di Maria dentro la tradizione degli Ordini Mendicanti sorti nella Chiesa del XIII secolo.

* Stessa pietà verso la Madre di Dio. Andrebbe sottolineato che, pur dovendo essere la devozione a Maria una caratteristica dei Servi di Maria, non viene specificato quale aspetto della vita di Maria dovrebbe essere il riferimento primario della devozione, o quali particolari preghiere o azioni dovrebbero essere le espressioni privilegiate di questa pietà. Per esempio, non sarebbe corretto limitare la devozione dei Servi di Maria solo ai dolori di Maria (benché questa sia dominante nella vita dell’Ordine dei Servi almeno dal ‘500 inoltrato) o dire che i Servi di Maria devono recitare il rosario ogni giorno (anche se questa è una pratica esemplare). All’interno della tradizione dei Servi, un Servo di Maria può preferire onorare l’obbedienza di Maria nell’Annunciazione e recitare ogni giorno la Vigilia della Nostra Signora invece del rosario. Deve esserci la pietà mariana; ma può esprimersi in una quantità di forme diverse.

3. La terza affermazione significativa dell’articolo 6 è questa: “con l’Ordine dei Servi (l’Ordine Secolare) una sola Famiglia”. Penso che l’enunciazione della frase sia goffa e forse persino ambigua; però il significato è chiaro. I membri dell’Ordine Secolare, insieme ai membri delle altre espressioni di vita dei Servi, costituiscono una famiglia. Mentre questo può essere stato sempre vero in passato, soltanto recentemente [4 maggio 1987] tale concetto è stato messo in pratica con la creazione dell’UNIFAS (Unione Internazionale della Famiglia Servitana):
un gruppo formato dai rappresentanti generali di tutte le Componenti della Famiglia dei Servi e delle Serve di Maria esistenti nel mondo: frati, monache, suore, Ordine Secolare, Diaconie laiche, Istituti Secolari, Gruppi Laici, e Unifas nazionali. Finalità dell’Unione è studiare, esprimere, animare e promuovere attività di interesse comune. La natura del rapporto tra le diverse Componenti della Famiglia Servitana sta altresì evolvendosi da un modello nel quale i frati erano la fonte e il centro di tutti i rapporti, a un modello più egualitario, dove i frati sono a un livello di parità con gli altri Gruppi (monache, suore, Ordine Secolare, Istituti Secolari, Diaconie laiche e altri Gruppi Laici).

ARTICOLO 7

L’articolo 7 richiama in particolare le origini laicali dell’ Ordine dei Servi, in quanto iniziato dai Sette Santi Fondatori che furono membri di una Confraternita laicale a Firenze prima di lasciare la città per andare sul Monte Senario dove intrapresero una vita rigorosamente religiosa, pur mantenendo uno stretto contatto con i loro antichi fratelli.

Art. 7. Come membri laici dell’Ordine dei Servi, i fratelli e le sorelle sono autentici testimoni dell’origine laicale dell’ Ordine. Laici furono, infatti, i Sette Santi che hanno iniziato il loro itinerario come laici uniti in preghiera e servizio in onore della beata Vergine Maria.

Secondo la visione storica corrente, i Sette Santi Fondatori furono membri di una Confraternita laicale sulla quale ebbero influssi sia i movimenti penitenziali del tempo (alcuni pensano che abbiano fatto parte dei Fratelli della Penitenza) sia la devozione mariana. Sembra che la Confraternita fosse incaricata di un ospedale o ospizio per i poveri chiamato di Santa Maria. I membri della Confraternita si chiamavano “Servi di Santa Maria”. Più tardi, i Sette uscirono della Confraternita per formare una Comunità religiosa a Monte Senario. Questa è stata l’origine dell’Ordine dei Frati Servi di Maria.

L’articolo enfatizza le origini laicali dell’Ordine. Risulta così che i gruppi laici facenti parte della Famiglia dei Servi non vanno considerati di secondaria importanza, ma un’espressione della vita che i Sette Santi Fondatori hanno condotto nel mondo prima di recarsi sul Monte Senario.
ARTICOLI 8-9

L’articolo 6 ha parlato di una vocazione condivisa, una sola vocazione che è comune ai vari Gruppi che compongono la Famiglia Servitana, e ha elencato alcune caratteristiche di questa vocazione, caratteristiche che dovrebbero trovarsi in tutte le Componenti. Queste sono espresse in termini molto generici, ed allora compito di ogni Gruppo determinare con maggiore precisione come devono essere vissute secondo il proprio stile di vita.

Gli articolo 8 e 9 riguardano più specificamente la vocazione o chiamata.

Art. 8. Nella Chiesa, popolo santo di Dio, la vocazione del Servo di Maria Secolare è una speciale chiamata che comporta un invito gratuito di Dio e una risposta cosciente e libera. In questo modo il Servo di Maria Secolare riconosce la presenza materna ed operante di Maria.
Art. 9. Con l’accettazione volontaria del dono della vocazione radicata nella consacrazione battesimale, il Servo di Maria Secolare si impegna a seguire Cristo e a portare a pienezza il comandamento evangelico dell’amore.

La maggior parte della gente considera una “vocazione” o chiamata soprattutto in termini di vita religiosa o sacerdotale. Qui la parola “vocazione” è usata in un senso più ampio. Anche il Vaticano II usa “vocazione” in senso ampio giacché stabilisce, per esempio, che tutta la Chiesa è chiamata alla santità (Lumen Gentium, titolo del capitolo V): “per loro vocazione è proprio dei laici cercare il Regno di Dio trattando le cose temporali e ordinandole secondo Dio” (Lumen Gentium, 31). Dice anche che gli educatori hanno una vocazione bella e davvero importante (Gravissimum educationis, sull’Educazione Cristiana, 5). Così vediamo che Dio può chiamarci in vari modi, non soltanto come religiosi/e o sacerdoti. Il Catechismo della Chiesa Cattolica (n. 1877) non esita a dire “che la vocazione di tutta l’umanità è di rendere manifesta l’immagine di Dio e di essere trasformata ad immagine del Figlio Unigenito del Padre”. Questa vocazione è personale poiché ognuno è chiamato ad entrare nella beatitudine divina. Si potrebbero citare molti altri esempi per mostrare come la chiamata che Dio ci rivolge non è soltanto per la vita religiosa o per quella sacerdotale.

I due articoli ci aiutano a capire più chiaramente in che cosa consista questa speciale chiamata all’Ordine Secolare dei Servi di Maria.

1. Primo, è un invito gratuito da parte di Dio. Non siamo noi a scegliere Dio, ma è Dio che sceglie noi per primo. Dio non ha limiti; egli rivolge il suo invito liberamente. Poiché è un invito dato liberamente da Dio, l’articolo 9 lo chiama anche un “dono”, qualcosa che non viene guadagnato o qualcosa che nessuna somma di denaro o sforzo da parte nostra può comprare.

2. Secondo, da parte nostra è richiesto un “sì” libero e cosciente. Non possiamo acquistare questo dono da Dio, ma possiamo rifiutarlo. È liberamente dato e noi dobbiamo liberamente accoglierlo. Essendo il nostro rapporto con Dio essenzialmente un rapporto di amore, non può svolgersi in nessun altro modo, perché una relazione di amore esige libertà da ambedue le parti. Non possiamo forzare Dio, né Dio può costringere noi ad amarlo.

3. Ogni chiamata speciale che riceviamo da Dio deve essere vista come derivante dal nostro battesimo. Il battesimo rimane la base del nostro rapporto di amore con Dio. Considerare la chiamata all’Ordine Secolare, o alla vita religiosa o al sacerdozio, come qualcosa di separato dalla nostra risposta originale all’invito di Dio, di rinunciare cioè al nostro stato di peccato e di entrare in un rapporto d’amore con lui, significherebbe misconoscere il posto fondamentale del battesimo nella nostra relazione con Dio.

4. Il frutto di una risposta affermativa all’invito di Dio è che l’individuo, in maniera consapevole e determinata, si sforzi di portare a compimento il comandamento dell’amore così come si trova nel Vangelo (cfr. Gv 13,34). Tali caratteristiche collocano la spiritualità dell’ Ordine Secolare sul solido fondamento di un’ autentica spiritualità cristiana.

5. Ma c’è ancora un altro elemento espresso nell’articolo 8. In questo dono, il Servo riconoscerà la presenza di Maria. Più volte la Legenda de Origine, il più antico racconto che abbiamo sulle origini dell’Ordine dei Servi, afferma che i Sette Fondatori furono scelti per dare inizio all’Ordine da Dio e dalla Beata Vergine, perché doveva essere un Ordine dedicato specialmente a lei. Pertanto la chiamata dei membri dell’ Ordine continua oggi ad essere una chiamata da parte di Dio e della beata Vergine.

Mentre i cinque elementi sopra citati degli articoli 8 e 9 ci aiutano a spiegare la vocazione del Servo Secolare, c’è pure una conclusione importante a cui dobbiamo arrivare. Giacché l’Ordine Secolare è formato da uomini e donne che sono stati chiamati in forma speciale da Dio e dalla Beata Vergine, ne consegue che l’Ordine Secolare differisce totalmente da gruppi o organizzazioni parrocchiali. Non si parla, per esempio, di vocazione a essere ministro straordinario dell’Eucaristia, membro del Consiglio Pastorale, lettore nella Messa. Queste sono funzioni che devono essere svolte, non una vocazione che va vissuta. Si può passare da una funzione ad altra, smettere di essere lettore o ministro dell’Eucaristia o membro di una organizzazione parrocchiale, ma la Promessa che si fa nell’Ordine Secolare è per la vita.

Il Servo Secolare rimane un Servo Secolare 24 ore su 24. Tutto è fatto alla luce di questa chiamata; tutte le attività sgorgano da essa. L’accento è posto più su chi noi siamo che su ciò che facciamo.

ARTICOLO 10

Gli articoli 4 e 6 della Regola di Vita collocano l’Ordine Secolare all’interno della più grande Famiglia Servitana, formata da Gruppi che condividono una stessa vocazione espressa in diverse forme. Gli articoli 8 e 9 spiegano più diffusamente il significato di vocazione in relazione all’Ordine Secolare. L’articolo 10 descrive tale particolare vocazione nel suo rapporto diretto con l’Ordine Secolare. L’articolo 10 perciò è molto vicino a una “definizione” o “descrizione” dell’Ordine Secolare. Se qualcuno vi chiedesse che cosa è l’Ordine Secolare, potreste semplicemente citare l’articolo 10 per far capire, a chi vi rivolge la domanda, l’essenza dell’Ordine Secolare.

Art. 10. I membri dell’Ordine Secolare dei Servi di Maria sono uomini e donne che si sostengono nella loro vita matrimoniale, familiare e sociale e nell’impegno attivo nel mondo e tendono alla santità secondo la spiritualità dell’Ordine dei Servi di Maria, seguendone le direttive e la Regola propria.

Si dicono due cose significative sulla vita dei membri dell’Ordine Secolare: essi tendono alla santità; si sostengono vicendevolmente gli uni gli altri. Anche se queste due affermazioni sembrano indipendenti, in realtà sono strettamente correlate.

Vediamo prima la questione della “santità”. Molta gente ha un’idea di santità come di qualcosa di distante o forse riservato a un certo tipo di persone, non ai comuni cattolici. Eppure il Capitolo V del documento sulla Chiesa del Vaticano II (Lumen Gentium) si intitola “universale vocazione alla santità nella Chiesa.” Il Concilio mette in chiaro che tutti i cristiani sono chiamati alla santità, e vede nel discorso della montagna una parola che Gesù rivolge a tutti i credenti: “siate voi dunque perfetti come è perfetto il Padre vostro celeste” (Mt 5, 48). Siamo chiamati da Dio, continua il Concilio, non secondo i nostri meriti ma secondo la volontà e la grazia di Dio. Siamo giustificati nel Signore Gesù e, attraverso il battesimo, diventiamo davvero figli di Dio e condividiamo la natura divina.

In questo modo siamo realmente resi santi.

Nella citazione seguente, il Concilio ci aiuta a capire meglio la natura di questa santità: “è chiaro dunque a tutti che ogni fedele di qualsiasi stato o grado è chiamato alla pienezza della vita cristiana e alla perfezione della carità: da questa santità è promosso, anche nella società terrena, un tenore di vita più umano” (Lumen Gentium, 40)

Il Concilio dunque identifica la santità con la pienezza della vita cristiana e la perfezione nella carità. Se adesso diamo uno sguardo all’articolo 9 della Regola di Vita, vediamo che tale articolo parla di questa chiamata alla santità, ma con parole diverse. Dice che la vocazione di un Servo Secolare trova le sue radici nel battesimo: accettando questa vocazione egli “si impegna a portare a pienezza il comandamento evangelico dell’amore”. La “pienezza della vita cristiana”, espressione utilizzata dal Concilio per descrivere la santità, equivale a “portare a pienezza il comandamento evangelico dell’amore”. In questo modo vediamo che la nostra Regola di Vita è chiaramente basata sull’insegnamento del Vaticano II e sulla tradizione cattolica in generale.

Potremmo rilevare, tuttavia, questa differenza. Il Concilio dice che siamo chiamati alla santità, ma l’articolo 10 dichiara che i membri dell’Ordine Secolare tendono alla santità. È guardare la stessa realtà da due diverse angolature. Siamo prima chiamati alla santità, e poiché siamo chiamati da Dio, rispondiamo tendendo verso quella meta che Dio ci ha posto davanti. È importante rendersi conto che il nostro tendere non è che la nostra risposta libera e cosciente all’invito di Dio (come affermato dall’articolo 8 della Regola di Vita).

Il Concilio poi continua dicendo che “nei vari generi di vita e nei vari uffici un’unica santità è coltivata da quanti sono mossi dallo Spirito di Dio” (Lumen Gentium, 41). Il Servo Secolare, avendo accettato l’invito o la chiamata di Dio alla santità, deve chiedersi in che modo questa può essere raggiunta.

Quanto affermato ci porta alla seconda parte dell’articolo 10: i membri si sostengono vicendevolmente gli uni gli altri. Questo è il modo in cui i Servi Secolari tendono alla santità: non come individui isolati ma nel darsi mutuo appoggio e ispirazione nel loro camminare insieme verso Dio. La Regola specifica i settori di vita in cui tale mutuo appoggio deve realizzarsi: nella loro vita matrimoniale, familiare e sociale e nell’impegno attivo nel mondo. Il Servo Secolare tende verso la meta della santità o della pienezza della vita cristiana, alla quale Dio lo ha chiamato, non da solo ma insieme agli altri, ed insieme essi fanno della loro vita matrimoniale, familiare e sociale e dell’impegno attivo nel mondo un mezzo per raggiungere quella meta.

Tutto questo è sintetizzato dal Concilio Vaticano così: i fedeli devono aiutarsi a vicenda a vivere una vita più santa anche con opere propriamente secolari (Lumen Gentium, 36).

Quattro sono gli aspetti della vita ricordati. Matrimonio, famiglia, vita sociale, impegno attivo nel mondo sono gli ambiti sui quali ogni Fraternità dell’ Ordine Secolare deve esaminarsi. I quattro ambiti saranno nuovamente ricordati nel capitolo 6, a proposito dell’apostolato, ma sono presupposti negli altri capitoli come la realtà fondamentale sulla quale il resto della Regola è costruito.

È compito perciò di ogni Fraternità Secolare Servitana verificare che tale aiuto reciproco nei quattro settori sia attivamente promosso: sia questo uno dei temi principali da sviluppare nelle riunioni.

Infine, l’articolo ne richiama la modalità di attuazione: secondo la spiritualità dell’ Ordine dei Servi, seguendo le sue direttive e la Regola di Vita. Infatti, il resto della Regola è un adattamento pratico della spiritualità servitana per tutti quelli che vivono nel mondo. La Regola ne dà una codificazione che serva da guida ai membri. Perciò, l’articolo 10 deve essere tenuto presente nel corso dello studio della Regola.

ARTICOLO 11

L’ articolo 10 presenta una descrizione essenziale dell’ Ordine Secolare dei Servi. Gli altri articoli del primo capitolo introducono aspetti o temi rilevanti che rendono questa descrizione della vita secolare servitana una realtà vivente. Sono soltanto una “introduzione” perché in effetti i tre articoli immediatamente seguenti (11-12-13) annunziano vari argomenti che verranno approfonditi in capitoli successivi. La vita dei membri dell’Ordine Secolare deve essere quella di una Fraternità (articolo 11, già sviluppato nel capitolo 2); essi devono anche essere impegnati tanto nella preghiera quanto nell’ azione (articolo 12, sviluppato nei capitoli 3 e 6); si sono dedicati a Maria (articolo 13, sviluppato in molti articoli come il 24, 29, 35, 37, 42, 47, 48 e il 53). Tutto questo è contenuto nella Promessa che il Servo Secolare emette alla fine del tempo di Noviziato (articolo 14, sviluppato nel capitolo 10).

Art. 11. Impegnati ad attualizzare l’esperienza religiosa dei Primi Sette Padri che vissero in comunione fraterna per un migliore servizio a Dio, alla Vergine, ai fratelli e alle sorelle, anche i Servi di Maria Secolari, riuniti nel nome del Signore, trovano nella Fraternità Secolare la Sua presenza e il sostegno per realizzare la speciale chiamata alla santità.

Il pensiero centrale di questo articolo è che i Servi Secolari vogliono vivere una vita di Fraternità, proprio come hanno fatto i Sette Fondatori. Tale vita comunitaria poi avrà tre conseguenze: li renderà coscienti della presenza del Signore in mezzo a loro; sarà un sostegno nel loro cammino verso Dio; li aiuterà ad essere sempre più servi degli altri: di Dio, di Nostra Signora, dei loro fratelli e sorelle.

L’articolo 10 ha dichiarato che i Servi Secolari tendono alla santità in sintonia con la spiritualità dell’Ordine. L’articolo 11 è una applicazione di questo principio perché dice che i Servi Secolari vogliono vivere in comunione scambievole come lo hanno fatto i Sette Santi Fondatori dell’Ordine. La Legenda de Origine rileva tale dimensione a proposito dei Sette, mentre essi erano laici viventi nel mondo.

“L’amicizia di carità li portava con dolcezza e amore non solo a un perfetto accordo nel valutare alla luce del volere di Dio le cose divine e umane, ma anche a non poter tollerare di stare lontani gli uni dagli altri: la separazione perfino di un’ora sola era da loro sofferta con grande disagio. L’amicizia… li ispirò anche ad abbandonare le cose terrene e a dimenticarle del tutto. Essa li aiutò a restare saldi in questo proposito fino a far sorgere in loro l’idea di vivere insieme in una unità non solo di anima ma anche di vita, in modo da sostenersi reciprocamente con i buoni esempi, le parole e le opere” (n. 29).

Questa concreta unione di anima e cuore da parte dei Sette Fondatori è l’immagine che i Servi, inclusi i Servi Secolari, desiderano fare propria. E un alto ideale, espresso (come abbiamo detto a proposito dell’articolo 1) negli Atti degli Apostoli (4, 32), e ripreso poi alla fine del secolo IV nella Regola di Sant’Agostino. I Sette Fondatori si impegnarono infine a seguire la Regola di Sant’Agostino che sembrava esprimere bene il loro desiderio di una Comunità fondata sull’unità del pensiero e del volere. Quali sono i risultati pratici derivanti da tale comunione d’amore? L’articolo 11 ne elenca tre.

1. Primo, questa comunione li rende coscienti della presenza del Signore in mezzo a loro. Qui si concretizzano le parole di Gesù: “dove sono due o tre riuniti nel mio nome, io sono in mezzo a loro” (Mt 18, 20). Ogni volta che i credenti sono uniti nella mente e nel cuore, rendono la presenza di Gesù una realtà in mezzo a loro.

2. La comunione di cuori e anime come si trova nella vera Comunità che è l’Ordine Secolare, è la base del mutuo sostegno che l’articolo 10 aveva considerato come un elemento essenziale della vocazione nell’Ordine Secolare. Questo risalta anche nel brano della Legenda de Origine sopra citato: la “comunione” o “Comunità” tra i Sette li rese capaci di abitare insieme per “sostenersi reciprocamente con buoni esempi, con parole e con opere”.

Questo tipo di mutuo sostegno è ora ulteriormente precisato: non si tratta soltanto del loro comportamento; esso invece include tutto il loro agire e il modo di comportarsi tra di loro. Pertanto la Fraternità Secolare ha un grande ideale: non solo non parlare male o spettegolare degli altri, ma, in maniera più positiva, essere sostegno degli altri attraverso la parola che viene detta. San Paolo esprime questa stessa realtà nella lettera agli Efesini: “nessuna parola cattiva esca più dalla vostra bocca; ma piuttosto parole buone che possano servire per la necessaria edificazione, giovando a quelli che ascoltano.” Paolo era ben conscio che le parole che rivolgiamo ad altri o diciamo degli altri possono distruggere una persona (la maldicenza) o possono costruire la persona: le nostre parole possono essere un vero sostegno per la persona.

3. Infine la Fraternità creata dall’unità di anima e cuore nel Signore, ci mette nella possibilità di rendere un miglior servizio a Dio, a Nostra Signora e agli altri. Non solo ci aiuta a camminare più speditamente verso Dio, ma anche “esplode” fuori di noi. Un vero amore scambievole che realizza la presenza di Dio in mezzo a noi, non può restare rivolto solo all’interno. Questo amore deve trovare una via di uscita nel servizio a Dio, a Nostra Signora, e agli altri uomini e donne, nostri fratelli e sorelle.

ARTICOLO 12

L’articolo 12 continua ad enunciare in forma sommaria alcuni aspetti della vita Secolare Servitana che sarà considerata con maggiori particolari più avanti. In questo articolo si trovano due insegnamenti significativi.

Art. 12. Nell’ascolto della Parola di Dio e nella preghiera i Servi di Maria Secolari approfondiscono la propria vocazione cristiana e la propria missione nella comunità ecclesiale e nel mondo. Come parte viva nella Chiesa, si impegnano a conoscerne e viverne gli insegnamenti nella vita e nell’apostolato.

Il primo punto è l’ascolto della Parola di Dio e la preghiera. Sebbene la Regola non sviluppi qui il senso della “Parola di Dio”, certamente ne afferma il ricco e profondo significato. Cristo è la parola di Dio e così il Servo e la Serva Secolare devono ascoltare con attenzione il Cristo che parla nella loro vita. Per di più la Parola di Dio indica la Scrittura, e pertanto il Servo Secolare deve anche ascoltare la Scrittura, non solo come è proclamata, ma in tutta la sua interezza. Però la Parola di Dio si è fatta conoscere a noi non nella Scrittura, ma tramite l’ascolto come si legge nella prima lettura della Vigilia de Domina: “alla Vergine del Fiat”.

Vivere nell’ ascolto della Parola,
attenti ai suoi richiami
nel segreto del cuore,
vigili alle sue manifestazioni
nella vita dei fratelli,
negli avvenimenti della storia,
nel gemito e nel giubilo del creato.

Il tema della preghiera sarà approfondito in seguito (art. 24) quale incontro con Dio nella fede. Inteso in questo modo, l’ascolto alla Parola di Dio può essere considerato anche una preghiera.

Come nell’ articolo precedente sulla Fraternità, così troviamo che la preghiera e l’ascolto alla Parola di Dio, pur essendo azioni interiori e personali, devono attualizzarsi nel mondo. Non soltanto dobbiamo sentire la Parola di Dio pronunciata intorno a noi e nelle difficoltà dei nostri tempi, ma dobbiamo fare sì che la Parola di Dio dentro di noi, l’intenso incontro con Dio nella fede, accrescano la comprensione della nostra vocazione e missione nella Chiesa (Comunità ecclesiale) e nel mondo. Dio non solo chiama il Servo Secolare (vocazione = chiamata) ma lo invia o lo invia nel mondo per portare la presenza di Dio agli altri (missione = invio).

La seconda parte di questo articolo è il risultato della prima parte: giacché il Servo Secolare, con la preghiera, approfondisce il senso della missione nella Chiesa, come membro di essa deve essere interessato a conoscere e a vivere gli insegnamenti della Chiesa. La preghiera ci guida a Dio, verso la Parola che è Cristo, e poi al Corpo di Cristo. Di necessità il Servo Secolare deve perciò essere coinvolto nella Chiesa, ma – come vedremo – questo coinvolgimento deve avvenire precisamente nella dimensione “secolare”. Questo rapporto con la Chiesa sarà ulteriormente approfondito negli articoli 18, 26, 39 e 41.

ARTICOLO 13

L’articolo 13 enuncia una tematica centrale che sarà ripresa almeno da una mezza dozzina di articoli: il rapporto fra i Servi di Maria e la loro “Signora”. Questo articolo è immensamente ricco nel suo contenuto e quindi nel suo significato. E ricco nel suo significato perché dice esplicitamente di essere conforme allo spirito o alla spiritualità dell’Ordine. Anche se l’intera Regola è certamente un’espressione della spiritualità servitana, la Regola vuole attribuire una speciale attenzione a questo particolare articolo in quanto è conforme allo spirito servitano. E ricco nel suo contenuto perché pone le fondamenta dei maggiori temi riguardanti la relazione fra i “Servi” e la “Signora”.

Art. 13. Il Servo di Maria Secolare, secondo lo spirito dell’Ordine, si ispira costantemente a Maria, Madre e Serva del Signore, come ad immagine conduttrice che lo spinge a una vita semplice e di servizio, tutta orientata verso Dio. Nella Vergine vede il modello perfetto del discepolo di Gesù; a Lei si dedica totalmente, la celebra particolarmente come la Vergine Addolorata e, attraverso lo studio e la preghiera personale, si impegna ad approfondirne la conoscenza e il ruolo nel mistero della salvezza.

Un commento completo di questo articolo avrebbe bisogno di un lungo trattato, ma qui cercheremo di dare uno schema del nostro rapporto con Maria come è indicato dall’articolo stesso. Organizzeremmo il materiale in due parti: primo, i titoli che sono attribuiti a Maria, perché richiamano quegli aspetti della vita di Maria che sono più familiari alla mente e alla penna dei Servi di Maria; secondo, le tematiche più significative che ci aiutano a spiegare il nostro rapporto di Servi con Maria.

1. Attributi che qualificano Maria. In questo articolo tre sono gli attributi applicati a Maria: Madre del Signore, Serva del Signore e Vergine Addolorata. I primi due, riguardanti Maria in quanto è la nostra costante ispiratrice, sono stati presi direttamente dal primo articolo delle Costituzioni dei frati, e sono stati considerati nel commento del primo articolo di questa Regola. Sono titoli biblici: Elisabetta infatti disse a Maria, “a che debbo che la madre del mio Signore venga a me?” (Lc 1, 43). Qui è indicato il ruolo unico di Maria nella storia della salvezza e vi si trova la motivazione fondamentale per cui noi possiamo chiamarci suoi servi. All’ Annunciazione, Maria ha proclamato se stessa serva del Signore (Lc 1, 38) e poi si è attribuita ancora questo titolo nel canto del Magnificat: “ha guardato l’umiltà della sua serva” (Lc 1, 48). Maria è così un esempio di servizio per noi.

Il titolo di Vergine dei dolori riconosce la verginità di Maria e i suoi dolori, realtà entrambe bibliche. Si potrebbe rilevare che tradizionalmente, dal XVI-XVII secolo, i Servi hanno contemplato Maria soprattutto nei suoi dolori.

Nell’articolo 3 abbiamo già rilevati altri due titoli di Maria: Madre di Dio e nostra, Figlia di Sion.

Altri due titoli ricorrono nel Rito di Ammissione: discepola di Cristo (n. 40) e Nostra Signora (n. 44).

Si vede subito la predilezione per i titoli scritturistici. Però non si vuole dire che la validità e l’uso di altri titoli siano negati: infatti sono usati dagli scrittori Servitani in altri contesti. Ma indicano che un “servo” tende a guardare Maria in un modo particolare. Questo è vero anche nelle Costituzioni dei frati, come lo indica uno studio fatto da Fra Lawrence Choate, Drawing Inspiration from Their Lady: Mary in the Constitutions of the Friar Servants after Vatican Council II (Ispirandosi alla loro Signora: Maria nelle Costituzioni dei Frati Servi dopo il Concilio Vaticano II), in Marianum 45 (1983), p. 629-677.

2. In secondo luogo guarderemo ai temi più importanti che l’articolo ha espresso a riguardo della nostra relazione con Maria. Ci sono almeno 5 temi: 1. Ispirazione, 2. Esempio, 3. Dedizione, 4. Onore, 5. Studio.

a. I Servi Secolari, seguendo l’ideale dei frati così come è descritto nelle loro Costituzioni (art. 1), si ispirano costantemente a Maria. Ispirazione vuoi dire che prendiamo i nostri ideali, le motivazioni del nostro agire, la nostra concezione spirituale, da Maria. E questa ispirazione è detta “costante”: non è qualcosa che viene e va, ma è permanente nella nostra vita. Come abbiamo detto prima, l’Ordine Secolare è una forma di vita non una serie di azioni sconnesse. Poiché ci siamo dedicati all’Ordine Secolare in quanto comporta uno stile di vita, questo deve avere un influsso su tutto ciò che siamo e facciamo. Tale tipo di vita trova le sue radici nella consacrazione battesimale (art. 9) lo Spirito Santo rimane la nostra prima e radicale fonte d’ispirazione.

b. Maria è l’esempio per i Servi Secolari da seguire in vari modi. In questo articolo Maria è descritta come l’immagine-guida di una vita di semplicità e di servizio. La sua vita non è stata esteriormente diversa da quella delle altre donne di Nazaret del suo tempo. L’articolo 47 esplicita maggiormente tale idea, dicendo che Maria è il modello per ogni Servo dal momento che ha condiviso sulla terra la vita che è comune a tutti. Ella non solo si è proclamata una Serva del Signore davanti all’Angelo Gabriele (Lc 1, 38), ma anche ha dimostrato il suo servizio agli altri recandosi a visitare Elisabetta nella sua nécessità (Lc 1, 39-56) e notando con delicatezza che la coppia nuziale di Cana non aveva vino sufficiente (Gv 2, 1-11): fatti rivelatori della preoccupazione che anche noi dovremmo avere verso Dio e verso i nostri fratelli e sorelle. Infatti, nell’articolo 37, Maria è detta nostro esempio nell’irradiare l’amore di Cristo nel mondo e nella dedizione di noi stessi agli altri.

Come discepola del suo Figlio, diventa per noi modello del nostro discepolato (art. 13), e la sua vita interiore di preghiera diventa guida per noi nel nostro itinerario di preghiera verso Dio (art. 24).

c. L’articolo afferma inoltre che i Servi Secolari sono dedicati totalmente a Dio e si dedicano completamente a Maria. La nostra dedicazione a Maria è espressa bene nella Legenda de Origine, n. 18:

“Temendo la loro imperfezione, pensarono giustamente di mettere umilmente se stessi e i loro cuori, con ogni devozione, ai piedi della Regina del cielo, la gloriosissima Vergine Maria perché Ella, come mediatrice e avvocata, li riconciliasse e li raccomandasse al Figlio suo e, supplendo con la sua pienissima carità alle loro imperfezione, ottenesse loro misericordiosamente fecondità di meriti. Per questo mettendosi a onore di Dio al servizio della Vergine Madre sua, volevano fin da allora essere chiamati ‘Servi di Santa Maria’, assumendosi un regolamento di vita secondo il consiglio di persone sagge “.

Questa dedicazione a Maria è espressa in termini che riflettono il mondo medioevale: il servo è conscio della propria debolezza e mancanza di protezione, perciò cerca qualcuno che gli offra protezione ed aiuto. Egli si mette al servizio di uno che diventa il suo “signore” (o la sua “signora”) e in cambio riceve la protezione e l’aiuto che il signore (o la signora) può dare. Per questa ragione il titolo mariano di “Nostra Signora” (che in italiano equivale a Madonna) è stato uno dei titoli preferiti dai membri dell’Ordine dei Servi. Tale dedicazione o consacrazione, come è chiamata a volte, si esprime in diverse forme secondo il tempo e la cultura. La forma più conosciuta è quella promossa da San Luigi di Montfort che usa terminologia ed esempi familiari alla spiritualità francese dei secoli XVII e inizio del XVIII.

d. Come conseguenza della nostra totale dedicazione a Maria, noi la onoriamo. L’articolo 29 darà esempi di come tradizionalmente i Servi hanno espresso questo onore a Maria e suggerisce che tali esempi siano seguiti anche dalle Fraternità dell’Ordine Secolare. Conviene rilevare che queste pratiche devozionali in onore di Maria sono sempre state considerate come espressioni derivanti dalla nostra dedicazione a Maria: esse non costituiscono la nostra dedicazione. Cioè, il nostro “servizio a Maria” coinvolge tutto il nostro modo di vivere e non può essere sostituito dalla recita di certo tipo o numero di preghiere o dall’esecuzione di determinate azioni.

e. Infine, questo articolo indica che i Servi Secolari devono preoccuparsi di approfondire la loro conoscenza di Maria. L’articolo offre due riferimenti, due modi in cui fare questo: con lo studio e con la preghiera personale. Altri modi possono essere costituiti da conferenze o lezioni negli incontri regolari delle Fraternità dell’Ordine Secolare o in altre occasioni, ecc. Il nostro studio deve considerare Maria in se stessa, e anche nel suo ruolo nella storia della Salvezza.

Ci sono altri due aspetti meritevoli di commento che non si trovano nella Regola di Vita, ma sono ricordati nel Rito della Promessa. Il primo è il “servizio” a Maria. Poiché siamo Servi di Maria, una più ampia menzione del servizio a Maria ci sembrerebbe opportuna. Ma lo troviamo ricordato solo nell’articolo 11, insieme al servizio a Dio e agli altri. Al numero 80 del Rito della Promessa il celebrante prega per quelli che Dio ha chiamato al “servizio della Vergine Maria”. Non viene data alcuna definizione o descrizione di ciò che “servizio” alla Vergine significhi. Questo si deve al fatto che, come abbiamo detto sopra riguardo alla dedicazione, il nostro servizio o dedicazione a Maria è l’intero nostro modo di vivere, non questa o quella pratica devozionale, preghiera o anche servizio ad altri. Se qualcuno vi chiede che significhi “servire Maria”, la migliore risposta è dire semplicemente “l’intera forma di vita descritta nella nostra Regola”.

Un altro elemento che sembra omesso è il ruolo di Maria verso i suoi servi. Tuttavia esso viene espresso in forma generica quando il celebrante accetta i nuovi membri nella Famiglia dei Servi (n. 83 del Rito della Promessa). Dobbiamo vivere in unità di spirito, e “seguire lo stesso ideale di vita, sotto la protezione della Beata Vergine”. Come detto prima, nel Medioevo il servo si poneva al servizio del signore o della signora per avere in cambio la protezione che un più potente padrone poteva offrire. La nostra dedicazione è vissuta sotto la protezione e con l’aiuto della Vergine Maria.

ARTICOLO 14

L’articolo 14 conclude il primo capitolo della Regola.

Art. 14. Il Servo di Maria Secolare esprime liberamente l’impegno di fedeltà alla propria vocazione secolare e il legame vitale con l’Ordine per mezzo della Promessa.

L’obiettivo della Promessa che i Servi di Maria Secolari emettono dopo il periodo di Noviziato è quello di esprimere pubblicamente il proprio impegno di fedeltà alla vocazione e alla forma di vita indicata nella Regola. Nello stesso tempo essi dichiarano che desiderano stabilire e mantenere un legame vitale con il resto dell’Ordine Servitano. E detto “legame vitale”, perché deve essere costantemente nutrito per crescere e mantenersi forte. Se questo legame viene abbandonato o non sufficientemente curato, presto deperirà e morirà.

CAPITOLO SECONDO

LA VITA DELLA FRATERNITÀ SECOLARE

Il secondo capitolo della Regola di Vita è una ulteriore spiegazione della Fraternità dell’Ordine Secolare che è già stata descritta nell’articolo 11. L’articolo 11 stabiliva che la Fraternità dell’Ordine Secolare è modellata sull’esempio dei Sette Santi Fondatori, e perciò si presenta come parte della spiritualità dell’ Ordine. L’ importanza della Fraternità può cogliersi dal fatto che la santità, che è l’obiettivo di tutta la vita cristiana, deve raggiungersi “secondo la spiritualità dell’Ordine” (art. 10). Poiché la vita dell’Ordine Secolare è modellata sulla vita dei Sette Santi Fondatori, la vita fraterna si presenta come il primo elemento della spiritualità dell’Ordine. Il modo con cui i Servi Secolari tendono alla santità si attua non nell’isolamento dagli altri, ma nella comunione con gli altri Servi Secolari e con l’intera Famiglia Servitana.

Ci sono sette articoli nel secondo capitolo. I tre primi articoli (art. 15-16-17) trattano delle finalità e del lavoro interno alla Fraternità; i tre seguenti (art. 18-19-20) trattano del rapporto della Fraternità dell’Ordine Secolare con gli altri Gruppi; e infine l’articolo 21 si occupa di questioni finanziarie.

ARTICOLI 15-17

Gli articoli 15 e 17 continuano la discussione cominciata nell’articolo 11 sulle ragioni per cui la Fraternità dell’Ordine Secolare si raduna insieme. Adesso si aggiungono almeno quattro ragioni alle tre dell’articolo 11.

Art. 15. Ad imitazione dei primi cristiani che “erano un cuor solo e un’anima sola”, i fratelli e le sorelle dell’Ordine Secolare dei Servi di Maria si riuniscono nel segno della comunione fraterna per approfondire la conoscenza reciproca, per sostenersi nel comune cammino di perfezione cristiana, nel servizio di amore verso tutti gli uomini.

Art. 17. La Fraternità Secolare si riunisce per la proclamazione e la riflessione sulla Parola di Dio e per l’esame e l’approfondimento della Regola, di temi umani, sociali, religiosi e argomenti propri della vita dei Servi.

Il capitolo comincia con l’esempio dell’unità di cuore e anima dei primi cristiani. E un richiamo agli Atti degli Apostoli (4, 32), che ha avuto un grande influsso nella vita della Chiesa e specialmente negli Ordini religiosi.

L’articolo 11 ha già elencato due ragioni per essere Fraternità: essa rende capaci di prestare un più grande servizio a Dio, alla Beata Vergine, ai fratelli e alle sorelle; in essa i Servi dell’Ordine Secolare trovano il sostegno di cui hanno bisogno per rispondere alla loro speciale chiamata alla santità. Dopo aver osservato che l’incontrarsi insieme è un segno della loro mutua comunione, gli articoli 15 e 17 aggiungono quattro punti.

1. L’approfondimento della conoscenza reciproca. Il motivo di questa conoscenza è non vana curiosità o desiderio di notizie per spettegolare. La conoscenza personale acquisita negli incontri dell’Ordine Secolare dovrebbe normalmente essere mantenuta nei limiti di una confidenza che rispetta ciascuna persona e per questa ragione permette una discussione aperta e libera. Il grado di scambio di conoscenza varierà da persona a persona, semplicemente perché ogni individuo si sente di parlare più liberamente di argomenti personali con certe persone e non con altre. Tuttavia, l’articolo indica che ogni membro deve essere interessato a tutti gli altri membri. Perciò, le riunioni devono essere strutturate in maniera che questo diventi possibile.

2. Il fortificarsi reciproco nel cammino comune verso la perfezione cristiana e nell’amoroso servizio a tutti. E una riaffermazione della descrizione generale dell’Ordine Secolare fatta nell’articolo 10. I membri dell’Ordine Secolare Servitano si sostengono vicendevolmente nella loro vita matrimoniale, familiare e sociale e nell’impegno attivo nel mondo.

3. Proclamare la Parola di Dio e riflettere insieme su di essa. Ogni volta che un gruppo si riunisce nel nome del Signore (art. 11), deve ascoltare ciò che il Signore gli dice in quel momento particolare della propria vita. Ordinariamente il Signore parla attraverso la parola che si trova nella Sacra Scrittura; ma, come abbiamo visto, la Parola di Dio può arrivarci anche in forme differenti. Una volta che l’abbiamo ascoltata, dobbiamo riflettere su di essa, per farla diventare parte di noi stessi. Tradurla in azione è il necessario passo ulteriore.

4. Esaminare e studiare la Regola, argomenti di interesse umano, sociale e religioso, e questioni relative alla vita dei Servi. È conclusione naturale dell’articolo 10. Se i membri dell’Ordine Secolare devono sostenersi gli uni agli altri nella vita matrimoniale, familiare e sociale e nell’impegno attivo nel mondo, ne consegue che questi devono essere gli argomenti di discussione e di studio durante le riunioni. Poiché i Servi Secolari tendono alla santità secondo la spiritualità dell’ Ordine, dovrebbero anche essere studiate questioni relative alla vita dei Servi. Alcuni esempi possono mostrare la grande varietà e ricchezza di argomenti accessibili ai Servi Secolari da utilizzare nei loro incontri. Nel decreto sull’Apostolato dei Laici (n. 29) il Concilio Vaticano II dice che si devono coltivare le buone relazioni umane. I veri valori umani devono essere incoraggiati, specialmente l’arte di vivere fraternamente con gli altri, il cooperare e intraprendere un dialogo con loro. Sono esempi di argomenti di interesse umano che le Fraternità dell’Ordine Secolare potrebbero esaminare e studiare. Si potrebbero anche studiare le dottrine sociali della Chiesa, o forse in una forma più concreta, analizzare le necessità sociali dell’area in cui la Fraternità si trova, per esempio, problemi di criminalità, fame, razzismo, casa, educazione, ecc. Argomenti di interesse religioso che possono diventare opportunamente temi di discussione sono la Scrittura, la liturgia, la spiritualità, scritti spirituali.

È compito del Consiglio locale o forse anche di tutti i membri della Fraternità decidere quali argomenti siano da trattare nelle riunioni e il metodo con cui devono essere trattati. È bene che il Consiglio prepari un programma per alcuni mesi, così che i temi possano essere fruttuosamente studiati.

[Gli Statuti particolari per l’Italia forniscono ulteriori linee di riferimento. Perciò la prassi per questo quarto punto dell’articolo va completata con l’attuazione del relativo numero dello Statuto]

ARTICOLO 16

Gli articoli 15 e 17 ci hanno fornito le ragioni generali per cui l’Ordine Secolare è organizzato in Fraternità e hanno anche dato alcuni suggerimenti per il contenuto delle riunioni. L’articolo 16 adesso parla molto generalmente del modo con cui gli incontri devono essere condotti.

Art. 16. Ogni membro dell’Ordine Secolare partecipa attivamente agli incontri periodici che celebrano la vita della Fraternità, offrendo con semplicità il proprio contributo di esperienze e di idee.

Anche se i principi affermati da questo articolo sembrano ovvii, è sempre bene ricordarli. Nessun membro deve essere un osservatore meramente passivo durante l’incontro di Fraternità. Non tutti certo sono capaci di parlare con cognizione scientifica su un particolare argomento, ma tutti possono dare un contributo partendo dalla propria esperienza personale. Per questa ragione, ogni membro deve mettere in comune i suoi personali pensieri e le esperienze, semplicemente e senza ostentazione o pretese. E compito di chi presiede la riunione vigilare che nessuno domini l’incontro a danno di un libero scambio fra tutti i membri della Fraternità, perché solo in questo modo la vita fraterna può essere celebrata in verità.

ARTICOLI 18-19

Dopo l’analisi del lavoro interno della Fraternità Secolare, la Regola considera adesso i rapporti tra questa e gli altri Gruppi al di fuori di essa. Ogni Fraternità Secolare deve essere dunque consapevole di questi molteplici rapporti così che nei suoi incontri e nel suo sguardo d’insieme non trascuri il mondo che le sta attorno.

Art. 18. La Fraternità Secolare è vitalmente collegata con la Chiesa locale e con la comunità religiosa della Famiglia dei Servi, della quale condivide la spiritualità e con la quale collabora nell’impegno apostolico.

Art. 19. 1 fratelli e le sorelle della Fraternità Secolare, secondo le possibilità, partecipano ai momenti di preghiera della comunità religiosa e, quando siano invitati, a incontri di rinnovamento spirituale, al capitolo, alla mensa.

I due primi rapporti esterni menzionati sono quelli con la Chiesa locale e con la locale Comunità religiosa Servitana. L’articolo 8 ha già ricordato ai membri dell’Ordine Secolare che la loro è una vocazione dentro la Chiesa ed è per questo che l’articolo 12 insiste affinché venga approfondito il senso di vocazione e missione nella Chiesa e nel mondo. L’articolo 39 sull’apostolato sottolineerà il loro ruolo attivo dentro la Chiesa.

Gli articoli succitati guardano di più al singolo Servo Secolare, mentre l’articolo 18 parla della Fraternità Secolare. Pertanto, la Fraternità Secolare come tale deve essere cosciente, attraverso le sue attività, gli incontri, gli argomenti discussi nelle riunioni e attraverso la preghiera, di essere parte integrante della più vasta Chiesa che la circonda. Questa può essere la parrocchia locale, la diocesi dove si trova, o la Chiesa universale diffusa in tutto il mondo. La Fraternità Secolare locale deve riconoscersi parte di questa più ampia realtà e dimostrarlo con le sue azioni.

La Fraternità Secolare locale ha inoltre dei legami con la Comunità religiosa servitana locale. Questo presuppone che la Fraternità Secolare si trovi in prossimità della Comunità religiosa, che è una Comunità di frati o di religiose. Quando non è così, il legame vitale con l’Ordine dei Servi è mantenuto attraverso l’Assistente con lettere, notiziari, ecc.

L’articolo 19 specifica alcuni modi in cui questo legame vitale può esprimersi: per prima cosa partecipando alla vita di preghiera della Comunità religiosa. Molte Fraternità Servitane celebrano ogni giorno la preghiera della Chiesa, la mattina e la sera, con i membri della Comunità parrocchiale. Questa è una forma in cui i Servi Secolari possono mostrare il loro rapporto con la Comunità di frati o di religiose. Viene suggerito anche la partecipazione agli incontri di rinnovamento, ai Capitoli della Comunità, ai pasti.

L’inciso “quando siano invitati” non è da intendersi come una concessione, ma vuole solo precisare che a volte gli incontri o Capitoli sono diretti più specificamente alle necessità dei frati e delle suore. È anche una sollecitazione rivolta alla Comunità religiosa perché programmi riunioni di rinnovamento o Capitoli con argomenti di interesse comune e inviti l’Ordine Secolare a parteciparvi. La programmazione normalmente dovrebbe essere fatta insieme alla Fraternità Secolare.

ARTICOLO 20

L’ articolo 19 si occupa del rapporto della Fraternità Secolare con la Comunità religiosa vicina. L’articolo 20 considera la relazione con gli altri Gruppi di Servi.

Art. 20. La Fraternità Secolare mantiene costanti rapporti con i fratelli e le sorelle che, per motivi particolari, non possono partecipare agli incontri del gruppo. Li incoraggi e li sostenga nella comunione fraterna e nella crescita religiosa.

Ugualmente mantiene legami di comunione, di fraternità e di collegamento con le altre numerose Famiglie e Gruppi che partecipano all’unica vocazione dei Servi e costituiscono una sola Famiglia.

Particolare attenzione sarà prestata alla comunicazione e alla collaborazione con gli altri Gruppi Laici dei Servi.

La Fraternità Secolare deve mantenere uno stretto rapporto con quei membri che non possono partecipare regolarmente agli incontri. Ci sono circostanze in cui un membro dell’Ordine Secolare non è in grado di partecipare agli incontri per un lungo periodo, o può trovarsi in una situazione che gli impedisca di parteciparvi del tutto. Ciò può essere causato da malattia, o forse da un personale trasferimento in una zona lontana dal luogo dove si svolge la riunione della Fraternità a cui appartiene e mentre, dov’è ora, non esiste alcuna Fraternità dell’Ordine Secolare. Con la corrispondenza, bollettini, ecc., deve essere continuato il rapporto di sostegno e di aiuto per la crescita spirituale.

Ci sono anche casi di Servi Secolari “isolati”, cioè di quelli che non appartengono più a una Fraternità Secolare regolare e vivono lontano a quelle esistenti. Questi casi devono stimolare le Fraternità locali a intraprendere contatti con tali persone e ad analizzare insieme con creatività i modi con cui questi Servi “isolati” possono prendere parte alla Comunità locale.

I legami di comunione devono essere mantenuti con gli altri Gruppi che formano la Famiglia Servitana: frati, monache, suore, membri degli Istituti Secolari, le Diaconie laiche, membri di altre Fraternità dell’Ordine Secolare, altri svariati Gruppi Laici che esistono in diversi paesi. La maniera con la quale questi legami si possono stabilire e mantenere deve essere studiata dalla Fraternità locale. Un modo concreto di mantenere legami di comunione oggi è l’UNIFAS, Unione Internazionale della Famiglia dei Servi, e le sue unità nazionali, o provinciali corrispondenti.

La conoscenza di altri Gruppi è un primo passo. Tale conoscenza può essere ottenuta con la lettura delle Missioni dei Servi che contengono articoli dei Servi di tutto il mondo.

Cosmo è un notiziario bimestrale pubblicato dalla Curia Generale dei frati a Roma. Contiene notizie non soltanto sui frati ma anche sulle religiose, sugli Istituti Secolari e sui Gruppi Laici. Una volta acquisita la conoscenza di tali Gruppi, la Fraternità Secolare può discutere come raggiungerli, o visitandoli o invitandoli a partecipare agli incontri della Fraternità locale. Se il problema è la distanza, si può ricorrere allo scambio di lettere, fotografie o a qualche altro modo similare.

Anche se non è detto in forma esplicita, la Fraternità Secolare locale dovrebbe cercare e stabilire legami di comunione con altre Fraternità Secolari Servitane nella stessa regione, nella nazione o in altri paesi.

ARTICOLO 21

L’articolo 21 è l’unico che menzioni finanze e denaro, e soltanto in forma indiretta.

Art. 21. Nello spirito delle Beatitudini, ogni Fraternità Secolare vive la comunione dei beni. I membri contribuiscono, secondo le possibilità, alle spese delle Fraternità locale, zonale [o provinciale], nazionale e internazionale; aiutano i fratelli e le sorelle che si trovano in particolari difficoltà economiche.

Il riferimento dello spirito delle Beatitudini in questo contesto è vago: nell’ articolo 35 invece la prima beatitudine citata riguarda la povertà. Il significato dell’articolo, tuttavia, è chiaro, anche se è espresso in termini generici. Per esempio, ricorda che la Fraternità Secolare deve condividere i suoi beni. Ma non dice che cosa siano questi “beni”. Ovviamente, è implicito che la Fraternità Secolare debba avere qualche entrata, e certo da parte dei suoi membri, e che da queste entrate tutte le spese comuni debbano essere pagate. Qualsiasi membro che si trovi in difficoltà finanziarie può essere aiutato dal fondo comune. Per esempio un modo semplice può essere quello di non esigere un contributo per un ritiro dell’Ordine Secolare o altre attività da chi in quel momento non può permetterselo.

In pratica, l’articolo conferma il fatto che la Fraternità Secolare non è un’organizzazione per la raccolta di fondi. Ma ogni gruppo deve stabilire, di comune accordo, quali “tasse” o contributi i membri devono pagare, e con quale frequenza. Naturalmente nessuno può essere escluso dalla Fraternità Secolare se non può pagare questi “contributi”. Una soluzione semplice potrebbe essere quella di avere una cassa dove mettere un contributo libero e anonimo ad ogni regolare riunione.

L’articolo suggerisce anche che la Fraternità Secolare abbia un tesoriere [amministratore] tra gli incaricati ufficiali. Poiché il tesoriere non è menzionato fra gli Ufficiali che ogni Fraternità deve avere, ogni Fraternità determinerà da sé, nei suoi Statuti particolari, i limiti di tempo, il metodo di elezione e i compiti specifici dell’ Ufficio.

Il denaro delle offerte deve coprire le spese della Fraternità; le eccedenze possono essere utilizzate per sostenere iniziative materiali dell’ Ordine o per altre necessità urgenti. Tutte le decisione a questo riguardo devono essere prese dalla Fraternità stessa.

CAPITOLO TERZO

LA PREGHIERA

Il secondo grande argomento nella vita dell’Ordine Secolare, dopo la comunione fraterna, è la preghiera. I dieci articoli sulla preghiera fanno di questo capitolo il più lungo della Regola. Tuttavia, non dobbiamo aspettarci di trovarvi un trattato sulla preghiera. Piuttosto, ci sono alcune suggestioni generali e utili linee di orientamento, che il Servo Secolare deve utilizzare come stimolo per una maggiore comprensione del ruolo della preghiera nella sua vita.

Il seguente schema ci aiuterà a capire meglio il materiale presente in questo capitolo, anche se poi nel commento procederemo secondo l’ordine degli articoli.

1. Necessità della preghiera (art. 22, ripresa anche nell’articolo 23)
2. Definizione di preghiera (art. 24)
3. Gesù e Maria come esempi di preghiera (art. 23, 24)
4. Forme e tipi di preghiera:

• Preghiera personale (art. 23)

• Preghiera comunitaria (art. 25)

• Preghiera liturgica (art. 26)

a. Eucaristia (art. 27-28)

b. b. Lodi e Vespri (art. 28)

• Preghiere in onore della Beata Vergine Maria (art. 29)
• Preghiere per i defunti della Famiglia dei Servi (art. 30)

5. Giorni di ritiro (art. 31)
(6) Due aspetti della preghiera che qui non sono menzionati:

• altre forme di preghiera

• obbligo della recita di alcune preghiere

ARTICOLO 22

L’articolo 22 si incentra sulla necessità della preghiera, ma come si può vedere dallo schema precedente, anche l’articolo 23 sottolinea la necessità della preghiera personale.

Art. 22. La preghiera, se è un dovere essenziale per ogni cristiano, per il Servo di Maria Secolare che ha scelto di seguire Cristo, il suo esempio e il suo insegnamento costituiscono un impegno particolare per crescere nella fede e nella speranza e per portare a perfezione il comand mento dell’amore.

Esistono molte “definizioni” di preghiera, una delle quali è suggerita nell’articolo 24. Ma nessuna definizione può ignorare il fatto che la preghiera include sempre un’espressione di relazione viva e vitale con Dio. Perciò, essa è una presenza essenziale in ogni vita cristiana. Senza preghiera non esiste alcun rapporto personale e consapevole con Dio, un rapporto che si muove secondo due direzioni: da Dio all’individuo e dall’individuo a Dio. Certamente, abbiamo altri rapporti con Dio, per esempio il rapporto di creatura a Creatore. Ma solo nella preghiera riconosciamo consapevolmente questi rapporti.

E molto significativo per noi che, nel nostro caso, la preghiera sia vista come mezzo per portare alla perfezione il comandamento dell’amore. Nell’articolo 9 abbiamo visto che accettando il dono della vocazione, il Servo Secolare s’impegna a “portare a pienezza il comandamento evangelico dell’amore”. Adesso la Regola afferma esplicitamente che la preghiera è un mezzo per raggiungere tale obiettivo. La preghiera contribuisce non soltanto alla crescita dell’amore ma anche alla crescita della fede e della speranza.

La descrizione che qui viene data del Servo Secolare merita un commento. Il Servo Secolare è uno che ha scelto di seguire Cristo, il suo esempio e i suoi insegnamenti. Nella sua enciclica Lo Splendore della Verità Giovanni Paolo Il offre una riflessione particolareggiata sull’incontro del giovane con Cristo e sull’invito che Cristo gli rivolge: “vieni, e seguimi”. Dapprima il papa chiarisce che ogni credente è chiamato a seguire Cristo, non soltanto i Dodici ai quali tale invito fu per la prima volta rivolto nel Vangelo (n. 18). Giovanni Paolo spiega in cosa consista il seguire Cristo. “Non si tratta soltanto di mettersi in ascolto di un insegnamento e di accogliere nell’obbedienza un comandamento. Si tratta, più radicalmente, di aderire alla persona stessa di Gesù, di condividere la sua vita e il suo destino, di partecipare alla sua obbedienza libera e amorosa alla volontà del Padre” (n. 19).

“Seguire Cristo non è un’imitazione esteriore, perché tocca l’uomo nella sua profonda interiorità. Essere discepoli di Gesù significa essere resi conformi a lui, che si è fatto servo fino al dono di sé sulla Croce (cfr. Fil 2, 5-8). Mediante la fede, Cristo abita nel cuore del credente (cfr. Ef 3, 17), e così il discepolo è assimilato al suo Signore” (n. 21).

Questo articolo stabilisce perciò la necessità della preghiera nella vita del Servo Secolare e aggiunge che essa contribuisce al compimento dell’impegno fondamentale della vita del Servo, il comandamento dell’amore datoci dal Signore.

ARTICOLO 23

Dopo aver considerato la preghiera in termini generali nell’articolo precedente, la Regola di Vita diventa più specifica.

Art. 23. Il Servo di Maria Secolare sa che per vivere costantemente alla presenza di Dio è necessaria la preghiera personale, silenziosa, nascosta, quella di cui Gesù stesso diede mirabile esempio.

Nell’articolo si affermano tre cose: in primo luogo, che il vivere costantemente alla presenza di Dio è un ideale riguardante la preghiera; secondo, che la preghiera personale, silenziosa e nascosta è un mezzo necessario per ottenere di vivere alla presenza di Dio; terzo, che Gesù ci dà un esempio a questo riguardo.

Uno dei temi ricorrenti negli scritti dei santi è l’esercizio della presenza di Dio.

Dio, certo, è presente dovunque, come ci ricorda il salmo 139:

Signore, tu mi scruti e mi conosci,

tu sai quando seggo e quando mi alzo.

Penetri da lontano i miei pensieri,

mi scruti quando cammino e quando riposo.

Dove andare lontano dal tuo spirito,

dove fuggire dalla tua presenza?

Se salgo in cielo, là tu sei,

se scendo negli inferi, eccoti.

Paolo disse agli Ateniesi: “in lui infatti viviamo, ci muoviamo ed esistiamo” (At 17, 28). Questo è vero sia dal punto di vista naturale che soprannaturale. Come Creatore, Dio dà vita a tutte le sue creature e le mantiene nell’esistenza Ma anche condivide la sua vita divina con noi, attraverso Cristo e lo Spirito Santo.

Vivere costantemente alla presenza di Dio, perciò, vuol dire riconoscerlo e portare a consapevolezza una realtà che esiste indipendentemente dalla nostra attenzione. Troviamo la presenza di Dio non soltanto in tutta la creazione attorno a noi, ma particolarmente in noi stessi. Quanto più diventiamo coscienti della presenza di Dio intorno a noi e dentro di noi, tanto più siamo attenti ad evitare il peccato e solleciti nel servire Dio.

Come possiamo realizzare questo ideale dei santi? La Regola afferma che un mezzo essenziale per vivere sempre nella presenza di Dio è la preghiera personale, silenziosa e nascosta. Negli articoli che seguono, la Regola afferma pure la necessità di una preghiera comune e vocale. Ma se desideriamo avere una costante consapevolezza della presenza di Dio, dobbiamo necessariamente riflettere dentro di noi, con le parole del nostro cuore e della nostra anima. Anche il Vaticano II nella Costituzione sulla Sacra Liturgia riconosce la grande importanza della preghiera personale e silenziosa.

“La vita spirituale, tuttavia, non si esaurisce nella partecipazione alla sola liturgia. Il cristiano, infatti, benché chiamato alla preghiera comune, è sempre tenuto a entrare nella sua stanza per pregare il Padre in segreto (cfr. Mt 6, 6)” (n. 12).

Infine, i Vangeli ci danno parecchi esempi di Gesù che cercava luoghi solitari per pregare nel silenzio del suo cuore.

“Al mattino si alzò quando ancora era buio e, uscito di casa, si ritirò in un luogo deserto e là pregava” (Mc 1, 35).

“Appena li ebbe congedati, salì sul monte a pregare” (Mc 6, 46).

“Ma Gesù si ritirava in luoghi solitari a pregare” (Lc 5, 16).

ARTICOLO 24

L’articolo 24 prosegue la trattazione sulla preghiera, dandone una breve descrizione e citando poi l’esempio di Maria.

Art. 24. La preghiera è l’incontro con Dio nella fede. In questo cammino la Vergine, altissimo esempio di creatura orante, è per il Servo di Maria Secolare guida sicura e sostegno.

Ci sono molte definizioni e descrizioni di preghiera. Il Catechismo della Chiesa Cattolica ne cita due.

La prima è di Santa Teresa di Lisieux. “Per me, la preghiera è un impulso del cuore; è un semplice sguardo rivolto verso il cielo; è un grido di riconoscenza e d’amore, che abbraccia pena
e gioia”.

La seconda è di San Giovanni Damasceno. “La preghiera è innalzare la mente e il cuore a Dio o chiedere cose buone a Dio” (nn. 2558-2559).

La Regola dell’Ordine Secolare presenta una descrizione più semplice: la preghiera è un incontro con Dio nella fede. Le descrizioni di Santa Teresa e di San Giovanni Damasceno sembrano implicare una fuoruscita da noi stessi, uno sguardo verso il cielo, un elevare il cuore verso Dio. La descrizione nella Regola non cerca di “localizzare” il luogo d’incontro con Dio, che può avvenire “su” in cielo, o dentro l’individuo. Il concetto di luogo, che certamente è metaforico e non va preso alla lettera nelle altre descrizioni, è carente perché manca di quell’elemento essenziale che è l’incontro tra la persona e Dio. Ma questo incontro può avvenire soltanto nella fede. Se Dio è conosciuto con la fede, questa è l’unica maniera che rende possibile un incontro. Senza fede, non può esserci preghiera.

L’esempio della preghiera della Vergine Maria è spiegato più diffusamente nel Catechismo della Chiesa Cattolica (nn. 2617- 2619) che ricava il suo materiale esclusivamente dalla Sacra Scrittura.

… la sua preghiera coopera in maniera unica al Disegno benevolo del Padre: al momento dell’Annunciazione per il concepimento di Cristo, e in attesa della Pentecoste per la formazione della Chiesa, Corpo di Cristo. Nella fede della sua umile Serva il Dono di Dio trova l’accoglienza che fin dall’inizio dei tempi aspettava. Colei che l’Onnipotente ha fatto “piena di grazia”, risponde con l’offerta di tutto il proprio essere: “Eccomi, sono la Serva del Signore, avvenga di me quello che hai detto”.

Il Vangelo ci rivela come Maria preghi e interceda nella fede: a Cana la Madre di Gesù prega il Figlio suo per le necessità di un banchetto di nozze.,.. Ed è nell’ora della Nuova Alleanza, ai piedi della croce, che Maria viene esaudita come la Donna, la nuova Eva, la vera “Madre dei viventi”.

È per questo che il cantico di Maria (il “Magnificat” latino, il “Megalynei” bizantino) rappresenta a un tempo il cantico della Madre di Dio e quello della Chiesa, cantico della Figlia di Sion e del nuovo Popolo di Dio, cantico di ringraziamento per la pienezza di grazie elargite nell’Economia della salvezza, cantico dei “poveri” la cui speranza si realizza mediante il compimento delle Promesse fatte “ai nostri padri, ad Abramo e alla sua discendenza per sempre”.

ARTICOLO 25

Dalla preghiera personale, nascosta, la Regola passa ora alla preghiera comunitaria.

Art. 25. Fedeli alla propria vocazione, i Servi di Maria Secolari danno grande importanza alla preghiera comunitaria. Insieme con i fratelli e le sorelle approfondiscono la Parola di Dio e offrono la loro preghiera per gli uomini e per il mondo.

Ci si rende subito conto della differenza di motivazione dalla preghiera personale: la preghiera personale è necessaria per vivere alla presenza di Dio; ma la preghiera comunitaria appartiene direttamente alla vocazione del Servo Secolare. La vocazione del Servo Secolare infatti è una chiamata alla comunione fraterna (cfr. Regola, art. 11). Perciò, per portare a compimento questo aspetto della vocazione Secolare servitana, un’importante forma di preghiera è la preghiera comune, cioè la preghiera fatta insieme a tutti gli altri membri dell’Ordine Secolare. Pregare con gli altri e per gli altri è uno dei modi con cui i membri si danno scambievole aiuto (cfr. art. 10).

In quale forma si deve celebrare la preghiera comunitaria? La preghiera liturgica, un tipo speciale di preghiera comunitaria, viene trattata nei tre articoli seguenti. La Regola, nell’ articolo 25, richiama l’attenzione su due altre possibili forme. Primo, la Fraternità può usare la Parola di Dio, la Bibbia, come base di preghiera all’interno degli incontri o fra i suoi membri. Un modo per capire meglio non solo il significato della Scrittura ma anche l’importanza di una sua attuazione pratica è il pregare con la Scrittura. Si comprende che tale modalità non è soltanto “proclamare” o “riflettere” sulla Parola di Dio, come dice l’articolo 17. L’articolo 17 sottolinea l’ attività intellettuale dello studio e della riflessione, piuttosto che l’uso del testo come luogo di incontro con Dio, per ascoltare più attentamente Dio che ci parla e formulare la nostra risposta alla sua Parola. Un concetto, questo, più vicino a quello suggerito dall’articolo 12, secondo cui l’Ordine Secolare approfondisce il senso di vocazione e missione attraverso l’ascolto della Parola di Dio e la preghiera.

La seconda forma di preghiera comunitaria suggerita nell’ articolo è la preghiera di intercessione per l’umanità e per il mondo. Questo ovviamente non esaurisce i possibili tipi di preghiera comunitaria (come si dirà più diffusamente alla fine di questo capitolo). Le due forme di preghiera (la preghiera con la Scrittura e la preghiera d’intercessione) sono da considerarsi come forme tipiche e diffuse di preghiera comune, senza però con questo escludere altre forme.

ARTICOLO 26

La Regola dice che la preghiera personale è una “necessità” e la preghiera comunitaria è “di grande importanza”; nell’articolo 26 dà alla preghiera liturgica un posto prioritario.

Art. 26. Tra le varie forme di preghiera, quella liturgica ha la priorità. Il Servo di Maria Secolare parteciperà alla vita liturgica e sacramentale della Chiesa.

La preghiera liturgica include la Messa, i Sacramenti, la Liturgia delle Ore, la Benedetta. Il primato della preghiera liturgica nella vita spirituale e apostolica dei membri dell’Ordine Secolare richiama un insegnamento fondamentale della Costituzione sulla Liturgia Sacra del Vaticano II e ne dà la ragione.

La liturgia è il culmine verso cui tende l’azione della Chiesa e, insieme, la fonte da cui promana tutta la sua virtù. Infatti il lavoro apostolico è ordinato a che tutti, diventati figli di Dio mediante la fede del battesimo, si riuniscano in assemblea, lodino Dio nella Chiesa, prendano parte al Sacrificio e alla Mensa del Signore (n. 10).

Poiché la liturgia include sia la Messa che i sacramenti, l’affermazione che il Servo Secolare deve partecipare alla vita liturgica e sacramentale della Chiesa deve essere considerata non mera ridondanza, ma un modo più esplicito per dire che la Messa e i sacramenti sono elementi importanti nella vita spirituale del Servo Secolare. Per quel che riguarda i sacramenti, un riferimento specifico è fatto all’Eucaristia nell’articolo 27 e 28, e al sacramento della Riconciliazione nell’articolo 34.

I due articoli seguenti precisano più dettagliatamente questa partecipazione.

ARTICOLO 27

Fra le molte forme di preghiera liturgica la Messa assume l’importanza più rilevante.

Art. 27. Nell’Eucaristia, l’espressione più alta della preghiera ed il segno sacramentale della Fraternità Secolare locale, i fratelli e le sorelle attualizzano la Pasqua del Signore e realizzano il legame d’amore tra loro e con tutti gli uomini.

Anche quest’articolo è basato sull’insegnamento del Vaticano II. Nella Costituzione Dogmatica della Chiesa (Lumen Gentium) l’Eucaristia è chiamata fonte e culmine della vita cristiana (n. 11) e partecipando al corpo del Signore siamo in comunione con lui e tra di noi (n. 7). Nel Decreto sul Ministero e la Vita dei presbiteri viene sottolineato che l’Eucaristia contiene l’intera salvezza della vita spirituale della Chiesa, cioè Cristo stesso, nostra Pasqua e cibo di vita (n. 5).

La Regola di Vita presenta all’approfondimento dei membri dell’Ordine Secolare vari aspetti della Messa. Essa è la più alta forma di preghiera che i membri possono attuare per incontrare Dio nella fede e, poiché nella condivisione dell’Eucaristia i membri di Cristo diventano un solo corpo, l’Eucaristia è il segno dell’unità della Fraternità Secolare locale. Tra gli effetti dell’Eucaristia la Regola ne rileva due: in primo luogo, i membri rendono presente la morte e la risurrezione del Signore e poi stabiliscono un vincolo d’amore che li unisce non solo tra di loro ma anche con il mondo intero.

ARTICOLO 28

L’ articolo riprende il tema della preghiera liturgica.

Art. 28. I fratelli e le sorelle prenderanno parte attiva alla celebrazione eucaristica e preferiranno, ove possibile, quella della comunità locale dei Servi. Cercheranno anche di partecipare spesso alla celebrazione liturgica delle Lodi e dei Vespri.

Dalla lettura di questo articolo emergono almeno tre pensieri distinti e indipendenti, presentati qui come guida per il Servo Secolare. I primi due sono in rapporto con la Messa e il terzo con la Liturgia delle Ore.

1. Sebbene possa sembrare non necessario affermare un principio valido per tutti i fedeli, forse la prima frase di questo articolo è stata aggiunta in particolare per ricordare ai membri dell’ Ordine Secolare, che non possono partecipare alla Messa come osservatori passivi. La Costituzione sulla Liturgia Sacra stabilisce che è un dovere dei pastori di anime “vigilare che i fedeli vi prendano parte consapevolmente, attivamente e fruttuosamente” (n. 11). Qui sono inclusi i vari tipi di ministero in relazione alla Messa, come per esempio il ministero della musica, i lettori, il ministro della comunione, l’antifonario. I Servi Secolari però non solo assumeranno un servizio conforme ai loro talenti, ma dovranno essere attenti allo svolgimento dell’azione sacra, ed entrarvi pienamente per ricavarne frutti abbondantissimi.

2. La seconda parte dell’articolo — i Servi Secolari partecipano alla Messa locale della Comunità religiosa — presume che la Fraternità Secolare si trovi in prossimità di una Comunità di frati o di religiose Servi/e di Maria. Questo sarebbe l’ideale, ma ci sono varie ragioni che rendono difficile per la maggior parte mettere in atto tale punto. Prima di tutto ci sono Fraternità Secolari che non si trovano vicino alle Comunità religiose, e perciò partecipare alla preghiera della Comunità è impossibile. Inoltre l’articolo sembra considerare la Messa conventuale dove tutti i religiosi della Comunità convengono per la celebrazione, ed è la Messa alla quale i Secolari dovrebbero partecipare. Però i sacerdoti della maggior parte delle Comunità che hanno incarichi pastorali dovranno rendersi liberi per le Messe della parrocchia. Inoltre a causa della scarsità di sacerdoti, molti conventi di suore non hanno Messa nella loro cappella (ammesso che abbiano una cappella abbastanza grande per accogliere la gente). È meglio allora vedere il valore che questa parte dell’articolo intende promuovere, e cioè: i Servi di Maria Secolari e religiosi/e devono pregare insieme ogni volta che sia possibile, e talora anche mettersi d’accordo per una celebrazione comune della Messa.

3. Infine, l’articolo suggerisce che i Servi Secolari partecipino alla preghiera di Lodi e Vespri della Comunità. La Regola sembra attribuirvi una minore importanza rispetto alla partecipazione alla Messa della locale Comunità religiosa (Cercheranno anche di partecipare spesso…). La pratica di celebrare Lodi e Vespri nelle chiese parrocchiali sta diventando più comune e, come si vede in articoli di riviste cattoliche, laici, uomini e donne, pregano quotidianamente in numero sempre maggiore la Liturgia delle Ore. Perciò, questo articolo andrebbe interpretato nei due sensi: che i Servi Secolari partecipino alla Liturgia delle Ore quando viene fatta pubblicamente nella loro parrocchia o in una Comunità religiosa; ma essi devono anche essere incoraggiati a pregare la Liturgia delle Ore in forma privata ogni giorno e così unirsi più strettamente ai Religiosi/e Servi/e di Maria e a tutta la Chiesa.

ARTICOLO 29

La Regola passa ora a trattare delle preghiere alla Madonna e
delle preghiere proprie dei Servi.

Art. 29. Seguendo la tradizione dell’ Ordine, la Fraternità Secolare onorerà la Vergine con particolari atti di venerazione: il saluto angelico, la Vigilia della Beata Vergine e la Corona dell’ Addolorata. Celebrerà come feste di famiglia le principali feste mariane dell’Ordine e della Chiesa locale, la memoria della Vergine Addolorata e le memorie e solennità dei nostri fratelli e sorelle santi e beati.

La devozione mariana della Fraternità Secolare è considerata come appartenente alla tradizione dell’ Ordine. Vengono elencate dapprima tre devozioni mariane; poi c’è una lista di cinque tipi di feste che devono essere celebrate. Considereremo i due gruppi separatamente e vedremo come si legano alla tradizione dell’ Ordine.

1. In primo luogo va rilevato che l’Ave Maria, la Vigilia della Beata Vergine e la Corona dell’Addolorata sono qui menzionate semplicemente come esempi di devozioni mariane praticate nell’ Ordine. Vengono nominate perché sono le devozioni mariane servitane più comuni, ma personalmente si potrebbero preferire altre preghiere che qui non sono elencate. Altre forme di devozioni mariane sono la dedicazione del sabato a Nostra Signora, la Desolata del Venerdì Santo, la Novena dell’Addolorata, la Via Matris, la preghiera dell’Angelus, la Salve Regina.

a. Riguardo all’Ave Maria, le più antiche Costituzioni dei Servi che ci sono pervenute, della fine del 1200, prescrivevano che il saluto angelico doveva essere recitato prima di ciascuna “ora” della Liturgia delle Ore e prima di qualsiasi lettura. All’epoca della fondazione dell’Ordine, cioè nel XIII secolo, il “Saluto Angelico” era composto principalmente dalle parole dell’angelo Gabriele: “Ave, Maria, piena di grazia, il Signore è con te”. A questa frase si aggiungeva a volte il saluto di
Elisabetta: “Benedetta tu fra le donne, e benedetto il frutto del tuo seno”. Solo nel 1400 fu aggiunto il nome di “Gesù” per identificare il “frutto del tuo seno”. Si aggiungeva, a volte, una preghiera d’intercessione, ma soltanto verso la fine del 1400 e l’inizio del 1500 la formula “Santa Maria, Madre di Dio…” diventò comune.

Pertanto, prima della recitazione delle Lodi e dei Vespri, o di qualsiasi altra preghiera della Liturgia delle Ore, viene usata la forma più antica e chi presiede inizia: “Ave, Maria, piena di grazia, il Signore è con te”; e l’assemblea risponde: “Benedetta tu fra le donne, e benedetto il frutto del tuo seno, Gesù”. L’Ave Maria è sempre stata una preghiera amata tra i Servi. Le “legende” del beato Gioacchino da Siena e del beato Francesco da Siena raccontano che nella loro giovinezza recitavano con frequenza il Saluto Angelico. La prima Regola dell’Ordine Secolare (1424) prescriveva che, nell’impossibilità di recitare le Ore dell’Ufficio Divino, queste dovevano essere sostituite da un certo numero di Ave Maria e Padre Nostro.

L’Ave Maria deve essere dunque una preghiera comune e amata anche dai Servi Secolari di oggi.

b. Vigilia della Beata Vergine. Questa preghiera segue lo schema dell’Ora dell’Ufficio Divino che si recitava a mezzanotte: ci sono tre salmi seguiti da tre letture e due responsori, e dopo la terza lettura si canta o si recita la Salve Regina. Le più antiche Costituzioni stabilivano che doveva essere celebrata ogni sera.

La forma originale della Vigilia, insieme ad una versione contemporanea che ha la stessa forma (tre salmi, tre letture, due responsori e la Salve Regina) è stata recentemente pubblicata dalla Commissione Liturgica Internazionale a Roma.
L’introduzione a questa recente pubblicazione ci offre una utile informazione di base su questa preghiera mariana. La Vigilia della Beata Vergine non è stata composta dai Servi di Maria né è una preghiera che si trova solo nel nostro Ordine. E stata usata in una forma sostanzialmente uguale da altri Ordini religiosi sorti prima del nostro. Le sue origini possono collocarsi nel contesto della pietà mariana sviluppatasi all’interno degli Ordini religiosi tra l’XI e il XIII secolo, dapprima in Comunità monastiche e poi in quelle dei Mendicanti.

Secondo questa stessa introduzione, la Vigilia è diventata un omaggio a Maria, caratteristico dei Servi.

“Con il volgere dei secoli, la Vigilia de Domina è diventata espressione di preghiera propria dei Servi di Maria, nostro caratteristico ossequio alla Vergine: tale infatti riteniamo la Vigilia per l’epoca remota in cui fu adottata; per l’amore con cui è stata conservata e trasmessa; per i significati che le sono stati attribuiti – preghiera di ringraziamento per l’approvazione dell’Ordine, tessera distintiva della nostra pietà mariana -; per l’alta stima che le hanno professato scrittori nostri, asceti, frati di ogni tempo; perché il nostro è l’unico degli Ordini Mendicanti che costantemente la ricordi e la proponga alla pietà dei frati nei successivi testi costituzionali, fino all’attuale”.

Il Servo di Maria Secolare, pertanto, può ricavare un grande profitto dalla recitazione quotidiana, o almeno settimanale, della Vigilia di Nostra Signora.

c. La Corona dell’Addolorata. La Commissione Liturgica Internazionale ha pubblicato recentemente un libretto sulla Corona dell’Addolorata, dove rileva: “Le origini della Corona dell’Addolorata non si conoscono bene. Sembra che coincidono con lo sviluppo della devozione alla Madre Addolorata all’inizio del secolo XVII”.
In questa pubblicazione la Commissione Liturgica conserva la forma tradizionale della Corona: un Padre Nostro e sette Ave Maria per ciascuno dei sette dolori di Maria. Ma propone anche altri tre schemi celebrativi. Pur mantenendo la struttura base del rosario, essi introducono piccole modifiche che danno varietà alla preghiera della Corona e, quindi, permettono di riflettere su altri aspetti dei dolori di Maria. E un’esperienza arricchente pregare la Corona usando varie forme.

Nel 1997 la stessa Commissione ha pubblicato il libretto della Via Matris Dolorosa.

2. Alcune feste devono essere celebrate come feste di famiglia. Questo significa che devono essere celebrate “sia nella Liturgia che in altri modi fraterni” (cfr. Cost. art. 27). La celebrazione, cioè, deve includere ma non restringersi alla Messa e alla Liturgia delle Ore. Gli “altri modi fraterni” possono comprendere un pasto in comune, un rinfresco, un momento di allegria.

L’articolo 29 elenca le seguenti tipi di feste.

a. Le principali feste dell’Ordine. Poiché le feste della Madonna e quelle dei Servi santi sono elencate separatamente, considereremo qui soltanto quelle feste che non si trovano in nessuna di queste categorie. Ci sono, per esempio, la festa di Sant’Agostino, legislatore dell’Ordine (28 agosto), la dedicazione della Basilica di Monte Senario (22 settembre), festa di tutti i santi e le sante dell’Ordine (16 novembre), e la memoria di tutti i defunti frati, suore, genitori, parenti e amici dell’Ordine (17 novembre).

b. Feste della Madonna: le principali feste di 5. Maria includono l’Immacolata Concezione, la Natività della Vergine, l’Annunciazione, la Purificazione, l’Addolorata e l’Assunzione.

c. Feste mariane locali sarebbero la festa patronale della parrocchia locale, della diocesi o della nazione, per esempio la festa della Beata Vergine della Ghiara a Reggio Emilia o la festa di Nostra Signora di Guadalupe in Messico.

d. Uno speciale ricordo ricevono le celebrazioni in onore dell’ Addolorata: la solennità dell’Addolorata (15 settembre) e la festa di Nostra Signora S. Maria presso la Croce (il quinto venerdì di Quaresima).

e. Infine, le feste dei santi e beati dell’Ordine. Per una breve riflessione su ciascuna di queste feste si possono leggere le note introduttive nella Liturgia propria dell’Ordine.

ARTICOLO 30

L’ articolo 30 è una esortazione per pregare per i membri defunti dell’ Ordine Secolare.

Art. 30. Il Servo di Maria Secolare ricorderà frequentemente i fratelli e le sorelle defunti e per essi implorerà la misericordia del Signore. Nel giorno della morte e della sepoltura di un fratello o di una sorella parteciperà al cordoglio dei familiari ed offrirà la propria preghiera di suffragio.

La prima parte di questo articolo si esprime soltanto in termini generali. Non specifica la frequenza con cui la preghiera deve essere fatta, quali siano le preghiere da recitare, se è diretta all’individuo o alla Fraternità, o se l’oggetto della preghiera siano prima di tutto i membri della propria Fraternità o dello stesso Paese, o per i defunti dell’ Ordine Secolare nel mondo.

E un articolo che i membri dell’Ordine Secolare dovranno specificare più dettagliatamente nei loro Statuti particolari.

Come impegno minimo si può tuttavia dire fin d’ora che i membri defunti della Fraternità locale e quelli delle Fraternità sparse nel mondo devono essere ricordati nella preghiera ad ogni incontro della Fraternità. Quelli che partecipano ogni giorno alla Messa, li ricorderanno o nella preghiera universale o nel “memento” dei defunti nel corso della preghiera eucaristica. Quelli che celebrano la Liturgia delle Ore devono ricordarli nell’invocazione per i defunti alla fine delle intercessioni vespertine.

La seconda parte di questo articolo considera una circostanza non ordinaria: la morte di un membro della locale Fraternità Secolare. In questo caso tutti i membri saranno vicini al dolore dei familiari del defunto e offriranno preghiere appropriate in conformità agli usi locali.

ARTICOLO 31

L’ultimo articolo di questo capitolo sulla preghiera richiama la necessità di periodi più prolungati di preghiera.

Art. 31. Sarà cura della Fraternità Secolare programmare giorni e periodi di raccoglimento, ai quali ogni membro si impegnerà a partecipare.

La crescita della vita spirituale richiede non solo un ritmo quotidiano di preghiera che scandisca il nostro usuale lavoro, la scuola o la routine familiare. C’è anche bisogno di periodi che rompano la routine del tempo e dello spazio, così che per brevi e più intensi periodi possiamo riflettere con calma e tranquillità sul nostro cammino verso Dio. La Regola, perciò, stabilisce saggiamente che è un dovere (non semplicemente un’esortazione) della Fraternità Secolare organizzare giorni di raccoglimento, ritiri di fine settimana e altre opportunità spirituali per diventare più coscienti non solo di Dio nella nostra vita ma anche degli altri. Ordinariamente questi momenti avvengano fuori dall’usuale luogo di incontro della Fraternità. Il Consiglio o una commissione speciale potranno designare il giorno o i giorni meglio rispondenti alle necessità della Fraternità. L’articolo lascia ampio spazio a riguardo del tempo, del luogo, della frequenza e del contenuto.

Come la Fraternità nel suo insieme ha il dovere di organizzare questi ritiri, così ogni membro, deve “impegnarsi a partecipare”. La partecipazione deve considerarsi non come un obbligo da adempiere, bensì come una opportunità per trovare quel mutuo sostegno, di cui si parla all’articolo 10, nella tensione di ciascuno verso la santità.

Due aspetti della preghiera non menzionati in questo capitolo

Per completare questa esposizione sulla preghiera, è necessario considerare due aspetti che non sono contenuti in questi articoli.

1. In primo luogo, ci sono forme di preghiera che non vengono ricordate. Si incoraggiano alcuni tipi di preghiera: la preghiera personale, comunitaria e liturgica, le preghiere devozionali alla Madonna, e le preghiere per i membri defunti OSSM. Questo capitolo non intende dire che solo queste forme di preghiera vadano usate. Tra le forme non menzionate ci sono la preghiera carismatica, la meditazione, la preghiera profonda, per citarne alcune. Le forme di preghiera menzionate sono le più comuni e senza dubbio le più importanti, come la preghiera Liturgica. Ognuno deve cercare quella forma o quelle forme di preghiera di cui ha bisogno nel momento presente, ed esaminare o tentare altre forme, non indicate esplicitamente. Occorre ricordare l’affermazione iniziale di questo capitolo: la preghiera è un dovere essenziale per ogni cristiano. Il nostro modo di pregare, tuttavia, deve essere adattato alle esigenze di ciascuna persona.

2. In secondo luogo, questo capitolo non obbliga i membri a pregare in una forma particolare. C’è qui una differenza rispetto alle precedenti edizioni della Regola. Nella prima edizione (1424), ogni membro era obbligato a recitare tutto l’Ufficio Divino, o, se non erano in grado di leggere, un certo numero di Ave Maria e Padre Nostro per ogni ora dell’Ufficio. La Regola approvata nel 1966 ha prescritto come obbligo una delle seguenti preghiere: l’Ufficio della B. Vergine Maria, l’Ufficio Divino abbreviato, la Vigilia, la Corona dell’Addolorata, dodici Padre Nostro, Ave Maria e Gloria, o l’Ave Maria prima e dopo il lavoro e prima e dopo i pasti.

Poiché nessuna forma particolare di preghiera è obbligatoria per tutti, ciò significa che ogni membro dell’OSSM deve cercare un ritmo di preghiera che corrisponda alle sue attuali necessità e possibilità. Sarebbe bene anche trascriversi questo ritmo di preghiera in modo da servirsene come verifica. Dico “ritmo” perché nella nostra vita di preghiera dobbiamo avere uno schema quotidiano, settimanale, mensile e annuale; oppure possiamo seguire il ritmo dell’anno liturgico: un ritmo per l’Avvento e la Quaresima, per Natale e Pasqua, e per il tempo ordinario. Abbiamo ora l’opportunità di scegliere quelle forme che ci sono più utili. Gli incontri mensili possono anche servire come verifica per vedere se viviamo in conformità ai programmi che noi stessi ci siamo dati. Ci sono molte possibilità ed ogni Fraternità dell’Ordine Secolare deve cercare quella che è migliore per se stessa.

CAPITOLO QUARTO

PENITENZA E CONVERSIONE

Dopo aver trattato l’aspetto comunitario della vita dei membri della Fraternità Secolare (capitolo 2) e la preghiera (capitolo 3), la Regola passa ora a considerare brevemente la dimensione penitenziale nella vita del Servo Secolare. Nell’edizione preconciliare della Regola questo capitolo era intitolato “Digiuno, Penitenza e Mortificazione”. Nella Regola attuale la penitenza è vista in rapporto alla conversione. Sotto questo punto il capitolo si basa sul capitolo 10 delle Costituzioni dei frati, anch’esso intitolato “Penitenza e Conversione”.

ARTICOLO 32

L’articolo 32 pone in rapporto reciproco i tre concetti di penitenza, conversione e comandamento della carità.

Art. 32. Per il Servo di Maria Secolare, impegnato a portare alla perfezione il comandamento della carità, la penitenza costituisce un valore evangelico e un mezzo sicuro di conversione.

Secondo questo articolo, la meta finale del Servo Secolare è portare alla perfezione il comandamento della carità. Questo era già stato affermato nell’ articolo 9: accettando la loro vocazione i Servi di Maria si impegnano nel portare a pienezza il comandamento evangelico dell’amore. Nell’ articolo 22 la preghiera è presentata come fonte di uno speciale impegno nel portare alla perfezione il comandamento dell’amore.

Ora nell’articolo 32 altre due dimensioni della nostra vita intervengono, insieme alla preghiera, per aiutare il Servo Secolare a raggiungere questo obiettivo: la penitenza e la conversione. La penitenza (forse nel senso di pentimento) è vista come guida alla conversione. Il rapporto tra queste due azioni è talora ambiguo. Conversione, nel suo significato più comune come si trova nel Catechismo della Chiesa Cattolica (n. 1432), è opera della grazia di Dio che fa ritornare i nostri cuori a lui. La penitenza è una azione volontaria e normalmente difficile, che assumiamo come espiazione per il peccato o per dirigere i nostri passi a Dio e per allontanarci da tutto ciò che potrebbe distrarci da lui.

Quale viene prima, la penitenza o la conversione? Il Servo Secolare, come si dice nell’articolo 32, ha già esperimentato la prima conversione che culmina nel battesimo. Pertanto questo articolo focalizza soltanto la conversione permanente: ogni giorno siamo chiamati alla conversione. Si potrebbe vedere qui l’esperienza di tanti cristiani durante la Quaresima e la Pasqua: nel periodo quaresimale compiamo atti di penitenza con cui ci rendiamo più coscienti dell’assenza di Dio nella nostra vita, e quindi torniamo a Dio con maggiore fervore nel cammino verso la Pasqua. Il rinnovamento delle nostre promesse battesimali nella veglia pasquale significa una conversione più profonda a Dio. Le azioni penitenziali, perciò, portano verso la conversione della Pasqua.

Ma c’è ancora un altro modo di vedere il rapporto tra penitenza e conversione. Il Catechismo della Chiesa Cattolica (n. 1434), vede negli atti di penitenza un’espressione di conversione. Il Catechismo enuncia le tre forme più comuni di penitenza come si trovano nella Scrittura e nei Padri: digiuno, preghiera e carità. Queste tre forme esprimono la nostra conversione in rapporto a noi, a Dio e agli altri.

Possiamo comunque essere senz’altro d’accordo con l’articolo 32: sia gli atti di penitenza che guidano e derivano dal nostro continuo ritorno a Dio, sia la stessa conversione ci aiuteranno a portare il comandamento dell’amore a perfezione nella nostra vita.

ARTICOLO 33

Mentre l’articolo 32 enuncia l’importanza della penitenza e della conversione nella vita del Servo Secolare, l’articolo 33 identifica il tipo di penitenza che il Servo Secolare deve assumere.

Art. 33. Secondo l’esempio dei nostri Primi Padri e la tradizione dell’ Ordine, la penitenza, per il Servo di Maria Secolare, consiste principalmente nella carità intesa come accettazione reciproca e servizio vicendevole.

La prima penitenza, che il Servo Secolare deve praticare, è l’accettazione reciproca e il servizio vicendevole. Sebbene questo articolo sembri indicare che l’accettazione e il servizio sono rivolti ad altri membri della Famiglia dei Servi, certamente esso intende estendere tale atteggiamento a tutti.

Questa penitenza è particolarmente difficile perché la sua messa in pratica non cade sotto il nostro controllo. Non abbiamo possibilità di controllo sulla personalità della gente con cui veniamo a contatto; non possiamo dire quando situazioni difficili nella loro vita creeranno o accentueranno tensioni che dobbiamo “accettare”; non possiamo accogliere gli altri secondo la nostra convenienza e non secondo il loro bisogno. Non abbiamo un controllo. Se penitenza significa servire le necessità degli altri, non possiamo controllare quali saranno queste necessità o quando ci verrà chiesto di servirli.

Per questa ragione la penitenza così intesa è una caratteristica peculiare del cristiano in genere e del Servo Secolare in particolare.

Sebbene si affermi che essa si basa sull’esempio dei Sette Santi Fondatori e sulla tradizione dell’ Ordine, non conosco studi che dimostrino tale interpretazione della penitenza come facente parte dell’autentica tradizione dell’ Ordine.

ARTICOLO 34

Il principio generale, in forza del quale la penitenza consiste principalmente nell’ accettazione e nel servizio reciproco, viene ulteriormente specificato nell’ articolo 34.

Art. 34. Convinto che la sequela di Cristo richiede orientamento costante alla volontà di Dio, il Servo di Maria Secolare sarà attento ad accogliere, quale segno di grazia e richiamo alla conversione, le molteplici occasioni di vivere la penitenza che la vita presenta ogni giorno. Celebrerà con frequenza il sacramento della riconciliazione. Praticherà le opere di misericordia, la temperanza particolarmente durante i tempi liturgici di Avvento e di Quaresima.

La prima parte di questo articolo applica la pratica della penitenza, presentata dall’articolo 33, al principio enunciato dall’articolo 32: le sfide e le difficoltà che troviamo nella vita quotidiana sono, infatti, opportunità per veri atti di penitenza. Questi atti di penitenza sono grazie (cioè, doni provenienti da Dio, perché a lui ci conducono) e appelli alla conversione (cioè, una chiamata a lasciare da parte quelle cose che ci distraggono da Dio e dal tornare a lui).

Si potrebbe aggiungere che volgendoci più decisamente a Dio, possiamo accettare maggiormente gli altri ed essere pronti ad aiutarli nelle loro necessità. La conversione allora ci riporta anche alla penitenza. In un certo modo, perciò, la penitenza è un mezzo di conversione (come afferma la Regola), ma la conversione può anche essere vissuta come guida alla penitenza.

Questo articolo elenca poi tre applicazioni più specifiche riguardo alla penitenza.

1. I Servi Secolari devono celebrare con frequenza il sacramento della riconciliazione. Può essere particolarmente utile sottolinearlo oggi, quando il sacramento della riconciliazione non è praticato così frequentemente come in passato. Ma dobbiamo anche subito aggiungere che non viene stabilita alcuna scadenza settimanale, mensile, ecc.

2. Essi faranno anche frequentemente opere di misericordia. Il Catechismo della Chiesa Cattolica è molto utile a questo punto perché ci offre una migliore comprensione del termine. “Le opere di misericordia sono le azioni caritatevoli con le quali soccorriamo il nostro prossimo nelle sue necessità corporali e spirituali. Istruire, consigliare, confortare sono opere di misericordia spirituale, come perdonare e sopportare con pazienza. Le opere di misericordia corporale consistono segnatamente nel dare da mangiare a chi ha fame, nell’ospitare i senza tetto, nel vestire il nudo, visitare il malato e il carcerato e nel seppellire i morti. Tra questi il soccorrere i poveri e una delle testimonianze di carità fraterna: e anche un’opera di giustizia per piacere a Dio” (n. 2447).

3. I Servi dell’Ordine Secolare sono esortati a praticare la virtù della temperanza. La parola “virtù” è usata qui in modo generico, come una ferma disposizione a fare il bene, anche se non parliamo spesso della “virtù” della temperanza. Nel nostro caso sembra significare che le pratiche penitenziali (forse qui intese nel senso tradizionale di digiuno e astinenza) vanno attuate entro limiti ragionevoli e che desideri eccessivi o estremi di pratiche penitenziali devono essere moderati.

Infine può essere ricordato che non è del tutto nuova l’idea di considerare penitenza le prove e i problemi che ogni giorno dobbiamo affrontare. E un elemento già presente nell’edizione, della
Regola anteriore al Vaticano II, dove si afferma che i membri dell’ Ordine Secolare “devono essere attenti al fatto che non esiste penitenza più meritevole e gradita a Dio che l’accettare con pazienza le prove della vita quotidiana”. La novità nell’ attuale Regola di Vita è che il digiuno e l’astinenza non vengono prescritte.

L’articolo termina sottolineando che la penitenza, compresa in questo senso, deve praticarsi soprattutto durante l’Avvento e la Quaresima.

CAPITOLO QUINTO

TESTIMONIANZA DI POVERTA

Questo capitolo è composto da due articoli.

Come negli altri capitoli, il primo articolo presenta un principio generale dal quale il secondo articolo ricava norme più specifiche e pratiche. Si può inoltre rilevare come solo la penitenza (capitolo 4) e, nel nostro caso, la povertà siano state stimate così importanti e significative nella spiritualità dell’ Ordine Secolare da meritare una trattazione speciale. Altre virtù ed esercizi di una vita devota sono presupposti, ma non sono l’argomento di un intero capitolo.

ARTICOLO 35

Art. 35. Il Servo di Maria Secolare vuole vivere la beatitudine evangelica: “beati i poveri in spirito perché di essi è il regno dei cieli “, seguendo l’esempio di Maria, serva umile e povera del Signore.

L’affermazione sottolinea che la chiamata del Servo di Maria Secolare, come di qualsiasi altro Servo di Maria, obbedisce a una norma comune a tutti i seguaci di Cristo. E stata annunciata da Gesù nel Discorso della Montagna (Mt 5, 3). Il significato di “poveri in spirito” è stato interpretato in vari modi da quelli che hanno studiato la Scrittura e anche da quelli che hanno meditato le parole di Gesù. Ma i Servi Secolari, nell’applicazione della prima beatitudine alla loro vita, dispongono di un aiuto particolare in quanto tale beatitudine è interpretata alla luce del modo con cui l’ha vissuta santa Maria, una povera e umile serva del Signore. L’ articolo 47 permette un ulteriore approfondimento nella conoscenza della prospettiva in cui la Regola vede la vita di Maria:
ella ha condiviso una vita che è comune a tutti, piena di preoccupazioni familiari e di duro lavoro. In riferimento alla povertà, il rapporto che il Servo Secolare ha con i beni materiali, sarà caratterizzato, prima di tutto, da un modo di vivere che non si distingue – in riferimento ai beni materiali – da quello della gente tra la quale vive, e poi da un duro lavoro. Tale concezione della povertà, seguendo l’esempio di Maria, non è vissuta come fine a se stessa, ma come un mezzo per servire il Signore.

ARTICOLO 36

Il secondo e ultimo articolo di questo capitolo ci dà indicazioni più specifiche sia sulle attuazioni pratiche della povertà nella vita del Servo Secolare, sia sul modo in cui egli ne dà “testimonianza”.

Art. 36. Con l’impegno e la serietà nel lavoro, la semplicità e l’austerità della vita, la sensibilità alle necessità degli altri, il servizio ai più bisognosi, i Servi di Maria Secolari intendono testimoniare il loro amore a Cristo povero sia come singoli sia come Fraternità, ed annunciare all’uomo di oggi, tentato dalla bramosia del denaro, del potere, del piacere, che Dio è l’unico bene necessario, l’Unico che può saziare il cuore dell’uomo.

L’articolo elenca quattro modi di esercitare la povertà: lavoro, semplicità, austerità, e sensibilità alle necessità degli altri. Queste modalità non vanno prese come una lista completa di tutto ciò che un Servo di Maria Secolare deve operare per dare “testimonianza di povertà”. Viene inoltre evidenziato il tipo d’azioni pratiche che produrranno una “testimonianza di povertà”. Il lavoro coscienzioso, che noi svolgiamo, ci mette in mezzo alla gente comune che lavora per vivere. Esso crea un legame con la gente. Semplicità e austerità mostrano agli altri che non abbiamo bisogno di tante cose materiali per godere appieno della vita, e vanno considerate in relazione all’ultimo esempio dato: la sensibilità alle necessità degli altri. La semplicità di vita non deve essere cercata per se stessa; essa invece ci rende coscienti dei bisogni degli altri e suscita il desiderio di condividere i nostri beni materiali. Quelli che si preoccupano troppo del loro stile di vita non hanno né la disponibilità né il tempo di essere disturbati dagli altri e meno ancora di condividere con loro i beni che hanno accumulato.

La “testimonianza di povertà” viene spiegata allora come un mezzo per dimostrare a chi è tentato dalla ricchezza, dal potere e dal piacere, che solo Dio è necessario. I Servi dell’Ordine Secolare, perciò, devono, per un duplice motivo, vigilare attentamente sulla loro vita: prima, per vedere come respingere la tentazione della ricchezza, del potere e del piacere nella loro vita, e poi per chiedersi se la loro vita mostra chiaramente agli altri che Dio costituisce il centro dei loro desideri.

CAPITOLO SESTO

APOSTOLATO

I capitoli precedenti guidano i Servi Secolari nella loro vita personale e nei loro rapporti reciproci. Ma nessuna vocazione autenticamente cristiana si ferma o si esaurisce all’interno di se stessa; è necessario spingere lo sguardo anche verso gli altri. Prima di esaminare gli articoli di questo capitolo, sono utili alcune considerazioni per vedere come i consigli riguardanti i Servi Secolari derivano dall’insegnamento comune della Chiesa. Le raccomandazioni più specifiche per i Servi Secolari provengono dagli insegnamenti della Chiesa contenuti nel Concilio Vaticano II e in alcuni documenti pontifici posteriori a questa data.

Prima di tutto è bene chiarire due termini che possono essere intercambiabili: apostolato e missione. Entrambi significano “mandare fuori”. “Apostolato” deriva dal greco e “missione” dal latino. La stessa cosa avviene per i termini indicanti la persona inviata: apostolo (dal greco) e missionario (dal latino) hanno lo stesso significato. Tuttavia, nella pratica, noi tendiamo a preferire il termine “apostolato” per indicare l’essere inviato negli immediati dintorni, e “missione” per indicare l’invio in luoghi distanti, specialmente in un paese estero.

Il Concilio Vaticano II offre il contesto nel quale situare gli articoli di questo sesto capitolo. Nel documento sulla Chiesa (Lumen Gentium, 31 e 33) il Concilio dice così.

“L’ indole secolare è propria e peculiare dei laici… Per loro vocazione è proprio dei laici , cercare il regno di Dio trattando le cose temporali e ordinandole secondo Dio. Vivono nel secolo, cioè implicati in tutti e singoli i doveri e affari del mondo e nelle ordinarie condizioni della vita familiare e sociale, di cui la loro esistenza è come intessuta. Ivi sono da Dio chiamati a contribuire, quasi dall’interno a modo di fermento, alla santificazione del mondo mediante l’esercizio del proprio ufficio e sotto la guida dello spirito evangelico, e in questo modo, a manifestare Cristo agli altri, principalmente con la testimonianza della loro stessa vita, e col fulgore della loro fede, della loro speranza e carità. A loro quindi particolarmente spetta di illuminare e ordinare tutte le cose temporali, alle quali sono strettamente legati, in modo che sempre siano fatte secondo Cristo, e crescano e siano di lode al Creatore e Redentore (n. 31).

L’apostolato dei laici è quindi partecipazione alla stessa missione salvifica della Chiesa, e a questo apostolato sono tutti destinati dal Signore stesso per mezzo del battesimo e della confermazione… Ma i laici sono soprattutto chiamati a rendere presente e operosa la Chiesa in quei luoghi e in quelle circostanze, in cui essa non può diventare sale della terra se non per loro mezzo…. Oltre a questa forma di apostolato, che spetta a tutti i fedeli indistintamente, i laici possono anche essere chiamati in diversi modi a collaborare più immediatamente con l’apostolato della Gerarchia (n. 33)”.

Nel periodo anteriore al Vaticano II, l’Azione Cattolica, come era normalmente chiamato l’apostolato dei laici, veniva definita quale partecipazione dei laici all’apostolato della Gerarchia. Cioè, il vero apostolato era quello della struttura gerarchica della Chiesa (vescovi e sacerdoti) e il laicato era soltanto collaboratore del loro apostolato. Ma il Vaticano II ha messo in chiaro che tutti i membri battezzati della Chiesa sono chiamati a “contribuire con tutte le loro forze all’incremento della chiesa e alla sua ininterrotta santificazione” (n. 33). Il ruolo specifico del laico, tuttavia, consiste nel rendere la Chiesa presente in tutti i posti dove solo loro hanno accesso. Secondariamente i laici possono anche essere chiamati a collaborare con l’apostolato della Gerarchia. Così i chierici (vescovi, sacerdoti, diaconi) e i laici hanno il loro apostolato specifico conformemente alla natura propria dello stato clericale o laicale. Ma questo non esclude l’aiuto scambievole che ciascuno può e deve dare all’altro.

In pratica questo significa che il ruolo proprio dell’Ordine Secolare, precisamente in quanto secolare, è nel mondo: nella famiglia, nel mondo degli affari, nei campi della tecnica, in problemi di ecologia, scienza, educazione e via di seguito. Solo secondariamente l’Ordine Secolare in quanto tale può essere coinvolto direttamente nel promuovere le dimensioni più “religiose” della parrocchia, della diocesi o della Famiglia religiosa.

Gruppi dell’Ordine Secolare potrebbero studiare insieme con profitto il capitolo IV sui Laici nella Costituzione Dogmatica sulla Chiesa (Lumen Gentium); il Decreto sull’Apostolato dei Laici (Apostolicam Actuositatem). La Regola di Vita suggerisce altre fonti che possono essere utilmente lette e discusse: il Catechismo della Chiesa Cattolica, 1994, specialmente i numeri 863-864, e 898-903; l’Esortazione Apostolica sulla Famiglia (Familiaris Consortio) di Giovanni Paolo II, 1981; Lettera alle famiglie di Giovanni Paolo II, 1994; Lettera del Papa ai Bambini nell’anno della Famiglia, 1994; e la Carta dei Diritti della Famiglia, 1983; l’Esortazione Apostolica Christifideles Laici, 1989; l’enciclica Dives in misericordia, 1980.

ARTICOLO 37

Nel corso dell’analisi dei sette articoli del capitolo 6, vedremo che molto è stato preso direttamente dai documenti recenti del Vaticano II e dagli scritti di Giovanni Paolo II.

Art. 37. Fedeli alla loro vocazione di servizio i Servi di Maria Secolari desiderano irradiare nel mondo l’amore di Cristo e offrire agli uomini una testimonianza di vita e di dedizione ai fratelli, sull’esempio di Maria.

Il fondamento di questo articolo è la “vocazione di servizio”. Questo è l’unico esempio, nella Regola di Vita, in cui il termine “vocazione” e usato in questo senso. Negli articoli 8 e 9 la vocazione del Servo Secolare è una più generica chiamata al tipo di vita proprio dell’ Ordine Secolare. Ma abbiamo visto, mentre parlavamo di questi articoli, che la parola “vocazione” viene usata anche in sensi più specifici, come ad esempio la vocazione di un insegnante. La vocazione di servizio sgorga non solo dalla generale vocazione battesimale, ma per un Servo, dedicato al servizio di Maria, nasce anche dal “servizio” che acquista un’importanza particolare. Che il nostro “servizio” sia parte della vocazione come Servo significa che, come qualsiasi altra vocazione, è parte di quello che noi siamo, non qualcosa che può essere accettato o rifiutato a nostro piacimento. Nell’articolo 33 abbiamo visto che la penitenza è intesa come accettazione e servizio reciproco. Questo servizio è parte della nostra vocazione e pertanto non può essere negata agli altri senza smentire parte di quello che diciamo di essere.

La vocazione di servizio si attua diffondendo l’amore di Cristo nel mondo intorno a noi. Non c’è bisogno di cercare terre lontane e circostanze uniche per irradiare l’amore di Cristo. Il vicino della porta accanto che si trova in necessità, il malato in strada, le persone sole della Fraternità, sono tutte opportunità quotidiane per diffondere l’amore di Cristo. Esistono anche momenti di crisi nella vita delle persone, in cui hanno c’è bisogno che l’amore di Cristo sia reale e presente attraverso l’amore di uno dei suoi seguaci. L’amore di Cristo in noi, se è reale, è sempre attivo, mai passivo. In secondo luogo, la vocazione di servizio stimolerà il Servo Secolare ad essere testimone del dono di sé agli altri. È più facile predicare il dono di sé che attuarlo. Ma è soltanto dimostrandolo nella nostra vita quotidiana che portiamo a compimento la nostra vocazione di servizio. Questo articolo ricorda specificatamente l’esempio di Maria. Maria ha chiamato se stessa “serva del Signore”, e ha dimostrato che cosa questo significasse nella sua vita, quando ha accettato la missione singolare offertale dall’ angelo; come serva degli altri, piuttosto che parlarne di questo, lo ha dimostrato nell’ affrettarsi a visitare la sua parente Elisabetta in attesa di un figlio e nell’interessarsi della coppia di sposi di Cana che non avevano vino.

ARTICOLO 38

Questo articolo si concentra su una forma particolare di apostolato: la famiglia.

Art. 38. Coscienti che la famiglia è il fondamento della società civile, i Servi di Maria Secolari privilegeranno l’apostolato e la testimonianza della famiglia cristiana. All’interno della comunità familiare, “chiesa domestica”, il mutuo amore e il rispetto dei genitori assieme alla cura e all’educazione dei figli riceveranno particolare cura da parte della Fraternità nella preghiera e nell’impegno.

Il primo tipo specifico di apostolato menzionato nella Regola è quello della famiglia. La ragione di questa scelta è affermata con parole semplici: la famiglia è la cellula fondamentale della società, o come dice il Catechismo della Chiesa Cattolica, la famiglia è la cellula originaria della vita sociale (n. 2207). L’esatta differenza tra società civile e laica, come si esprime l’articolo, non è tanto chiara, ma il senso generale è sicuramente quello di sottolineare la qualità “laica” della vita familiare. Si ricorda anche che la famiglia costituisce la chiesa domestica, la più piccola unità della Chiesa. A motivo della fondamentale importanza della famiglia come unità basilare della società civile e religiosa insieme, possiamo capire perché tanto rilievo sia stato dato alla famiglia negli ultimi anni, e perché anche la Regola di Vita la menzioni come il primo apostolato.

Nei documenti recenti della Chiesa che trattano di famiglia o di matrimonio, ci sono sempre due aspetti strettamente collegati: il mutuo amore tra marito e moglie, e la procreazione e l’educazione dei figli. Il Catechismo della Chiesa Cattolica afferma: la famiglia “è la società naturale dove marito e moglie sono chiamati a donarsi mutuamente nell’ amore e nel dono della vita” (n. 2207). L’articolo 38 richiama questi due aspetti complementari della famiglia: scambievole amore e rispetto dei genitori, e la cura e l’educazione cristiana dei figli.

L’articolo non offre specifiche indicazioni circa il tipo di apostolato familiare che i membri dell’Ordine Secolare dovrebbero promuovere. Il decreto conciliare sull’ apostolato dei laici, tuttavia, offre alcuni suggerimenti concreti sul tipo di azione che può essere incluso sotto il titolo generico di apostolato familiare.

“Fra le svariate opere dell’apostolato familiare, ci sia concesso enumerare le seguenti: adottare come figli i bambini abbandonati, accogliere con benevolenza i forestieri, dare il proprio contributo nella direzione delle scuole, assistere gli adolescenti con il consiglio e con mezzi economici, aiutare i fidanzati affinché si preparino meglio al matrimonio, collaborare alla catechesi, sostenere i coniugi e le famiglie materialmente e moralmente in pericolo, provvedere ai vecchi non solo il necessario ma anche renderli partecipi equamente dei frutti del progresso economico” (n. 11).

In questo modo il Vaticano II chiarifica i tipi di interventi più urgentemente necessari al momento presente. Dà un ampio raggio di possibilità e queste ne possono ispirare altre basate su attuali necessità locali. Noterete anche che questi sono perlopiù lavori “laici”, non “religiosi”, legati a una chiesa locale o a una parrocchia locale. Alcuni di essi, però, possono essere sostenuti anche dalla parrocchia o dalla diocesi, come per esempio la preparazione di coppie di fidanzati al matrimonio.

La frase conclusiva del numero 11 dello stesso decreto dovrebbe suscitare in tutti i Servi dell’Ordine Secolare una riflessione attenta: “affinché possano raggiungere più facilmente la finalità del loro apostolato, può essere opportuno che le famiglie si uniscano in qualche associazione”. Per raggiungere dunque alcuni di questi obiettivi, l’identità di gruppo e l’appoggio trovato all’interno dell’ Ordine Secolare dovrebbero essere un aiuto più grande di quello che i membri potrebbero trovare se lavorassero da soli.

Di fronte alle urgenti necessità elencate dal Vaticano II, questo articolo si chiude, mi sembra, in forma piuttosto riduttiva, non andando oltre l’affermazione che l’apostolato familiare dovrebbe limitarsi alla preghiera e all’incoraggiamento. La speranza è, al contrario, che la preghiera e l’incoraggiamento abbiano come risultato positivi programmi e attività.

ARTICOLO 39

Se l’articolo 38 ha spinto i Servi dell’Ordine Secolare a considerare attentamente un particolare tipo di apostolato, l’articolo 39 colloca questo e tutti gli altri tipi di apostolato in un contesto più ampio.

Art. 39. Inseriti nella Chiesa e nel mondo, i Servi di Maria Secolari ne condividono le ansie e le aspirazioni e, spinti dall’amore di Dio, si impegnano a collaborare alla costruzione di un mondo nuovo alla luce dei valori evangelici.

Notiamo per prima cosa che non si tratta di una questione relativa ai Servi dell’Ordine Secolare come tali, ma come membri della Chiesa e del mondo. Vale a dire, questo articolo non è specifico dei Servi Secolari ma è ugualmente applicabile a tutti i “membri della Chiesa e del mondo”. “Mondo” è frequentemente usato nella Scrittura per indicare quella parte della creazione che è in contrasto con Dio, in opposizione a Dio. Per esempio, nel Vangelo di Giovanni (17, 14) Gesù dice: “io ho dato a loro la tua parola e il mondo li ha odiati perché essi non sono del mondo, come io non sono del mondo”. Ma “mondo” è anche usato per indicare l’intera creazione, l’universo, e tutta la creazione di Dio è buona. In questo articolo “mondo” tende a questo secondo significato.

Il motivo che spinge ad agire non è un ideale altruistico o la pietà verso la sofferenza di tanta parte dell’umanità: la motivazione più profonda, che sta alla base dell’azione apostolica del Servo di Maria, è l’amore di Dio che agisce dentro di lui o di lei.

Il lavoro di costruzione di un mondo nuovo non è responsabilità dei soli Servi Secolari, ma essi cooperano con altri in questo grande compito. Il tipo di mondo nuovo viene dunque specificato:
è un mondo costruito alla luce dei valori evangelici. Questo comporta che i Servi Secolari non solo abbiano studiato il Vangelo in modo da essere capaci di ricavare dalla parola scritta i valori che la rendono viva, ma che essi abbiano reso questi valori parte della propria vita. Il lavoro di edificazione di un mondo nuovo non è un esercizio intellettuale ma si sviluppa dall’esperienza quotidianamente vissuta da ciascun Servo.

Il “mondo nuovo” che vogliamo costruire attorno a noi si riflette nelle parole di San Paolo: con il battesimo noi siamo una nuova creazione e perciò è già emerso il mondo nuovo. “Quindi se uno è in Cristo, è una creatura nuova; le cose vecchie sono passate, ecco, ne sono nate di nuove”. Lo stesso pensiero è espresso nel motto di papa san Pio X: “rinnovare tutte le cose in Cristo”. E’ anche parte della visione del libro dell’Apocalisse, nel quale l’autore ha visto “un nuovo cielo e una nuova terra. Il cielo di prima e la terra di prima sono passati … E colui che sedeva sul trono disse: ecco, io faccio nuove tutte le cose” (Ap 21,1.5). Il nostro lavoro nella costruzione di un mondo nuovo è perciò quello che comincia dentro di noi ma che avrà la sua pienezza soltanto alla fine dei tempi. Noi siamo parte di questo grande lavoro.

ARTICOLO 40

I Servi dell’Ordine Secolare devono vedere la loro attività davvero come parte di questo grande progetto di cui parla l’articolo 39. Ma è la vita quotidiana, caratterizzata per lo più da routine e da azioni ordinarie, quella che in realtà trasforma il mondo in una nuova creazione in Cristo. L’articolo 40 considera queste azioni quotidiane.

Art. 40. Costantemente i Servi di Maria Secolari vogliono vivere secondo lo Spirito: nella preghiera, nelle iniziative apostoliche, nella vita coniugale e familiare, nel lavoro quotidiano, nel tempo libero. Tutti questi momenti siano trasformati in sacrificio spirituale gradito a Dio per Cristo Gesù.

Questo articolo è praticamente una citazione tratta dal Concilio Vaticano II (Lumen Gentium, n. 34), citazione ripresa da papa Giovanni Paolo II nella sua Enciclica Christifideles Laici (n. 14). A loro volta questi testi si sono ispirati alla Prima Lettera di Pietro (2, 5): “anche voi venite impiegati come pietre vive per la costruzione di un edificio spirituale, per un sacerdozio santo, per offrire sacrifici spirituali graditi a Dio, per mezzo di Gesù Cristo”.

Sia il documento conciliare che l’enciclica collocano questa riflessione nel contesto della partecipazione dei laici “alla missione sacerdotale per la quale Gesù ha offerto se stesso sulla croce e continua ad essere offerto nella celebrazione dell’Eucaristia a gloria di Dio e per la salvezza dell’umanità”. Tutte le attività della giornata, perciò, sono viste in unione con l’offerta di Gesù sulla croce e nell’Eucaristia. Tre aspetti chiave della vita sono inclusi particolarmente in questa offerta: quello spirituale, costituito dalla preghiera e dal lavoro apostolico; quello familiare, costituito dalla vita matrimoniale per le coppie sposate e dalla vita familiare per esse e per tutti gli altri; e infine il lavoro di ogni giorno insieme ai necessari momenti di distensione. Anche se ogni azione quotidiana non si adatta esattamente all’una o all’altra di queste categorie, certamente il senso è che, in forza della nostra partecipazione alla missione sacerdotale di Gesù, la nostra intera vita quotidiana, anche le parti che appaiono meno significative, acquista nuovo significato ed importanza perché è offerta come un sacrificio spirituale a Dio per mezzo di Gesù Cristo. Nessuna azione, per quanto insignificante, è senza valore se offerta a Dio.

ARTICOLO 41

L’ articolo precedente ha considerato le attività personali quotidiane dei Servi dell’Ordine Secolare. L’articolo 41 ci introduce nella relazione tra queste attività personali e la Chiesa locale.

Art. 41. 1 Servi di Maria Secolari, parte viva di una Fraternità, collaboreranno agli impegni apostolici assunti assieme come risposta alle necessità dell’ambiente e della Chiesa locale. Secondo le proprie possibilità e capacità, si sforzeranno di prendere parte attiva a particolari impegni di servizio pastorale della comunità religiosa o della parrocchia.

Come l’articolo precedente, l’articolo 41 è ricavato da dichiarazioni ufficiali della Chiesa: l’insegnamento del Concilio Vaticano II (Decreto sull’apostolato dei Laici, Apostolicam Actuositatem, n. 10) che a sua volta è stato citato da Giovanni Paolo II nella sua Enciclica Christifideles Laici (n. 33). Sono state aggiunte però tre speciali sfumature che meritano attenzione.

In primo luogo, il tipo di lavoro apostolico qui menzionato è quello assunto dal Gruppo, non riguarda invece le iniziative individuali di ciascun membro. Questa è l’unica menzione di attività di gruppo, e la Regola di Vita né la raccomanda né la presenta come un grado più alto dell’azione apostolica individuale. Viene soltanto abilmente suggerito che la Fraternità dell’ Ordine Secolare può discutere se vuole o no impegnarsi in un’azione apostolica come Fraternità. In tal caso ogni membro darà il suo contributo nel realizzare questa decisione con lealtà e prontezza.

Una seconda sfumatura è stata aggiunta alle citazioni del Concilio e dell’Enciclica. La Regola di Vita parla della risposta del Gruppo alle necessità dell’ambiente e della Chiesa locale. Il contesto della citazione conciliare fa riferimento qui soltanto alla Chiesa locale (quantunque i nn. 9 e 13 dell’Apostolicam Actuositatem parlino di un interesse più ampio dei laici). Così, la Regola di Vita allarga l’orizzonte di attività per includere non soltanto la chiesa in relazione alle attività, ma anche quelle necessità sociali, economiche e culturali di tutta la gente della zona e le istituzioni, centri cittadini e di altro tipo che sono stati costituiti per promuovere queste attività.

La terza sfumatura, infine, è questa: mentre il Concilio fa riferimento ad una collaborazione con impegni apostolici e missionari sostenuti dalla parrocchia locale, la Regola di Vita aggiunge quelle attività sostenute dalla Comunità religiosa locale. In questo modo rende “servitano” il documento conciliare, ricordando ai Servi dell’ Ordine Secolare che la loro collaborazione deve essere rivolta anche alla Comunità servitana locale, se c’è. Il Concilio illustra il tipo di collaborazione che ha in mente, dando alcuni esempi.

“[I laici possono] condurre alla Chiesa gli uomini che forse ne vivono lontani; cooperano con dedizione generosa nel comunicare la parola di Dio, specialmente mediante l’insegnamento del catechismo; mettendo a disposizione la loro competenza rendono più efficace la cura delle anime ed anche l’amministrazione dei beni della Chiesa” (Apostolicam Actuositatem, 10).

Il Concilio identifica, così, nell’instaurazione dell’ordine temporale il compito principale dell’apostolato dei laici, affermando: “ai laici tocca assumere l’instaurazione dell’ordine temporale come compito proprio” (Apostolicam Actuositatem, 7). Tuttavia, non limita questo compito all’ ordine temporale, ma invita anche alla collaborazione nelle attività della parrocchia. I Servi Secolari trovano spazio nei compiti religiosi di una parrocchia o della locale Comunità servitana, ma devono sempre tenere presente che il loro impegno primario è quello di rinnovare l’ordine temporale.

ARTICOLO 42

Gli articoli precedenti sull’ apostolato dei laici nella Chiesa, basati come sono sull’insegnamento del Concilio Vaticano II, possono facilmente applicarsi a qualsiasi laico, donna o uomo. L’articolo 42 ora unisce l’apostolato a un interesse e una prospettiva più specificatamente servitana.

Art. 42. Attraverso la devozione alla Vergine Addolorata il Servo di Maria Secolare acquista un singolare interesse per il servizio agli infermi, agli anziani, ai fratelli bisognosi sia dal punto di vista fisico che spirituale e morale. In questo impegno di servizio la figura di Maria ai piedi della Croce sarà la loro immagine conduttrice. Poiché il Figlio dell’uomo è ancora crocifisso nei suoi fratelli, il Servo di Maria Secolare sarà presente con Maria ai piedi delle infinite croci.

L’articolo 13 aveva già presentato Maria come immagine conduttrice nella vita dei Servi Secolari, rilevando che essi la onorano specialmente come la Vergine dei Dolori. La seconda parte di questo articolo, basata sull’epilogo delle Costituzioni dei frati (art. 319), trasforma l’onore dato a Maria come Addolorata da una semplice memoria delle sofferenze passate del suo Figlio alla sofferenza presente e assai concreta di Gesù nei suoi fratelli e sorelle. Non è sufficiente richiamare il dolore di Maria sul Calvario, se non si vuole essere con lei ai piedi delle infinite croci su cui Gesù è ancora oggi crocifisso. La memoria del dolore di Maria ci porta alla realtà attuale della sofferenza che oggi è sopportata da tanti innocenti. Possiamo pretendere di essere devoti di Maria e trascurare i suoi figli che sono nel dolore?

Per questo l’articolo sottolinea che i Servi dell’Ordine Secolare devono avere un interesse speciale per quelli che si trovano in particolare necessità, sia fisica, che spirituale o morale. Ci sono molti tipi di sofferenza oggi, e questo articolo non vuole limitare l’attenzione e l’azione del Servo Secolare ad un tipo particolare, giacché tutti sono figli di Dio e Gesù soffre in ognuno di loro.

I singoli Servi o forse le Fraternità possono applicare l’articolo alle necessità più pressanti della gente della propria area.

Tocca ancora alla responsabilità dell’individuo o della Fraternità considerare le necessità sociali, economiche e culturali della gente più vicina, e valutare concretamente ciò che è nelle capacità degli individui e della Fraternità di operare. Deve infine essere intrapresa un’azione.
Questo articolo ci ricorda che, fino a quando non concretizziamo un’azione a favore del povero, del malato e di quelli che si trovano in gravi necessità, non possiamo parlare di vera devozione a Maria ai piedi della Croce.

ARTICOLO 43

L’articolo conclusivo sulle attività apostoliche è preso anch’esso direttamente dal decreto del Vaticano II, come citato da Giovanni Paolo II.

Art. 43. L’impegno vocazionale e apostolico e in particolare quello missionario dell’ Ordine troveranno nella Fraternità Secolare appoggio e compartecipazione.

Questo articolo bilancia i pensieri precedenti sull’azione apostolica. Pur insistendo sul fatto che “ai laici tocca assumere l’instaurazione dell’ordine temporale come compito proprio” (Apostolicam Actuositatem, 7), il Concilio non esclude che i laici partecipino anche attivamente alla vita della propria parrocchia o, come in questo caso, alla vita della propria Famiglia religiosa.

I tipi di collaborazione suggeriti sono probabilmente quelli più comuni e dove l’aiuto dei laici può essere significativo: le vocazioni e le missioni. Si riconosce genericamente che una delle motivazioni più determinanti, se non la più determinante per una risposta individuale alla chiamata di Dio, sia l’educazione e la vita in famiglia. Se la vita familiare è promossa come indicato dall’articolo 38, si crea un ambiente nel quale una chiamata di Dio può essere ascoltata e l’individuo avrà la fede e la forza per rispondere in forma affermativa. Si devono incoraggiare anche altri tipi di collaborazione nei programmi vocazionali.

Tutta la Chiesa è missionaria, e così i Servi dell’Ordine Secolare, come individui e come Fraternità, devono sentirsi pienamente coinvolti nella proclamazione del Vangelo in quelle aree (vicine e lontane) dove il messaggio di Gesù non è stato ancora ascoltato o non è stato ascoltato in forma efficace. Questo deve essere anche un incentivo per i membri dell’Ordine Secolare nel venire a maggiore conoscenza delle attività missionarie dei frati e delle varie Congregazioni di suore; sulla vita delle monache in Messico e Mozambico, e sui membri dell’Istituto Secolare.

La rivista Le Missioni dei Servi di Maria può essere un ottimo mezzo per informarsi sulle attività missionarie.
CAPITOLO SETTIMO

FORMAZIONE

La formazione è un processo guidato che favorisce l’apprendimento, l’accettazione, l’assimilazione e l’integrazione nella vita di quei principi, valori, abitudini e azioni che caratterizzano il Servo di Maria Secolare.

Essa “trasforma” l’individuo in un Servo di Maria.

Il capitolo 7 tratta di questo processo solo in termini molto generali. Norme più specifiche si trovano nell’articolo 53 sul periodo di Prova o Noviziato.

ARTICOLO 44

Il primo articolo di questo capitolo dà il contesto generale in cui si colloca il processo di formazione.

Art. 44. La vocazione del Servo di Maria Secolare si alimenta in seno alla Fraternità e nella comunione con la Famiglia dei Servi. Pertanto lo studio dei documenti ufficiali della Chiesa e dell’Ordine costituirà uno strumento per la loro formazione permanente.

La persona non subisce nel vuoto i cambiamenti dei valori e dello stile di vita richiesti per diventare un Servo di Maria Secolare. Questo processo avviene dentro la Fraternità Secolare, dove l’individuo vede in concreto che cosa sono i Servi Secolari, come è il loro reciproco rapporto, come hanno reso operativi nella propria esistenza i principi generali della Regola di Vita, quali difficoltà ci siano. Detto semplicemente, l’individuo vede un modello verso il quale è attratto e secondo il quale gli piacerebbe cambiare.

Ma l’integrazione della persona nella Fraternità dell’Ordine Secolare avviene anche in comunione con l’intera Famiglia Servitana. L’Ordine Secolare, come un qualsiasi altro componente della Famiglia Servitana, non è fine a sé stesso. Piuttosto, i suoi valori e la sua vita sono nutriti e rafforzati tramite l’interazione con le altre parti della Famiglia Servitana. Pertanto, l’individuo che vuole diventare un Servo di Maria Secolare non può ignorare le altre espressioni della vocazione servitana, ma al contrario deve imparare da esse.

La seconda frase di questo articolo ricorda che il processo di formazione, pur avvenendo soprattutto durante il periodo di Prova o Noviziato, è di fatto un processo che continua per tutta la vita. Questo è vero in qualsiasi settore della vita. Un medico, un avvocato, un tecnico, un meccanico, un insegnante, ecc., non possono restare al livello delle conoscenze e delle tecniche apprese nel primo stadio della loro formazione professionale. Devono aggiornarsi con gli ultimi metodi e tecniche.

Anche i Servi dell’Ordine Secolare devono essere desiderosi di continuare la loro formazione per la vita intera.

Questo articolo presuppone che i Servi Secolari siano interessati a continuare la formazione, e suggerisce che questa possa essere promossa con l’approfondimento della conoscenza dei documenti ufficiali della Chiesa e dell’ Ordine. L’intendimento non è quello di offrire una lista esaustiva; la conoscenza dei documenti ufficiali della Chiesa e dell’Ordine è piuttosto un punto di partenza. La formazione permanente può e deve includere diverse metodologie e tematiche; ad esempio, corsi, conferenze, lettura privata e studio di argomenti della Regola di Vita ritenuti importanti per la vita del Servo Secolare. Si potrebbe rileggere l’articolo 17 che ci dà una lista utile ditali argomenti; la Regola di Vita stessa, temi di argomento umano, sociale, religioso, e questioni relative alla vita dei Servi.

ARTICOLO 45

L’articolo precedente aveva rilevato che il processo di formazione avviene dentro la Fraternità Secolare e in comunione con la Famiglia Servitana. L’articolo 45 specifica adesso in forma più chiara quale sia il loro ruolo.

Art. 45. La Fraternità Secolare offre ad ogni fratello e ad ogni sorella l’esperienza della comunione di vita e l’aiuto costante. La comunità intera della Famiglia dei Servi offre le ricchezze della Chiesa e dell’Ordine.

Queste sono affermazioni molto generali e sono chiare in se stesse. La Fraternità Secolare offre l’esperienza vissuta e l’aiuto personale di ciascuno a ciascuno, di tutti a tutti. Si riafferma in un contesto diverso la sostanza dell’articolo 10: i membri dell’Ordine Secolare si sostengono a vicenda nella vita matrimoniale, familiare, sociale e nell’impegno attivo nel mondo.

La più grande Famiglia dei Servi dà ai membri dell’Ordine Secolare la ricca tradizione della Chiesa e dell’ Ordine. Le Costituzioni dei frati sono a questo riguardo più esplicite, affermando che il Priore Generale, i Priori Provinciali e i Priori Locali devono incoraggiare frati qualificati e volenterosi a promuovere tra i Gruppi religiosi e laici della Famiglia Servitana “un’adeguata conoscenza della storia e della spiritualità Servitana, e soprattutto, della dottrina sulla Vergine nel mistero di Cristo e della Chiesa” (art. 311).

ARTICOLO 46

L’articolo 45 ha parlato delle responsabilità della Fraternità Secolare e di tutta la Famiglia dei Servi nella formazione permanente di ogni membro dell’Ordine Secolare. L’articolo 46 considera adesso le responsabilità dei membri a questo riguardo.

Art. 46. Il Servo di Maria Secolare è cosciente che lo sviluppo e la maturazione della vocazione richiedono l’impegno personale e la valorizzazione delle proprie ricchezze in rapporto a Dio e agli uomini.

L’esperienza di comunione di vita e di sostegno offerto dalla Fraternità Secolare, e le ricchezze della tradizione della Chiesa e dell’ Ordine offerte dall’ intera Famiglia Servitana ad ogni membro dell’ Ordine Secolare, restano inefficaci fino a che non vengono assunte e utilizzate dal Servo di Maria Secolare. Questo impegno personale da parte del Servo Secolare è indispensabile se si vuole stabilire una relazione vitale.

Per crescere nella fede e giungere alla piena maturità, l’aspetto meramente intellettuale non è sufficiente; è necessaria invece l’applicazione pratica di doni e talenti a onore di Dio e per il miglioramento dell’umanità.

In questi due ultimi articoli vediamo la convergenza dei vari fili che sono stati gli argomenti di tutti gli articoli precedenti: la vocazione offerta da Dio deve essere accettata liberamente dagli individui, che allora a Lui si affidano e dimostrano la serietà e la realtà di questo impegno con la messa a frutto dei doni da Lui ricevuti. Da parte sua, la Famiglia Servitana, in tutti i suoi componenti, circonda l’individuo con la conoscenza, l’esperienza, l’amore e l’aiuto durante il suo cammino.

ARTICOLO 47

L’articolo 47, conclusivo di questa sezione sull’Ordine Secolare e la vita della Fraternità, fa riferimento non soltanto al capitolo sulla formazione ma all’intera sezione. Ancora una volta, Maria è presentata come il modello così che possiamo riconoscere chiaramente la vita di un membro dell’Ordine Secolare.

Art. 47. La Vergine Maria, che mentre viveva sulla terra una vita comune ad ogni uomo, piena di sollecitudini familiari e di lavoro, era sempre intimamente unita al Figlio suo e cooperava in modo del tutto singolare all’opera del Salvatore, è il modello di vita di ogni Servo di Maria Secolare.

Sono qui messi in rilievo due aspetti della vita di Maria che il Servo Secolare deve imitare. Il primo è la vita ordinaria che Maria ha vissuto sulla terra, come madre e sposa, con tutte le ansie e le gioie, la fatica e il riposo che essa ha implicato. In questo modo possiamo sentirci vicini a Maria perché anche la nostra vita è fatta di esperienze quotidiane di ordinaria routine. Ma il secondo aspetto è ciò che ha dato vera vita, significato ed ispirazione a questi compiti quotidiani: la stretta unione con suo Figlio. Questo è il modo in cui dobbiamo trovare senso e ispirazione nei nostri compiti di ogni giorno: unione con Gesù, condivisione del suo lavoro per portare a tutti il regno e la pace di Dio. Così chiudiamo questa sezione ripetendo l’affermazione trovata al suo inizio: I Servi Secolari tendono alla santità (unione con Dio per mezzo di Cristo) secondo la spiritualità dell’Ordine (art. 10).

PARTE III

INSERIMENTO NELLA FRATERNITÀ SECOLARE

L’inserimento ufficiale nella Fraternità dell’ Ordine Secolare avviene in tre tappe: l’Ammissione (capitolo 8), la Prova o Noviziato (capitolo 9), e l’impegno definitivo o Promessa (capitolo 10). Anche se queste sono le tappe ufficiali, sarebbe bene conoscere la fruttuosa esperienza di molte Fraternità Secolari che incoraggiano le persone, interessate ad unirsi all’Ordine Secolare, a partecipare ad incontri e ad altre attività della Fraternità, così da formarsi un’idea migliore sulla natura della Fraternità Secolare e la vita dei suoi membri. Dopo un periodo d’osservazione della Fraternità Secolare da parte del candidato e del candidato da parte della Fraternità, può essere presa da ambedue una decisione più matura per quanto riguarda l’Ammissione al periodo di Prova.

Molti degli articoli in questa sezione sono brevi e richiedono appena un piccolo commento.

CAPITOLO OTTAVO

AMMISSIONE

I quattro articoli di questo capitolo si occupano delle caratteristiche del candidato, per la verifica della vocazione all’Ordine Secolare dei Servi di Maria (art. 48), della richiesta formale (art. 49), della maniera con cui l’Ammissione accade (art. 50), del successivo periodo di Prova o Noviziato (art. 51 e anche tutti gli articoli del capitolo 9).

ARTICOLI 48-49-50-51

Art. 48. All’Ordine Secolare possono essere ammessi coloro che manifestano sincera volontà di condividere l’ideale dei Servi di Maria e che s’impegnano a vivere ed esprimere nella loro situazione familiare e sociale i valori umani ed evangelici di vita cristiana, ad onorare e imitare con particolare pietà, secondo lo spirito dell’ Ordine, la Vergine Maria.

Questo paragrafo riassume i concetti espressi altrove (cfr. artt. 5 e 6). Le caratteristiche di un possibile candidato sono costituite dal desiderio di condividere gli ideali dell’Ordine, dal fatto di vivere la vita cristiana, e dalla volontà di onorare ed imitare la Beata Vergine Maria.

Art. 49. Per venire ammessi all’Ordine Secolare dovrà essere presentata domanda scritta al Consiglio della Fraternità Secolare cui spetta l’accettazione.

Questa richiesta scritta deve poi conservarsi nell’ archivio della Fraternità Secolare. Pur essendo preferibile che la domanda scritta sia redatta con le parole proprie del candidato, l’esperienza ha mostrato che è utile avere una formula prestabilita che serva da modello o anche, se necessario, venga semplicemente firmata.

Il Consiglio, poi, agisce secondo questa richiesta (cfr. articolo 72, n. 2). È sufficiente la maggioranza dei voti dei membri presenti del Consiglio. Sarebbe opportuno, tuttavia, in un argomento così importante, chiedere privatamente il parere di coloro che non hanno potuto essere presenti.

Art. 50. L’ingresso nella Fraternità Secolare seguirà le indicazioni del Rituale proprio dell’Ordine Secolare dei Servi di Maria.

Si deve osservare il Rituale proprio d’ Ammissione alla Fraternità Secolare, perché esso dà un chiaro segno al candidato e ai presenti che il passo da lui intrapreso comporta un impegno serio. Questo rituale si trova alla fine della Regola di Vita. L’introduzione al Rituale deve essere letta con attenzione, specialmente la parte riguardante l’invito rivolto a frati, suore e altre Fraternità dell’ Ordine Secolare dei Servi di Maria di partecipare a questo evento almeno con la preghiera.

Art. 51. Con l’Ammissione il candidato/a inizia l’esperienza di vita nella Fraternità Secolare per verificare l’autenticità della propria vocazione, nello studio e nella
pratica della Regola.

Il tempo di Prova o Noviziato, successivo all’Ammissione, è spiegato con maggiore ampiezza nel capitolo 9.

CAPITOLO NONO

PROVA O NOVIZIATO

Questo capitolo tratta della durata del tempo di Prova (art. 52 e art. 54) e del tipo di esperienza e studio che il candidato deve fare durante il Noviziato (art. 53).
ARTICOLI 52-53-54

Art. 52. La Prova o Noviziato è il periodo di tempo che va dall’Ammissione alla Promessa.
Normalmente la sua durata è di almeno un anno.

Art. 54. Per giusti motivi e tenendo conto della preparazione e maturità dell’interessato/a, il periodo di Prova può essere abbreviato o prolungato secondo la prudenza del Consiglio della Fraternità.

Da questi due articoli appare chiaro che il Consiglio ha una considerevole discrezione a riguardo della durata del periodo di Prova. Il principio generale stabilisce la sua durata annuale, ma il Consiglio può abbreviano o prolungano. Nel prendere una decisione, il Consiglio considererà la preparazione e la maturità del candidato. Per esempio, può guardare al numero di incontri che sono stati saltati (e perciò può decidere di allungare il periodo), oppure per altre buone ragioni, dopo essersi assicurato che il candidato è di fatto pronto a emettere la Promessa, può abbreviarne il periodo.

Art. 53. Nel periodo di Prova o Noviziato il candidato/a, sotto la guida del Responsabile della formazione e dell’Assistente, si impegna a:

• scoprire gradualmente ed assimilare la vocazione specifica del laico nella Chiesa e gli aspetti propri della Fraternità dei Servi di Maria Secolari;

• studiare la Regola e gli Statuti propri dell’Ordine Secolare dei Servi di Maria;

• approfondire la conoscenza della dottrina sulla Vergine Maria nel mistero di Cristo e della Chiesa;

• conoscere nelle linee essenziali la storia e la spiritualità dell’Ordine.

Il programma per il periodo di Prova è espresso anche nella formula d’Ammissione:

A te fra N. Maria (sorella Maria N.),
noi N.N. chiediamo umilmente di essere ammessi
a compiere un’esperienza di comunione e di vita
nella Fraternità Secolare dei Servi di Maria.
Vogliamo vivere più intensamente
gli impegni della consacrazione battesimale,

condividendo l’ideale di vita dei Servi,
e dare più viva testimonianza
della nostra pietà verso la Madre di Dio.
Desideriamo pertanto conoscere
la storia, la vita, la spiritualità dell’Ordine e collaborare al compimento
della sua missione nella Chiesa.

È bene infine ricordare che questi stessi elementi si trovano anche nella Regola di Vita. L’identità dei Secolari Servitani è delineata principalmente negli articoli 5 e 7. Il loro impegno nella Chiesa si esprime nell’articolo 12. Lo studio della Regola è raccomandato a tutti nell’ articolo 17. L’articolo 13 chiede ai membri di impegnarsi nell’approfondire la conoscenza di Maria e il suo posto nel mistero della salvezza, attraverso lo studio e la preghiera personale. Secondo l’articolo 17 l’esame di questioni relative alla vita Servitana è una delle ragioni degli incontri della Fraternità Secolare.

Da queste varie fonti è possibile perciò realizzare un programma completo per l’istruzione dei candidati durante il periodo di Prova o Noviziato.

CAPITOLO DECIMO

PROMESSA

I cinque articoli di questo capitolo trattano della natura della Promessa (art. 55), dei suoi effetti (art. 56), dell’età minima richiesta per la domanda scritta (art. 57), del Rito (art. 58) e della dispensa (art. 59).

ARTICOLI 55-56

Art. 55. La Promessa è l’atto con cui il candidato/a rinnova la sua consacrazione battesimale, impegnandosi a viverla secondo la spiritualità servitana, in comunione fraterna con tutte le comunità della Famiglia dei Servi, secondo la Regola e gli Statuti dell’Ordine Secolare dei Servi.

Questo articolo è un sommario di quanto è stato detto nei primi capitoli della Regola: la vocazione all’Ordine Secolare ha le sue radici nella consacrazione battesimale (art. 9); i membri tendono alla santità secondo la spiritualità dell’ Ordine dei Servi di Maria e seguendo la loro propria Regola (art. 10); per mezzo della Promessa i Servi dell’ Ordine Secolare esprimono un volontario impegno ad essere fedeli alla propria vocazione e mantenere un vincolo vivo con l’Ordine (art. 14).

Art. 56. La Promessa inserisce per sempre il candidato/a nell’Ordine Secolare dei Servi di Maria e lo fa partecipe della vita di tutta la Famiglia dei Servi.

L’effetto della Promessa è rendere il candidato/a un membro a tempo pieno dell’Ordine Secolare e in grado di contribuire alla vita di tutta la Famiglia dei Servi. La chiamata di Dio è per un servizio che comprende la vita intera, anche se, come vedremo nell’articolo 59, è possibile ricevere una dispensa dalla Promessa.

ARTICOLO 57

Art. 57. La domanda per venire ammessi alla Promessa deve essere presentata per iscritto dall’interessato/a al Consiglio della Fraternità Secolare e deve essere accompagnata da una relazione scritta del Responsabile della formazione.

L’età minima richiesta è di 18 anni.

Simile alla domanda per l’Ammissione al periodo di Prova, la richiesta per emettere la Promessa deve farsi per iscritto, ed essere rivolta al Consiglio per l’accettazione. Come per la richiesta all’Ammissione all’anno di Prova, la domanda può essere stesa con parole proprie del candidato oppure può essere già formulata per aiutare il candidato, se è necessario.

Il candidato deve avere compiuto almeno 18 anni al momento di fare la Promessa, equivalente alla maggiore età.

Questo articolo e anche l’articolo 53 menzionano una persona Responsabile della formazione, che, secondo l’articolo 53, si presume diversa da quella dell’Assistente. Tale persona non è menzionata tra gli Ufficiali della Fraternità; perciò sarebbe materia degli Statuti particolari della Fraternità Secolare determinarne il modo di elezione, la durata dell’incarico e le specifiche responsabilità (vedere articolo 76). La Regola indica in questo modo che anche la formazione di nuovi membri è responsabilità propria della Fraternità, e non di un membro esterno, anche se fosse l’Assistente. La Fraternità deve avere al suo interno tutte le risorse necessarie per assicurare la formazione appropriata dei suoi membri.

ARTICOLO 58

Art. 58. Il Rito della Promessa seguirà le indicazioni e la formula del Rituale proprio dei Servi di Maria Secolari e sarà presieduto, a seconda dei casi, dal Priore della comunità religiosa o da un Delegato dell’Ordine.

Il Rito della Promessa si trova nel Rituale dell’Ordine Secolare subito dopo il Rito dell’Ammissione all’anno di Prova. La maggiore solennità nel Rito della Promessa appare da due differenze stabilite dal Rituale:

1. Il Rito per l’Ammissione all’anno di Prova si svolge durante una Liturgia della Parola, durante la Liturgia delle Ore o durante la Vigilia di Nostra Signora (n. 5 del Rituale).

Ma il Rito della Promessa ha luogo durante la Messa o durante la Liturgia delle Ore (n. 71 del Rituale).

2. Esiste anche una differenza nella persona che presiede. La Regola non dice chi sia a presiedere il Rito d’Ammissione al periodo di Prova, ma l’edizione italiana del Rituale, al
n. 3, dice testualmente questo: “spetta al Priore conventuale o all’ Assistente della Fraternità presiedere il Rito di Ammissione. Nelle Fraternità erette presso Comunità femminili, il Rito può essere presieduto dalla Priora locale o dalla Sorella Assistente della Fraternità”.

Per il Rito della Promessa, il presente articolo (art. 58) riafferma semplicemente ciò che si trova nel Rituale (n. 69): “spetta al Priore della Fraternità religiosa o a un Delegato dell’Ordine, debitamente nominato, presiedere il Rito”.

Per il Rito della Promessa, il Presidente deve essere il Priore della Comunità locale servitana dei frati o un Delegato designato dall’Ordine, intendendo qui presumibilmente un frate, dal momento che questo è il contesto dell’articolo. Probabilmente questo è stato fatto per mostrare non soltanto la maggiore solennità del Rito ma anche il vincolo vitale che la Promessa crea con l’Ordine intero, rappresentato dal Priore Generale e dal Priore della Locale Comunità di frati.

Poiché non viene specificato chi ha l’autorità per delegare a presiedere il Rito della Promessa, possiamo presumere che 1’ autorità competente sia il Priore Generale, il Priore Provinciale, il Vicario Provinciale e il Priore locale, ciascuno dentro la propria giurisdizione.

Poiché non è posta alcuna restrizione relativamente alla persona che può essere delegata, ogni persona nominata a presiedere il Rito di Ammissione al periodo di Prova / Noviziato, può anche essere delegata a presiedere il Rito della Promessa.

ARTICOLO 59

Art. 59. Per giusti e validi motivi il Consiglio della Fraternità potrà dispensare, temporaneamente o definitivamente, dalla Promessa ed anche dimettere il fratello o la sorella che hanno fatto la Promessa dopo averne esposto le ragioni e sentite quelle dell’interessato/a.

L’articolo 56 afferma che la Promessa coinvolge il candidato, per sempre, nell’Ordine Secolare. Il presente articolo, perciò, determina il metodo con cui questo vincolo vitale può essere sciolto. Il Consiglio della Fraternità Secolare ha l’autorità per dispensare dalla Promessa o dimettere un membro. Nel caso della dispensa, l’iniziativa viene dall’individuo; nel caso della dimissione, l’iniziativa viene dal Consiglio stesso.

La persona che chiede la dispensa, deve presentare domanda scritta che sarà debitamente registrata nel verbale dell’incontro del Consiglio, insieme al voto del Consiglio. La dispensa può essere concessa o per un preciso periodo, se l’individuo intende riprendere gli obblighi in una data posteriore, o in forma definitiva. Per esempio, un membro dell’Ordine Secolare si trasferisce in una zona dove non esiste una Fraternità dell’Ordine Secolare e desidera aggregarsi a quella Locale dei francescani. Dal momento che una persona non può appartenere a due Ordini Secolari nello stesso tempo, è necessario ottenere prima la dispensa dalla Promessa nell’Ordine Secolare dei Servi.

Il Consiglio può anche dimettere un membro dall’Ordine Secolare. Tuttavia, per rispettare un comportamento giusto, il Consiglio deve prima dichiarare le sue ragioni alla persona e invitare la persona a presentare le sue al Consiglio. Dopo aver ascoltato la persona (o se la persona non si presenta), il Consiglio può allora procedere alla votazione. La dimissione deve essere usata soltanto come un’ultima risorsa. Per esempio, un membro lascia la Chiesa Cattolica e si aggrega a un’altra Chiesa e non vede alcuna necessità di chiedere la dispensa.

PARTE IV

ORGANIZZAZIONE DELLA FRATERNITÀ SECOLARE

I tre capitoli di questa sezione spiegano dapprima l’organizzazione generale della Fraternità Secolare (Capitolo 11), poi il modo in cui un nuovo Gruppo riceve l’Ammissione ufficiale (Capitolo 12), e infine una descrizione più dettagliata degli Ufficiali della Fraternità Secolare, i loro doveri e le loro responsabilità (Capitolo 13). Molti di questi articoli sono chiari in se stessi e basta una breve spiegazione.

CAPITOL UNDICESIMO

ORGANIZZAZIONE

ARTICOLI 60-61-62-63

Art. 60. L’Ordine Secolare dei Servi di Maria è formato da Fraternità locali che, unite dallo stesso ideale di vita, costituiscono la Fraternità internazionale.

Art. 61. Più Fraternità possono raggrupparsi in Fraternità cittadine, zonali [o provinciali], nazionali.

Art. 62. La vita all’interno d’ogni Fraternità o gruppo di Fraternità è organizzata dalla Fraternità stessa sotto la guida dei rispettivi Priori/e e Consigli.

Art. 63. Ogni Fraternità è collegata all’Ordine tramite l’Assistente designato.

L’unione di tutte le Fraternità Secolari locali formano la Fraternità Internazionale. Inoltre, secondo la necessità o il desiderio, le Fraternità locali possono formare anche gruppi zonali [o provinciali], o nazionali, per trarre vantaggio da un numero più ampio e da una più vasta serie di esperienze e di doni. Ma l’articolo 62 fa notare rapidamente che, a prescindere dalle più grandi unità, la Fraternità Secolare locale mantiene la propria autonomia per quanto riguarda la sua vita interna regolata dai rispettivi Responsabili.

L’Assistente fa da legame con il resto dell’Ordine. Il vincolo appare più chiaramente quando l’Assistente è un Servo di Maria frate, monaca, suora, o membro di un Istituto Secolare. Nel caso di un sacerdote diocesano, il vincolo è presente attraverso la nomina fatta dalla competente autorità servitana, anche se la persona è confermata dall’Ordinario locale (vescovo).

Il ruolo dell’Assistente viene in forma particolareggiata considerato nell’articolo 73.

CAPITOL, O DODICESIMO

RICONOSCIMENTO UFFICIALE ECCLESIALE

ARTICOLI 64-65-66.67

Art’. 64

a. Spetta al Capitolo conventuale riconoscere l’autenticità servitana di un gruppo che sorge presso la comunità dei frati e appoggiare la domanda per l’approvazione ufficiale.
b. Anche le altre componenti della Famiglia dei Servi (monache, suore, istituti secolari) possono riconoscere l‘autenticità di un gruppo che sorge presso di loro e, allo stesso modo, appoggiare la domanda per l’approvazione ufficiale.

c. Per le Fraternità costituite al di fuori delle comunità della Famiglia dei Servi, competenti a riconoscere l’autenticità sono, a seconda dei casi, i Consigli Vicariale, Provinciale, Generalizio

Art. 65. Una Fraternità dell’Ordine Secolare dei Servi di Maria viene approvata ufficialmente con decreto del Priore Generale.

Art. 66. Per l’approvazione ufficiale di una Fraternità è necessaria la richiesta scritta. Nei caso di una Fraternità sorta ai di fuori di una comunità della Famiglia dei Servi, oltre alla richiesta scritta, si richiede l’autorizzazione dell’Ordinario del luogo.

Art. 67. Di ogni approvazione ufficiale venga informato il Segretario Generale dei Servi di Maria per i ‘Ordine Secolare e i Gruppi Laici.

Perché un gruppo sia riconosciuto come parte ufficiale dell’Ordine Secolare dei Servi vanno compiuti i seguenti passi: 1. deve essere riconosciuto a livello locale come autenticamente servitano; 2. si deve fare domanda al Priore Generale che allora 3. fa un decreto e 4. infine viene informato il Segretario Generale per l’Ordine Secolare e i Gruppi Laici.

1. Se la Fraternità Secolare sorge accanto ai Servi/e, (frati, monache, suore, Istituti Secolari), questa Componente può riconoscerne l’autenticità servitana. Tuttavia, nel caso dei frati, la Regola specifica che è il Capitolo conventuale a prenderne l’iniziativa. Poiché la Regola è stata redatta nell’ ambito dei frati, è possibile determinare chi è il responsabile a livello locale per riconoscere l’autenticità servitana di un gruppo. Si presume che entità corrispondenti saranno designate da altri membri della Famiglia dei Servi come autorità dotate di competenza per un’azione del genere. Deve essere anche rilevato che a. e b. di questo articolo ripetono semplicemente l’articolo 308 b. delle Costituzioni dei frati.

Quando una Fraternità Secolare sorge al di fuori delle Comunità Servitane, responsabile della concessione del riconoscimento è a seconda dei casi, i Consigli Vicariale, Provinciale, Generalizio della zona in cui si trova la Fraternità.

Per l’approvazione ufficiale di una Fraternità è necessaria la richiesta scritta.

2. Il Capitolo conventuale (o Consiglio Provinciale o un’entità similare di un’altra istituzione della Famiglia dei Servi) presenta allora la dichiarazione dell’autenticità servitana del gruppo, insieme alla richiesta al Priore Generale di erigere una Fraternità Secolare dell’Ordine di Servi di Maria. Se il nuovo gruppo nasce al di fuori di una Comunità dei Servi, è necessaria anche l’autorizzazione dell’ Ordinario del luogo (vescovo).

2 bis. [Gli Statuti particolari per l’Italia prevedono modalità anche differenti. Perciò questo articolo va completato con l’attuazione del relativo numero dello Statuto.]

3. Il Priore Generale emette il decreto di riconoscimento della nuova Fraternità come parte ufficiale dell’ Ordine Secolare dei Servi di Maria.

4. Infine, una persona che la Regola non individua, informa il Segretario Generale dei Servi di Maria per l’Ordine Secolare e i Gruppi Laici dell’atto avvenuto.

CAPITOLO TREDICESIMO

GOVERNO

Il Capitolo sul governo descrive il ruolo e i compiti degli Ufficiali dell’Ordine Secolare: il Priore Generale (art. 68), il Segretario Generale (art. 69), il Priore/a/Presidente della Fraternità: art. 70-71), il Consiglio (art. 72), l’Assistente (art. 73), il Segretario/a (art. 74).

Questi articoli sono generalmente chiari nel loro significato e richiedono un breve commento.

ARTICOLO 68. PRIORE GENERALE

Art. 68. Il Priore Generale dell’Ordine, segno di unità dell’intera Famiglia dei Servi, esercita la sua autorità, in spirito di servizio, su tutto l’Ordine Secolare dei Servi di Maria, nel rispetto della sua autonomia.

Il ruolo del Priore Generale, che è segno di unità dell’intera Famiglia dei Servi, è visto come un servizio all’Ordine Secolare, la cui autonomia va rispettata. Questo riflette l’articolo 266 delle Costituzioni dei frati dove anche si afferma che il Priore Generale “esercita la sua autorità in spirito di servizio”. Eccetto in circostanze straordinarie, egli eserciterà questo servizio attraverso i vari livelli di autorità.

ARTICOLO 69. SEGRETARIO GENERALE

Art. 69.

1. Il Segretario Generale per l’Ordine Secolare e i Gruppi Laici è nominato dal Consiglio Generalizio dell’Ordine. Suo compito principale è l’animazione ed il coordinamento a livello generale.
2. In collaborazione con i membri del Segretariato Generale e gli Assistenti ai vari livelli, porterà a conoscenza delle varie Fraternità le direttive spirituali e pastorali della Chiesa universale e dell’ Ordine, nonché le attività e le esperienze più significative delle singole Fraternità.

Il Segretariato Generale per l’Ordine Secolare e i Gruppi Laici è uno dei Segretariati e Ufficiali generali riconosciuti dalle Costituzioni dei frati (art. 285 a). Il Consiglio Generale dei frati elegge il Segretario Generale per l’Ordine Secolare e i Gruppi Laici e specifica le responsabilità e le modalità operative del Segretariato (art. 285 b). La descrizione del suo compito principale – animazione e coordinamento a livello dell’intero Ordine – è una logica derivazione dalla natura del Segretariato, ma non si trova nelle Costituzioni.

Nel secondo paragrafo di questo articolo si specifica l’unico modo con il quale questa “animazione” si attua: attraverso la comunicazione di varie direttive della Chiesa e dell’Ordine che possono essere d’interesse o di aiuto alle Fraternità, e informazioni provenienti dalle diverse Fraternità Secolari sparse nel mondo. Secondo la Regola, perciò, il Segretariato Generale opera come un centro internazionale di comunicazioni per l’Ordine Secolare. Altre responsabilità, comunque, possono essere attribuite al Segretario Generale e al Segretariato da parte del Consiglio Generale dei frati.

ARTICOLI 70-71. PRIORE/PRIORA

Art. 70.

1. Il Priore/a, primo tra i fratelli e le sorelle, presiede la Fraternità in spirito di carità. Insieme con il suo Consiglio e ogni membro della Fraternità, ha la responsabilità dell’intera Fraternità.
Nell’esercizio del suo servizio, il Priore/a si ricordi di testimoniare Cristo, venuto non per essere servito, ma per servire e far crescere la vita nei suoi.

2. E compito del Priore/a:

• convocare e presiedere le riunioni della Fraternità e del Consiglio;

• promuovere a animare gli impegni spirituali ed apostolici della Fraternità;

• vigilare sull’osservanza della Regola e degli Statuti;

• collaborare con l’Assistente e gli Ufficiali della Fraternità.

Art. 71. Il Priore/a viene eletto a norma degli Statuti particolari.

La Regola di Vita dà il titolo di Priore/Priora alla persona scelta a presiedere la Fraternità Secolare.

In una nota a piè di pagina la Regola afferma che il titolo di “Presidente” può essere utilizzato al posto di Priore o Priora.

La Regola in questo modo lascia alla Fraternità la decisione di scegliere il titolo che preferisce. Il titolo tradizionale di Priore o Priora sottolinea il carattere religioso del gruppo, che dipende da un Ordine medioevale; il più recente titolo di Presidente esprime meglio il carattere laicale del gruppo. Per esempio, nell’Istituto Secolare Servitano chi occupa il primo posto è chiamato Presidente, non Priore o Priora, esattamente per richiamare 1’ attenzione sul carattere Secolare non-religioso dell’organizzazione.

Anche se presiede la Fraternità, il Priore/Priora/Presidente condivide la sua responsabilità con i membri del Consiglio e tutti gli altri membri della Fraternità. Perciò ciascun membro deve sentirsi responsabile del bene e della crescita dell’intera Fraternità.

ARTICOLO 72. CONSIGLIO

Art. 72.

1. Ogni Fraternità Secolare ha un Consiglio composto dal Priore/a e da almeno tre Consiglieri eletti dalla Fraternità stessa, nonché dall’Assistente.

2. È compito del Consiglio:
• collaborare con il Priore/a nella guida e nell’animazione della Fraternità;
• accettare i candidati all’Ammissione e alla Promessa;
• dispensare dalla Promessa;
• dimettere, ove fosse necessario, un membro della Fraternità, sentite le ragioni presentate dall’interessato/a.

Ogni Fraternità Secolare deve avere un Consiglio formato da almeno tre Consiglieri che lavorano insieme al Priore/Priora/Presidente nel programmare, promuovere e attuare gli obiettivi della Fraternità. I Consiglieri devono essere eletti dalla stessa Fraternità, cioè non sono nominati dall’Assistente o dal Priore/Priora/Presidente. Abbiamo già visto che il voto del Consiglio è necessario per ammettere un candidato al periodo di Prova (art. 49) e alla Promessa (art. 57) e anche per dispensare dalla Promessa (art. 59) o dimettere un membro (art. 59).

L’esperienza ha mostrato che il buon funzionamento del Consiglio è essenziale per la crescita e il successo della Fraternità. Non ci sono regole per la frequenza degli incontri o per gli argomenti da trattare. Un ruolo essenziale è quello di programmare le riunioni, e il Consiglio deve riunirsi con quella frequenza necessaria ad assicurare che il tema e le dinamiche dell’incontro promuovano attivamente gli scopi dell’ Ordine Secolare.

ARTICOLO 73. ASSISTENTE

Art. 73.

1. Ogni Fraternità Secolare o gruppo di Fraternità ha un Assistente nominato dalle rispettive autorità competenti della Famiglia dei Servi.

Qualora l’Assistente non sia un membro della Famiglia dei Servi, verrà nominato dalle competenti Autorità dell’Ordine su indicazione della Fraternità Secolare locale e confermato dall’Ordinario del luogo.

2. L’Assistente può essere: un fratello o una sorella della Famiglia dei Servi (frati, monache, suore, istituti secolari); un Sacerdote appartenente all’Ordine Secolare dei Servi di Maria; un altro Sacerdote.

3. L’Assistente sia preparato e disponibile, impegnato ad approfondire con i fratelli e le sorelle con i quali condivide il comune cammino di fede, la specifica vocazione del Servo di Maria Secolare.

4. L’Assistente promuove, tra i membri della Fraternità, lo spirito della Famiglia dei Servi e offre un servizio spirituale di animazione.

L’articolo 63 descrive l’Assistente come la persona attraverso la quale la Fraternità Secolare è in rapporto con l’Ordine: il vincolo tra la Fraternità e il resto della Famiglia Servitana. E ovvio, perciò, che ogni Fraternità debba avere un [o una] Assistente.

L’Assistente è nominato dalle competenti Autorità dell’Ordine, che non vengono meglio specificate. Forse sarebbe bene identificare la competente Autorità: in questo caso chi ha il diritto di riconoscere l’autenticità servitana di un Gruppo alla sua origine (art. 64 a, b, c). Se l’Assistente non è un membro della Famiglia Servitana, l’Autorità competente ascolta dapprima la Fraternità Secolare locale, quindi presenta la nomina all’Ordinario locale (vescovo), che ha il diritto di confermare la persona nominata.

L’Assistente può essere una sorella o un fratello di un gruppo all’interno della Famiglia dei Servi, un sacerdote membro dell’Ordine Secolare o un altro sacerdote. E poiché l’Assistente è il legame tra l’Ordine Secolare e il resto della Famiglia Servitana, ne consegue che l’Assistente debba essere disposto a studiare la vocazione del Servo Secolare, inclusa la spiritualità servitana, così che possa guidare i membri nel loro cammino di fede alla luce della spiritualità dell’Ordine dei Servi, le sue direttive e la Regola di Vita dell’Ordine Secolare (cfr. art. 10).

[Gli Statuti particolari per l’ Italia prevedono modalità anche differenti. Perciò questo articolo va completato con l’attuazione dei relativo numero dello Statuto.]

ARTICOLO 74. SEGRETARIO/A

Art. 74.

1. Ogni Fraternità abbia un Segretario/a.

2. Spetta al Segretario/a:

• redigere i verbali degli incontri della Fraternità e del Consiglio;

• tenere aggiornato il registro delle Ammissioni e delle Promesse;

• custodire e tenere aggiornato lo schedario;

• mantenere i contatti con i fratelli e le sorelle impossibilitati/e ad intervenire agli incontri.

Oltre l’Assistente, il Priore/Priora/Presidente, e i Consiglieri, la Regola di Vita stabilisce anche la figura del Segretario/Segretaria. I compiti del Segretario sono: redigere i verbali degli incontri sia della Fraternità sia del Consiglio, tenere aggiornati i registri e lo schedario della Fraternità. Spetta anche al segretario mantenere i contatti con i fratelli e le sorelle che non possono partecipare agli incontri.

PARTE V

STATUTI PARTICOLARI

ARTICOLI 75-76

Gli Statuti propri di ogni Fraternità Secolare applicano le regole generali alle circostanze e alle necessità particolari.

Art. 75. Ogni Fraternità Secolare o gruppo di Fraternità dovrà avere un proprio Statuto per l’applicazione pratica di quanto stabilito dalla presente Regola.
Gli Statuti particolari saranno approvati dalle Fraternità stesse.

Art. 76. Gli Statuti particolari dovranno stabilire:
• le modalità di elezione del Priore/a e sua durata nell’ufficio;
• le modalità di elezione dei membri del Consiglio e la loro durata nell’ufficio;
• l’eventuale aumento del numero dei Consiglieri/e;
• il numero, le competenze, le modalità di elezione, durata in ufficio di eventuali Ufficiali della Fraternità;
• eventuali altri compiti del Segretario/a.

Questo è uno dei più importanti articoli della Regola di Vita. Nello studio della Regola abbiamo visto che frequentemente le linee guide per il tipo di vita dei membri dell’Ordine Secolare sono un po’ generiche, perché le regole sono state scritte per situazioni e culture. L’articolo permette ad ogni Fraternità di adeguare le regole generali alla situazione locale.

Gli Statuti particolari devono essere approvati dalla Fraternità Secolare Locale, o Zonale,Provinciale, o Nazionale, o Internazionale (cfr. art. 60), ossia ognuna approva gli Statuti del proprio livello.

Ci sono alcuni argomenti che devono essere posti negli Statuti particolari. Essi comprendono il metodo di elezione, la durata dell’incarico di Priore/Priora/Presidente e dei Consiglieri; il numero dei Consiglieri, se è necessario averne più di tre; altri Ufficiali eventualmente necessari e le loro responsabilità, durata dell’incarico, metodo di elezione; altri compiti del Segretario/a.

I gruppi tendono a preferire l’elezione con voto scritto, perché un voto segreto permette una maggior libertà di espressione. In questo modo, inoltre, non si sa chi vota per un certo candidato piuttosto che per un altro. Tuttavia, non sono esclusi altri metodi. Gli Statuti particolari possono anche stabilire una procedura di nomina o una commissione di nomina.

Alcuni gruppi preferiscono la durata di un anno, sulla base che chi fa bene può essere rieletto; altri preferiscono una maggiore durata per esigenze di continuità. Per l’elezione dei Consiglieri, alcuni gruppi hanno scelto un metodo che permette un avvicendamento graduale così che nel Consiglio ci sono sempre Consiglieri già sperimentati e altri di nuova nomina. Anche la durata dell’incarico deve essere considerata: trascorso un certo numero di anni, non si dovrebbe continuare a rieleggere uno stesso Ufficiale.

Va ricordato che altri due “Ufficiali” sono menzionati nella Regola, ma non si danno indicazioni per la loro elezione e i loro compiti. L’articolo 21 presume che vi sia un tesoriere [amministratore] e gli articoli 53 e 57 menzionano una persona Responsabile della formazione. La Fraternità può lasciare la scelta di questi incarichi al Consiglio, o può essere la Fraternità ad eleggerli.

La Fraternità deve specificare inoltre se un incarico sia compatibile con un altro. Per esempio, un membro del Consiglio può essere eletto tesoriere e Responsabile della formazione? E consigliabile, specialmente nei gruppi più piccoli, che il Segretario abbia anche il compito di tesoriere? In generale, non è opportuno che il Priore/Priora/Presidente abbia l’incarico di tesoriere, perché in una materia così delicata come l’uso del danaro, è bene che il tesoriere si rapporti con un Ufficiale più alto. Questo non è possibile, se il Priore / Priora / Presidente e il tesoriere sono la stessa persona.

Ma non può essere impossibile per il Priore / Priora / Presidente assumere anche l’incarico di Responsabile della formazione della Fraternità.

[In Italia sussiste una prassi che all’interno delle Fraternità OSSM distribuisce o accoglie altri uffici, ad esempio: Vice-Priore/a; Vice-Assistente; Responsabili per le vocazioni; Responsabili per le missioni; Responsabili con gli impossibilitati ad intervenire agli incontri della Fraternità (ex ‘infermiere’); ecc.]

Molta libertà e autonomia vengono date ad ogni Fraternità per organizzare la propria vita secondo le circostanze del tempo e del luogo.

Lo spirito creativo di ogni Fraternità assicurerà che queste decisioni promuovano davvero il bene comune di ciascuno dei membri e dell’intera Fraternità Secolare Servitana.

3 juillet, 2014

Françoise Breynaert docteur en Théologie qui a aussi puisé dans l’ enseignement doctrinale des Pères Servites de Marie

Classé dans : Non classé — andreadicaffa02 @ 18:51

Vivre le baptême avec Marie

                                                         Origine et développement du culte envers Marie                                                         La Tradition apostolique (vers l’an 215)                                                         Vivre le baptême avec Marie                                                         Marie dans la liturgie du dimanche                                                         Vivre la sainte Messe avec Marie                                                         Les prières liturgiques, une anthologie mariale

Partager

Imprimer la page

L’expérience du baptême :

Notre baptême est une participation à la victoire de Jésus sur la mort et sur le péché qui est la cause de la mort. C’est pourquoi les baptêmes d’adulte ont lieu durant la nuit pascale ou le jour de Pâques.

Vivre en se sachant aimé(e) de Dieu.
Le baptême est une manière de vivre parce qu’on se sait aimé(e) de Dieu.
Se savoir aimé(e) de Dieu est la victoire sur le péché qui est toujours un manque d’amour, et c’est la victoire sur la mort, car la vie d’union à Dieu est victorieuse de la mort.
Les paroles adressées à Jésus le jour de son baptême s’adressent aussi à nous.
« Ayant été baptisé, Jésus aussitôt remonta de l’eau; et voici que les cieux s’ouvrirent: il vit l’Esprit de Dieu descendre comme une colombe et venir sur lui. Et voici qu’une voix venue des cieux disait: « Celui-ci est mon Fils bien-aimé, qui a toute ma faveur. » » (Matthieu 3, 16-17)

On ne prend pas le baptême, on le reçoit : c’est un cadeau.
De la part du Fils, : veux-tu être Fils du Père comme moi ?
De la part du Père : consens-tu à être mon enfant et que je sois ton Père ?
De la part de l’Esprit Saint : Veux-tu être saisi, marqué d’un sceau par l’Esprit de la promesse ? (Soulignons l’image du sceau : par le sceau de l’Esprit Saint, Dieu peut nous reconnaître sien).

Il ne faut pas parler du baptême au passé mais au présent.
Dieu ne dit pas « tu as été mon enfant ».
Dieu dit : « tu es mon enfant ».
« Car tu comptes beaucoup à mes yeux, tu as du prix et je t’aime. » (Isaïe 43, 4)

Vivre le baptême, c’est vivre une expérience de l’Alliance.
La grâce du baptême, c’est le regard d’amour du Père posé sur moi avec fidélité.
Un exemple nous le fait comprendre :
Un enfant était adopté. Un jour, il commis beaucoup de fautes. Son père le réprimanda vivement et l’enfant s’en alla bouder en criant : de toute façon, tu n’es pas mon père !
Le père adoptif attendit puis il l’approcha et lui dit : c’est vrai, je ne suis pas ton père, mais je t’ai choisi.
A ces mots, la glace qui était dans le cœur ce cet enfant fondit.

 

Comment Marie est-elle présente au baptême?

Le baptême nous fait entrer dans la famille de l’Eglise, qui est le Corps mystique du Christ. La Mère du Christ est présente dans notre incorporation au Corps mystique du Christ. Le Corps mystique vit de la vie divine. En effet,

 

Cette vie divine nous est révélée et communiquée parce que Dieu s’est fait homme, et cela s’est réalisé par Marie, c’est le mystère de l’Incarnation (Lc 1, 26-38).

 

Pour entrer dans le Corps mystique du Christ, il faut mourir au péché pour renaître à la vie de la grâce, c’est une Pâque, là encore, Marie est présente, elle qui fut debout au pied de la croix, elle que Jésus a donnée à chaque disciple au moment crucial de ce passage qui est une nouvelle naissance.

 

Marie et le baptême dans la pratique de l’Eglise primitive

La Tradition apostolique, document liturgique romain de l’an 215 environ, témoigne que dans le rite de l’attribution du baptême, la nuit de Pâques, lors de la seconde immersion du catéchumène, il lui est demandé : « Crois-tu en Christ Jésus, Fils de Dieu, né par l’Esprit Saint de Marie la Vierge ? » [1]

Le motif est évident : la vraie maternité de Marie vis-à-vis du Fils de Dieu et sa fécondité virginale sont la base historique et la garantie du salut.

 

Dès le troisième siècle, la catéchèse et la solennisation du jour anniversaire du baptême avec renouvellement des promesses se sont développées afin de rendre les chrétiens plus persévérants.

 

Marie et le baptême dans l’Eglise catholique romaine

En 829, le concile de Sens renoue avec l’antique pratique du renouvellement des promesses baptismales.

Mais la Renaissance infiltra une sagesse humaine et même mondaine.

Luther puis la réforme catholique réagissent et rappellent à nouveau la grandeur du baptême. Saint Charles de Borromée, évêque de Milan, reprend la pratique du renouvellement des vœux du baptême.

Le pape Clément XI envoya le père de Montfort « faire renouveler partout l’esprit du christianisme par le renouvellement des vœux du baptême. »

 

Fort de son expérience spirituelle de terrain, saint Louis Marie de Montfort propose un don de soi-même au Christ par les mains de Marie dans la cérémonie du renouvellement des vœux du baptême (Contrat d’Alliance 1-3), et il identifie les deux démarches spirituelles (Traité 120). [2]

 

C’est l’Eglise qui baptise, et Marie est présente à ce moment là, elle accompagne le baptisé, elle accompagne l’Eglise qui baptise. C’est ainsi que le concile Vatican II dit que Marie coopère à la naissance des croyants. Voici la phrase du concile Vatican II :

 

« [Marie] engendra son Fils, dont Dieu a fait le premier-né parmi beaucoup de frères (Rm 8, 29), c’est-à-dire parmi les croyants, à la naissance et à l’éducation desquels elle apporte la coopération de son amour maternel. »

(Lumen gentium 63)

Le concile Vatican II a été suivi d’une réforme liturgique. Et le rituel du baptême indique dans une rubrique finale que le Magnificat d’action de grâces et la consécration à Notre-Dame peuvent avoir leur place, à la fin de la cérémonie (Rituel du baptême, n°80).

Exemples d’application :

  • Les mouvements néo-catéchuménaux, qui prennent le temps de refaire, avec des adultes, le cheminement pré-baptismal, donnent à Notre-Dame, et de façon explicite, la place qui lui revient.
  • Dans le même esprit, un certain nombre de sanctuaires marials célèbrent actuellement une consécration à Marie pour les enfants baptisés dans l’année, par exemple, Notre Dame de Grâce à Honfleur, Notre Dame de la Délivrande à Douvres-la-Délivrande, etc.
  • La spiritualité de saint Louis-Marie de Montfort : Marie est un moule vivant où nous sommes façonnés, chacun de manière unique.

[1] La Tradition Apostolique §21, par B.BOTTE, SC 11 bis, Le Cerf Paris 1968, p. 84

[2] F. Breynaert, L’arbre de vie, Parole et Silence, Paris 2006 ; ou A l’écoute de Marie, tome II, Brive 2007.

Lire aussi : Ignazio Calabuig, Il culto di Maria in occidente, In Pontificio Istituto Liturgico sant’Anselmo, Scientia Liturgica, sotto la direzione di A.J. Chupungco, vol V, Piemme 1998. p. 270-271


Mgr Jean Ntagwarara (Burundi)

 

 

Breynaert (Françoise Breynaert)


A propos de l’auteur

Françoise Breynaert docteur en Théologie qui a aussi puisé dans l' enseignement doctrinale des Pères Servites de Marie

Breynaert (Françoise Breynaert)Voir toutes ses publications

Née en 1963. Docteur en théologie (Marianum, Rome). J’ai rencontré les fondateurs du projet « Marie de Nazareth » en septembre 2001 et je me suis mise à leur service en partant à Rome dès le mois d’octobre. J’ai étudié à la faculté pontificale de théologie « Marianum », en apportant au projet des fiches de synthèse en français, entre les années 2002 et 2005. Pendant ces années à Rome, en 2004, j’ai soutenu une thèse de doctorat « L’arbre de vie, symbole de la spiritualité de saint L-M de Montfort », avec la mention Summum cum laude (mention suprême).
En 2006, j’ai donné la formation mariologique au séminaire franciscain de Jérusalem (en italien). Entre temps, j’ai aussi parfois donné des sessions de formations dans des communautés classiques ou dans d..

- See more at: http://www.mariedenazareth.com/qui-est-marie/vivre-le-bapteme-avec-marie#sthash.EF6hBlpE.dpuf

17 mai, 2014

Le site Notre-Dame des Douleurs recherche des traducteurs bénévoles

Classé dans : Non classé — andreadicaffa02 @ 19:57

Bonjour,

je vous remercie de vous intereser à mon site , http://notre-dame-des-douleurs.net/    et d’avoir consacré une page de presentation et de liens pour diverses pratiques pour prier notre Mère des douleurs.

d’autres textes vont être mis en ligne, mais le webmaster est débordé et ça prend ….du temps

je me permets de vous signaler ma recherche actuelle:

 

Je cherche des traducteurs bénévoles.

puisque vous trouvez ce site intéressant, vous pourriez peut-être avoir la possibilité de rencontrer un ou des traducteurs (des retraités par exemple ou autre), qui traduiraient le site en son entier ou tout du moins les prières principales et les textes fondamentaux, autant qu’il leur est possible.

 

Après être mis en contact, pour structurer le travail (chaque dossier porte un numéro pour que la webmaster s’y retrouve et ce quelle que soit la langue), je me chargerai alors de créer un site dans cette nouvelle langue, payer le webmaster ainsi que la maintenance du site.

 

Dans cette éventualité, il est clair que les traducteurs seront remerciés sur le site en citant  leur prénom et éventuellement leur nom mais il n’y sera fait aucune référence à vous comme organisation, comme d’ailleurs pour éventuellement tout autre ‘’courant’’.

Ce qui ne vous empêche pas de signaler dans un article interne que vous avez aimablement fourni des traducteurs bénévoles.

 

Il s’agit d’un site de dévotion, uniquement, pour faire aimer la Vierge Marie qui a souffert pour devenir notre Mère.

Ces sites seraient ma propriété et c’est moi qui les entretiendrais.

Mais ainsi nous aurons collaboré au développement de la reconnaissance que l’on doit aux souffrances de notre Mère, comme il se doit à de véritables enfants.

Ce qui est le plus important et de surcroît méritoire pour chacun des participants à ce travail.

 

En vous remerciant de m’avoir lu et en espérant, si Dieu le veut, à une collaboration future pour la Gloire de notre Mère et ainsi la joie de son Fils, Premier né,

Veuillez agréer mes sincères salutations cordiales.

 

pour tout contact : utiliser cette adresse mail : verdeoceanus@gmx.com ou celle du site, le webmaster me transmettra : contact@notre-dame-des-douleurs.net.  Merci.

9 avril, 2014

Sièges episcopaux sans evêques

Classé dans : Non classé — andreadicaffa02 @ 0:56

GCatholic.org

Home
Jurisdictions
Prelates
Churches
Documents
Saints
Canada
Vacant Titular Sees
Titular SeesAscending
(85 Metropolitan, 80 Archiepiscopal,
840 Episcopal) Vacant
since Last Titular Bishop
Abila in Palæstina 1977.02.24 Cardinal Paulos Tzadua (transferred)
Abydus 1996.11.11 Bishop Jacob Manathodath (67)Bishop Jacob Manathodath (67) (transferred)
Achelous 1976.10.28 Bishop Owen Noel Snedden (transferred)
Achrida 1997.04.19 Cardinal Varkey Vithayathil, C.SS.R. (transferred)
Achyraus 1990.08.11 Bishop Augustín Van Aaken, S.V.D. (died)
Acilisene 1972.09.20 Bishop Cirillo Giovanni Zohrabian, O.F.M. Cap. (died)
Acmonia 1962.04.02 Archbishop Gilbert Ramanantoanina, S.J. (transferred)
Acufida 2014.03.19 Bishop Henrique Soares da Costa (51)Bishop Henrique Soares da Costa (51) (transferred)
Adada 1977.12.20 Bishop Conrad Dubbelman, O. Praem. (died)
Adana 1981.07.20 Archbishop Diego Venini (died)
Adraa 1964.04.21 Bishop Elias Mchonde (transferred)
Adramyttium 1966.02.01 Bishop Nicola Agnozzi, O.F.M. Conv. (transferred)
Adrasus 1970.04.16 Bishop Norman Joseph Gallagher (transferred)
Adulis 1969.03.03 Archbishop Martin Lucas, S.V.D. (died)
Aëtus 1966.10.11 Bishop Johannes Willem Maria Bluijssen (transferred)
Afathonice 1993.02.01 Bishop William Brasseur, C.I.C.M. (died)
Ægæ 1978.05.26 Bishop Cornélio Chizzini, F.D.P. (resigned)
Agathopolis 2008.08.26 Bishop Michael Kuchmiak, C.SS.R. (died)
Ægeæ 1957.08.20 Archbishop Francisco de Borja Valenzuela Ríos (transferred)
Ægina 1990.09.29 Archbishop Raffaele Forni (died)
Agnus 1963.12.17 Bishop Michel-Louis Vial (transferred)
Agrippias 1933
Æla 1978.11.27 Cardinal Joseph-Marie Trịnh Văn Căn (transferred)
Alabanda 1968.05.02 Bishop James William Malone (transferred)
Álava 2014.02.12 Bishop Nelson Francelino Ferreira (49)Bishop Nelson Francelino Ferreira (49) (transferred)
Alexandria minor 1964.06.04 Bishop Daniel Tavares Baeta Neves (transferred)
Algiza 1995.12.09 Archbishop Mario Brini (died)
Alia 1971.12.01 Bishop Lech Kaczmarek (transferred)
Alinda 1982.06.06 Bishop Juan Hervás y Benet (died)
Alphocranon 1933
Amadassa 1970.03.15 Bishop François-Xavier Lacoursière, M. Afr. (died)
Amasea 1995.01.14 Archbishop James Patrick Carroll (died)
Amastris 1965.04.06 Archbishop Teopisto Valderrama Alberto (transferred)
Amathus in Cypro 1984.01.14 Bishop Garabed Amadouni (died)
Amathus in Palæstina 1967.12.23 Bishop Hugo Mark Gerbermann, M.M. (transferred)
Amblada 1967.12.02 Bishop Eldon Bernard Mathias Schuster (transferred)
Amida (Syrian Rite) 1989.11.30 Archbishop Flavien Zacharie Melki (died)
Amida (Armenian Rite) 1986.06.30 Bishop Grégoire Ghabroyan, I.C.P.B. (79)Bishop Grégoire Ghabroyan, I.C.P.B. (79) (transferred)
Amisus 1978.02.18 Bishop Cornelius de Wit, M.H.M. (resigned)
Ammoniace 1983.01.24 Bishop Luis María Blas Maestu Ojanguren, O.F.M. (died)
Amorium 1970.08.05 Archbishop Giovanni C. Luigi Marinoni, O.F.M. Cap. (died)
Amphipolis 1981.04.20 Bishop Edward Vincent Dargin (died)
Amyzon 1980.01.12 Bishop Antonin Fishta, O.F.M. (died)
Anæa 1984.08.14 Bishop Giovanni Picco (died)
Anasartha 1969.11.02 Archbishop Serafim Gomes Jardim da Silva (died)
Anastasiopolis 1970.12.20 Bishop Roberto Benardino Berríos Gaínza, O.F.M. (resigned)
Anatetarte 1933
Anazarbus 1964.07.31 Archbishop Joseph-Marie Le Gouaze (died)
Anchialus 1965.09.26 Archbishop Giacinto Giovanni Ambrosi, O.F.M. Cap. (died)
Ancyra 1976.05.24 Cardinal Opilio Rossi (transferred)
Ancyra (Armenian Rite) 2002.09.09 Bishop Mikail Nersès Sétian (died)
Ancyra ferrea 1933
Andeda 1997.04.18 Bishop Vincent-Marie Favé (died)
Andrapa 1966.12.09 Archbishop John Francis Whealon (transferred)
Anemurium 1966.06.18 Bishop Ottone Raible, S.A.C. (died)
Anineta 1973.02.16 Bishop Paweł Latusek (died)
Antandrus 1966.12.30 Bishop Léon-Arthur-Auguste Elchinger (transferred)
Antæopolis 1978.11.09 Bishop Ubaldo Teofano Stella, O.C.D. (died)
Anthedon 1965.02.24 Bishop Felix Roeder (died)
Antinoë 1999.12.18 Cardinal Varkey Vithayathil, C.SS.R. (transferred)
Antiochia ad Mæandrum 1973.03.11 Bishop Edward L. Fedders, M.M. (died)
Antiochia in Pisidia 1976.05.24 Cardinal Corrado Bafile (transferred)
Antiochia parva 1964.04.11 Bishop André-Jean-Marie Charles de la Brousse (transferred)
Antipatris ? Bishop Francis Liu Jin-wen (Liu Chiu-wen) (劉錦文) (resigned)
Antiphellus 1967.08.28 Bishop Jean-Marie Aubin, S.M. (died)
Antiphræ 1965.09.15 Archbishop John Joseph Maguire (transferred)
Antipyrgos 1969.03.06 Bishop Myles McKeon (95)Bishop Myles McKeon (95) (transferred)
Ænus 1971.06.06 Archbishop Louis Morel, C.I.C.M. (穆清海) (died)
Apamea Cibotus 1975.06.13 Bishop Eustace John Smith, O.F.M. (died)
Apamea in Bithynia 1933
Apamea in Syria 1974.02.28 Archbishop Eris Norman Michael O’Brien (died)
Apamea in Syria (Maronite Rite) 1999.06.05 Bishop Paul-Emile Saadé (80)Bishop Paul-Emile Saadé (80) (transferred)
Apamea in Syria (Syrian Rite) 1982.08.11 Archbishop Clément Ignace Mansourati (died)
Apamea in Syria (Greek-Melkite Rite) 2006.11.17 Archbishop Jean Mansour, M.S.P. (died)
Aperlæ 1967.03.12 Bishop Felicissimus Alphonse Raeymaeckers, O.F.M. Cap. (transferred)
Aphnæum 1997.04.15 Bishop Gregorio Espiga e Infante, O.A.R. (died)
Aphroditopolis ?
Apollonia Salbace 1933
Apollonias 1968.02.09 Bishop Enrico Petrilli (died)
Apollonis 2009.04.16 Bishop Michel Louis Marie Joseph Mondésert (died)
Apollonopolis magna 1933
Apollonopolis parva 1933
Apollonos-Hieron 1933
Appia 1982.12.17 Bishop Athanasios Abadir (transferred)
Aprus 1952.01.14 Archbishop Philip Francis Pocock (transferred)
Arabia 1933
Arabissus 1973.04.27 Bishop Peter Francis Rayappa (died)
Arad 1969.04.25 Bishop Vicente Roig y Villalba, O.F.M. Cap. (transferred)
Araxa 1989.04.13 Bishop Philip Joseph Furlong (died)
Arca in Armenia 1987.12.03 Bishop Salvador Martinez Aguirre, S.J. (died)
Arca in Pheonicia 1981.01.17 Bishop Hugo Aufderbeck (died)
Arcadia 1965.01.17 Bishop Giuseppe Almici (transferred)
Arcadiopolis in Asi 1977.09.20 Bishop Basil Harry Losten (83)Bishop Basil Harry Losten (83) (transferred)
Arcadiopolis in Europa 1968.10.24 Archbishop Auguste-Siméon Colas, M.E.P. (died)
Archelaïs 1968.06.09 Bishop Antonio María Michelato Danese, O.S.M. (died)
Ardamerium 1933
Areopolis 1965.05.09 Bishop René-Noël-Joseph Kérautret (transferred)
Arethusa 1986.04.28 Bishop Sebastian Mankuzhikary (transferred)
Arethusa (Syrian Rite) 1996.05.25 Archbishop Flavien Joseph Melki (82)Archbishop Flavien Joseph Melki (82) (transferred)
Argos 1973.02.02 Bishop Oreste Rauzi (died)
Ariarathia ?
Ariassus 1968.04.26 Bishop Ignacio María de Orbegozo y Goicoechea (transferred)
Aristium 1945.05 Bishop Josip Marija Carevic (died)
Arneæ 1970.10.13 Bishop Patrice Flynn (died)
Arsamosata 1977.12.30 Bishop Tomás Roberto Manning, O.F.M. (resigned)
Arsinoë in Arcadia 1999.05.23 Bishop Jerônimo Mazzarotto (died)
Arsinoë in Cypro 2012.06.26 Bishop Angelo Cuniberti, I.M.C. (died)
Artvin (Armenian Rite) 1972
Arycanda 2001.02.15 Bishop Benito Epifanio Rodríguez (died)
Ascalon 1966.06.21 Archbishop Paul-Laurent-Jean-Louis Mazé, SS.CC. (transferred)
Aspendus 1967.07.13 Bishop John Fergus O’Grady, O.M.I. (transferred)
Aspona 1978.08.12 Bishop Carlo Re, I.M.C. (died)
Assus 1995.10.09 Bishop Zygfryd Wincenty Kowalski (died)
Astypalæa 1980.04.24 Bishop James Buis, M.H.M. (died)
Atenia 1989.05.29 Bishop Gauthier Pierre Georges Antoine Dubois, O.F.M. Cap. (died)
Ath Truim 2009.04.15 Bishop Gregory O’Kelly, S.J. (72)Bishop Gregory O’Kelly, S.J. (72) (transferred)
Athribis 1968.05.24 Bishop Henryk Grzondziel (died)
Athyra 1964.11.25 Bishop Louis Nganga a Ndzando (transferred)
Attæa 1967.03.10 Bishop Vitale Bonifacio Bertoli, O.F.M. (died)
Attalea in Lydia 1933
Attalea in Pamphylia 1966.06.21 Archbishop George Hamilton Pearce, S.M. (93)Archbishop George Hamilton Pearce, S.M. (93) (transferred)
Attanasus 1964.07.07 Cardinal Joseph Albert Malula (transferred)
Attuda 1964.06.22 Archbishop Antônio Ferreira de Macedo, C.SS.R. (transferred)
Augusta 1979.05.12 Bishop Antonio Rocca (died)
Augustopolis in Palæstina 1933
Augustopolis in Phrygia 1968.06.11 Bishop Justin Abraham Najmy, B.A. (died)
Aulon 1998.07.28 Bishop Manuel Augusto Cárdenas (died)
Aureliopolis in Asia 1968.04.06 Bishop Alfonso Uribe Jaramillo (transferred)
Aureliopolis in Lydia 2004.12.30 Archbishop Salvatore Asta (died)
Aurocla 1933
Axomis 1967.12.02 Bishop Joseph Bernard Brunini (transferred)
Æzani 1969 Bishop Marcello Rosina (transferred)
Azotus 1951.01.08 Bishop Thomas Tharayil (transferred)
Babylon 1651.04.05 Bishop Timoteo Pérez Vargas, O.C.D. (died)
Bacatha in Arabia 1933
Bacatha in Palestina 1933
Balanea 1994.12.09 Bishop Edward Francis Joseph Schlotterback, O.S.F.S. (died)
Balbura 1969.03.06 Bishop Placidus Gervasius Nkalanga, O.S.B. (94)Bishop Placidus Gervasius Nkalanga, O.S.B. (94) (transferred)
Barata 1975.01.07 Bishop Mihály Endrey-Eipel (transferred)
Barbalissus 1969.01.30 Bishop Thomas James Wade, S.M. (died)
Barca 2003.03.21 Bishop Andraos Salama (transferred)
Barcusus 1996.12.16 Bishop Lawrence Ephraem Thottam (transferred)
Bareta 2013.01.18 Bishop Hlib Borys Sviatoslav Lonchyna, M.S.U. (60)Bishop Hlib Borys Sviatoslav Lonchyna, M.S.U. (60) (transferred)
Bargala 1959.05.07 Bishop Joseph-Jean-Yves Marcadé (died)
Bargylia 1963.08.13 Bishop Jean Ghislain Delcuve, O.F.M. Cap. (died)
Baris in Hellesponto 1990.11.22 Bishop Walenty Wójcik (died)
Baris in Pisidia 1967.01.10 Bishop António Cardoso Cunha (transferred)
Basilinoplis 1973.09.18 Bishop Alexandre Poncet, S.M. (died)
Batnæ 1974.07.11 Bishop Simeon Kokov (Kokoff), O.F.M. Cap. (died)
Belabitene 1966.11.15 Archbishop George Elmer Bernarding, S.V.D. (transferred)
Berenice 1968.10.27 Bishop Antonius Hofmann (transferred)
Berissa 1966.11.15 Archbishop Herman Tillemans, M.S.C. (transferred)
Berœa 1971.01.20 Archbishop Felipe Santiago Hermosa y Sarmiento (resigned)
Beroë 1974.07.16 Archbishop Domenico Picchinenna (transferred)
Berrhœa 1993.09.26 Bishop Federico Kaiser Depel, M.S.C. (died)
Bethleem 1987.07.17 Bishop Lois-Séverin Haller, C.R.A. (died)
Bethzabda 1933
Binda 2003.07.03 Archbishop Gaetano Alibrandi (died)
Birtha 1977.11.03 Bishop Carlos Arturo Mullín Nocetti, S.J. (transferred)
Bitylius 1981.11.09 Archbishop Marcelo Pinto Carvalhera, O.S.B. (85)Archbishop Marcelo Pinto Carvalhera, O.S.B. (85) (transferred)
Bizya 1970.12.10 Archbishop Frédéric Edouard Camille Lamy (resigned)
Blaundus 1971.01.31 Bishop Victor-Jean Perrin (died)
Bonitza 1984.12.18 Bishop Tadeusz Etter (died)
Boreum 1990.05.04 Bishop Sinforiano Lucas Rojo, O.M.I. (died)
Bosana 1992.04.23 Bishop Vincentas Brizgys (died)
Bosporus 1965.01.17 Cardinal Jean-Marie Villot (transferred)
Bostra 1971 Archbishop Iwannis Georges Stété (resigned)
Botrys 1967.06.12 Bishop Edward Wilson Douglas (died)
Bria 1996.06.15 Bishop John James Ward (transferred)
Briançonnet 2009.02.09
Bruzus 1969.08.20 Archbishop Josip Pavlišić (transferred)
Brysis 1967.11.05 Archbishop Pedro Maria Rodríguez Andrade (died)
Bubastis 1978.05.26 Bishop Camillo Faresin, S.D.B. (resigned)
Bubon 1933
Bulgarophygum 1933
Butus 1977.06.27 Cardinal František Tomášek (transferred)
Bycellus 1993.04.20 Bishop Mykhajlo Sabryha, C.SS.R. (transferred)
Cabasa 1973.08.24 Bishop David Francis Hickey, S.J. (died)
Cadi 2009.09.21 Archbishop Miroslav Stefan Marusyn (died)
Cadossia 2000.08.03 Bishop Antoon Demets, C.SS.R. (died)
Caffa 1978.03.10 Bishop Efraím Basílio Krevey, O.S.B.M. (transferred)
Callipolis 1992.06.16 Bishop Bernard Schilling, S.V.D. (died)
Calœ 1970.06.26 Bishop Matteo Aloisio Niedhammer y Yaeckle, O.F.M. Cap. (died)
Calydon 1973.12.14 Bishop Johannes Baptist Neuhäusler (died)
Calynda 1971.06.04 Bishop Warren Louis Boudreaux (transferred)
Camachus 1974.10.30 Archbishop Mesrop Habozian (died)
Campania 1965.06.12 Bishop Jorge Carlos Carreras (transferred)
Camuliana 1970.06.13 Bishop Piotr Dudziec (died)
Cana 1970.11.25 Patriarch Giacomo Giuseppe Beltritti (transferred)
Candyba 1966.10.20 Bishop Gerald Francis O’Keefe (transferred)
Capitolias 1992.04.23 Bishop José Thurler (died)
Carallia 1981.01.17 Archbishop Louis Joseph Cabana, M. Afr. (died)
Carcabia 2013.01.19 Bishop Borys Andrij Gudziak (53)Bishop Borys Andrij Gudziak (53) (transferred)
Cardabuntha 1933
Cardicium 1969.04.25 Bishop Eloy Tato Losada, I.E.M.E. (90)Bishop Eloy Tato Losada, I.E.M.E. (90) (transferred)
Carpasia 1965.02.22 Cardinal Enrico Dante (transferred)
Carpathus 1979.01.15 Archbishop Jean-Baptiste Urrutia, M.E.P. (died)
Carpentras 2009.02.09
Carrhæ 1965.03.27 Bishop Joseph Louis André Ouellette (transferred)
Cartagine 1979.06.30 Cardinal Agostino Casaroli (transferred)
Carystus 1966.04.21 Bishop Johannes Lenhardt (died)
Casæ in Pamphylia 1997.11.07 Bishop Mychajlo Koltun, C.SS.R. (65)Bishop Mychajlo Koltun, C.SS.R. (65) (transferred)
Cæsaropolis 1990.03.14 Cardinal Alexandru Todea (transferred)
Casius 1966.01.15 Bishop Renatus Lwamosa Butibubage (transferred)
Cassandria 1987.07.25 Bishop Georges-Stanislas-Jean Béjot (died)
Castoria 1971.04.22 Bishop Stanislas Courbe (died)
Caunas 1972.09.17 Bishop Angelo Barbisotti, F.S.C.J. (died)
Cea 1966.03.04 Bishop Lawrence Bernard Brennan Casey (transferred)
Celano 2009.01
Celenderis 1964.02.14 Bishop Petras Mazelis (transferred)
Cell Ausaille 2014.02.25 Bishop Donal McKeown (63)Bishop Donal McKeown (63) (transferred)
Cephas 1974.05.05 Archbishop Kuriakose Kunnacherry (85)Archbishop Kuriakose Kunnacherry (85) (transferred)
Cerasa 2001.05.02 Bishop Réginald-André-Paulin-Edmond Jacq, O.P. (died)
Cerasus 1965.03.21 Archbishop Arturo Antonio Szymanski Ramírez (92)Archbishop Arturo Antonio Szymanski Ramírez (92) (transferred)
Cerenza 2014.02.10 Bishop Pere Tena Garriga (died)
Ceretapa 1933
Cernitza 1973.02.01 Bishop Fidel Mario Tubino Mongilardi (died)
Cerynia 1976.12.29 Bishop Joseph Zimmermann (died)
Cesarea in Bithynia 1982.01.05 Bishop Secondo Chiocca (died)
Cesarea in Cappadocia 1973.03.05 Cardinal Pietro Palazzini (transferred)
Cesarea in Cappadocia (Greek-Melkite Rite) 1984.09.01 Archbishop Michel Hakim (resigned)
Cesarea in Palæstina 1967.06.26 Cardinal Dino Staffa (transferred)
Cesarea in Thessalia 1980.10.27 Bishop Paolo Savino (died)
Cestrus 1967.04.28 Bishop Edoardo Bresson, S.M. (died)
Chalcedon 1967.06.26 Cardinal Angelo Dell’Acqua, O.Ss.C.A. (transferred)
Chalcedon (Syrian Rite) 1958.07.04 Archbishop Clément Michel Bakhache (died)
Chalcis in Europa 1891.03.11 Archbishop Luís Antônio dos Santos (died)
Chalcis in Græcia 1966.11.26 Bishop Gallus Steiger, O.S.B. (died)
Chalcis in Syria 1968.09.19 Archbishop Antônio Maria Alves de Siqueira (transferred)
Charac-Moba 1933
Chariopolis 1970.09.11 Bishop Timoteo Giorgio Raymundos, O.F.M. Cap. (died)
Chayal (Syro-Malankar Rite) 2003.09.11 Cardinal Baselios Cleemis Thottunkal (54)Cardinal Baselios Cleemis Thottunkal (Baselios Cleemis Thottunkal) (54) (transferred)
Chersonesus in Creta 1989.12.21 Archbishop Karel Otčenášek (transferred)
Chersonesus in Europa 1965.12.04 Archbishop Felipe Santiago Benítez Avalos (transferred)
Chersonesus in Zechia 1976.07.03 Patriarch Hemaiag Bédros XVII Guédiguian (Hemaiagh Guédiguian, C.A.M.) (resigned)
Chiemsee 2009.01
Choma 1978.09.22 Bishop Joseph Arthur Costello (died)
Chonochora 1996.11.11 Bishop Joseph Khoury (77)Bishop Joseph Khoury (77) (transferred)
Christianopolis 1974.02.02 Bishop Imre Kisberk (transferred)
Christopolis 1984.03.31 Archbishop Sante Portalupi (died)
Chrysopolis in Arabia 1935.02.07 Bishop Pierre-Jean-Marie Gendreau, M.E.P. (died)
Chrysopolis in Macedonia 1987.12.27 Bishop Florencio Sanz Esparza, C.M. (died)
Chytri 1966.05.20 Bishop Miguel Nóvoa Fuente (died)
Cibyra 1965.07.06 Archbishop Clemens P. Chabukasansha (transferred)
Cidramus 1970.03.31 Bishop Anastasio Granados García (transferred)
Cidyessus 1965.12.18 Bishop Claude-Philippe Bayet, M.E.P. (transferred)
Cinna 1968.10.29 Bishop Matteo Múgica y Urrestarazu (died)
Cinnaborium 1933
Ciparissia 1969.04.26 Bishop Gregorio Garavito Jiménez, S.M.M. (95)Bishop Gregorio Garavito Jiménez, S.M.M. (95) (transferred)
Circesium 1980.11.24 Bishop Giovanni Gazza (transferred)
Cisamus 1994.05.25 Bishop Nikollë Troshani (died)
Ciscissus 1933
Citharizum 1971.04.30 Bishop Pio Alberto Fariña Fariña (died)
Citrus 1965.07.09 Bishop Adolph Marx (transferred)
Cius 1964.03.11 Archbishop Martin Michael Johnson (transferred)
Claneus 1968.01.31 Bishop George Henry Speltz (transferred)
Claudiopolis in Honoriade 2000.03.26 Archbishop Alfredo Bruniera (died)
Claudiopolis in Isauria 1969.06.14 Archbishop Emanuele Clarizio (transferred)
Clazomenæ 1966.08.26 Bishop Robert Stephen Dehler, C.R. (died)
Cleopatris 1985.06.28 Bishop Youhanna Kabès (died)
Cluain Iraird 2012.02.20 Archbishop Timothy Costelloe, S.D.B. (60)Archbishop Timothy Costelloe, S.D.B. (60) (transferred)
Clysma 1991.06.05 Bishop Wladyslaw Jedruszuk (transferred)
Cnidus 1973.06.29 Bishop Jan Vos, M.H.M. (died)
Cnossus 1970.11.27 Bishop Georges-Léon Landry (resigned)
Codaca 1933
Codrula 1933
Cœla 1980.06.03 Bishop João Batista Marchesi, S.D.B. (died)
Colbasa 1964.07.05 Bishop Pasquale Bacile (transferred)
Colonia in Armenia (Armenian Rite) 1983.06.27 Archbishop Paul Coussa (transferred)
Colonia in Cappadocia 1970.12.10 Bishop Xavier Morilleau (resigned)
Colophon 1973.08.27 Bishop Juan Solá y Farrell, O.F.M. Cap. (died)
Colossæ 1965.02.22 Cardinal Cesare Zerba (transferred)
Colybrassus 1974.02.24 Bishop José del Perpetuo Socorro Alvarez Mácua, O.A.R. (died)
Comama 1911.01.14 Bishop Bernardo Pizzorno (transferred)
Comana Armeniæ 2010.04.13 Bishop André Bedoglouyan, I.C.P.B. (died)
Comana pontica 1969.01.31 Bishop Vicente Felicísimo Maya Guzmán (transferred)
Comba 1984.12.18 Bishop Tarcisius Henricus Josephus van Valenberg, O.F.M. Cap. (died)
Conana 1966.11.15 Bishop Firmin Martin Schmidt, O.F.M. Cap. (transferred)
Cone 1968.05.29 Bishop Clarence Edward Elwell (transferred)
Constantia in Arabia 1969.02.03 Bishop Oscar Joseph Joliet (died)
Constantia in Scythia 1965.08.15 Archbishop Vito Roberti (transferred)
Constantia in Thracia 1963.07.16 Cardinal Pierre Veuillot (transferred)
Constantina 1979.04.20 Bishop Josef Hiltl (died)
Coprithis 1933
Coptus 1967.02.17 Bishop Luis Alfredo Carvajal Rosales (transferred)
Coracesium 1970.06.22 Bishop Julián Luis Barni Spotti, O.F.M. (transferred)
Corada 1994.11.12 Bishop Augustinus Frotz (died)
Corinthus 2005.11.17 Archbishop Gennaro Verolino (died)
Corna 1969.12.12 Bishop Mattia Leonardo Trudone Brans, O.F.M. Cap. (died)
Corone 1971.09.23 Bishop Ildefonso Rea, O.S.B. (died)
Coronea 1967.08.04 Archbishop Milton Corrêa Pereira (transferred)
Coropissus 1991.12.16 Bishop Argimiro Alvaro García Rodríguez, O.F.M. Cap. (died)
Corycus 1967.10.27 Bishop Francesco Salis-Seewis (died)
Corydala 1965.08.18 Bishop Henry Joseph Thünemann, O.S.F.S. (died)
Cos 2004.06.30 Bishop Paul Heinrich Nordhues (died)
Cotenna 1986.03.20 Bishop John Joseph Dougherty (died)
Cotrada 1969.04.27 Archbishop Antonio José Jaramillo Tobón (died)
Cotyæum 1956.11.23 Archbishop Francis William Markall, S.J. (transferred)
Cratia 1985.01.20 Bishop Camilo Plácido Crous y Salichs, O.F.M. Cap. (died)
Cremna 1967.07.09 Bishop Belchior Joaquim da Silva Neto, C.M. (transferred)
Cucusus 1981.03.22 Bishop Constantino Gómez Villa, O.F.M. Cap. (died)
Curium 1984.08.21 Bishop Edward Joseph Maginn (died)
Cusæ 1982.05.13 Bishop Joseph Anthony Ferrario (transferred)
Cyanæ 1982.11.01 Bishop Vitus Zhang Zuo-heng (Chang Tso-huan), S.V.D. (張作恆) (died)
Cybistra 1965.02.03 Bishop Nicasio Balisa y Melero, O.A.R. (died)
Cyme 1994.02.09 Bishop Urbain-Marie Person, O.F.M. Cap. (died)
Cynopolis in Ægypto 1970.12.07 Bishop Joseph Gerald Holland, S.M.A. (resigned)
Cynopolis in Arcadia 1968.04.10 Bishop Jean-Marcel Rodié (died)
Cypsela 1969.04.20 Archbishop Johannes Petrus Huibers (died)
Cyrene 1983.02.19 Bishop Valérien Bélanger (died)
Cyrrhus 1966.11.22 Archbishop José Rafael Pulido Méndez (transferred)
Cyzicus 1974.11.23 Archbishop Manuel Marilla Ferreira da Silva (died)
Dadima 1981.01.30 Bishop József Winkler (died)
Dadybra 1933
Daldis 1977.05.06 Bishop Henry Theophilus Klonowski (died)
Dalisandus in Isauria 1964.02.07 Bishop Laureano Castán Lacoma (transferred)
Dalisandus in Pamphylia 2007.06.24 Bishop Rudolf Johannes Maria Koppmann, O.M.I. (died)
Damascus 1967.06.26 Cardinal Giuseppe Beltrami (transferred)
Danaba 1964.09.01 Archbishop Luis Mena Arroyo (transferred)
Daonium 1986.10.27 Bishop Jerzy Modzelewski (died)
Daphnusia 1967.04.24 Bishop Thaddeus Lê Hữu Từ, O. Cist. (died)
Daphnutium 1933
Dara 1971.08.10 Archbishop Nicholas Thomas Elko (transferred)
Dascylium 1978.01.17 Bishop Juliusz Bieniek (died)
Daulia 1972.06.28 Bishop Franciszek Jop (transferred)
Dausara 1969.12.26 Bishop Henri Martin Mekkelholt, S.C.I. (died)
Demetrias 1979.08.02 Bishop Francis Arthur Carvalho (died)
Denia 2014.04.02 Bishop Michael Pearse Lacey (died)
Derbe 1971.11.13 Bishop Raymond Peter Hillinger (died)
Dercos 1970.11.27 Archbishop Armand-Etienne M. Blanquet du Chayla, O.C.D. (died)
Diocæsarea in Isauria 1969.05.05 Archbishop Gino Paro (transferred)
Diocæsarea in Palæstina 1964.05.26 Bishop Simone Lorenzo Salvi, O.S.B. (died)
Dioclea 1985.01.12 Bishop Youannès Malak (died)
Diocletiana 2014.02.22 Cardinal Lorenzo Baldisseri (73)Cardinal Lorenzo Baldisseri (73) (transferred)
Diocletianoplis in Thebaide 1933
Diocletianoplis in Thracia 2006.05.12 Archbishop Metodi Dimitrov Stratiev, A.A. (died)
Diocletianopolis in Palæstina 1965.12.04 Bishop Aníbal Maricevich Fleitas (transferred)
Dionysias 1966.11.15 Archbishop Daniel Willem Stuyvenberg, S.M. (transferred)
Dionysiopolis 1983.01.28 Archbishop Jean-Édouard-Lucien Rupp (died)
Dioshieron 1933
Diospolis in Thracia 1966.08.29 Bishop Adriano Mandarino Hypólito, O.F.M. (transferred)
Diospolis inferior 1996.11.15 Bishop Paul-Maurice Choquet, C.S.C. (died)
Diospolis superior 2007.01.09 Bishop Nemesio Rivera Meza (died)
Diyum 1976.03.15 Bishop Irzio Luigi Magliacani, O.F.M. Cap. (died)
Doara 1980.11.25 Bishop Aleksander Moscicki (died)
Doberus 1971.08.05 Bishop Jan Fondaliński (died)
Docimium 1983.01.14 Bishop Wacław Majewski (died)
Dodona 1983.09.12 Bishop Josip Lach (died)
Doliche 1997.09.08 Bishop Miguel Saturnino Aurrecoechea Palacios, O.F.M. Cap. (died)
Dometiopolis 1965.11.13 Bishop István Zadravecz, O.F.M. (died)
Dora 1980.02.04 Bishop Rafael Torija de la Fuente (87)Bishop Rafael Torija de la Fuente (87) (transferred)
Dorostorum 1933
Dorylaëum 1972.12.06 Bishop Henri-Charles Dupont (died)
Dragobitia 1830.05.29 Bishop Thomas Scallan, O.F.M. (died)
Drivastum 2013.10.31 Archbishop Bruno Bertagna (died)
Drizipara 1967.11.23 Archbishop Theotonius Amal Ganguly, C.S.C. (transferred)
Druas 2014.03.26 Bishop Wolfgang Kirchgässner (died)
Dystis 1986.03.06 Archbishop Emilio de Brigard Ortiz (died)
Ecdaumava 1933
Echinus 1966.11.15 Archbishop Eugène Klein, M.S.C. (transferred)
Ecsalus 1933
Edessa in Macedonia 1975.12.13 Bishop Hernando Antiporda (died)
Edessa in Osrhoëne 1969.10.28 Archbishop Luigi Centoz (died)
Edessa in Osrhoëne (Syrian Rite) 1993.10.15 Archbishop Grégoire Ephrem Jarjour (died)
Edessa in Osrhoëne (Greek-Melkite Rite) 2011.04.29 Archbishop Salim Ghazal, B.S. (died)
Elæa 1966.11.05 Bishop Heinrich Roleff (died)
Elatea 1981.05.26 Archbishop Dominic Deng Yi-ming (Tang Yee-ming), S.J. (鄧以明) (transferred)
Eleutherna 1969.05.11 Bishop Salomão Barbosa Ferraz (died)
Eleutheropolis in Macedonia 1933
Eleutheropolis in Palæstina 1966.11.15 Bishop Alfred Matthew Stemper, M.S.C. (transferred)
Elis 1987.05.23 Bishop Gellért Belon (died)
Elusa 1964.07.28 Bishop Joseph Basil Roper (died)
Eluza 1967.09.06 Archbishop Nivaldo Monte (transferred)
Ephesus 1992.05.22 Archbishop Giovanni Enrico Boccella, T.O.R. (died)
Epiphania in Cilicia 1971.09.29 Bishop Emiliano José Lonati, O.F.M. Cap. (died)
Epiphania in Syria 1990.09.29 Bishop Vladimiro Malanczuk, C.SS.R. (died)
Eressus 1997.09.26 Bishop José María Querejeta Mendizábal, C.M.F. (died)
Eriza 1961.07.11 Bishop Octave-Louis Pasquet (died)
Erra 1933
Erythræ 1964.07.07 Bishop Demetrio Mansilla Reoyo (transferred)
Erythrum 1969.01.22 Bishop Ghebre Jesus Jacob (died)
Esbus 1970.11.22 Bishop Joseph-Georges-Arthur Melançon (resigned)
Etenna 1964.08.28 Bishop Thomas Holland (transferred)
Euaza 1933
Eucarpia 1978.03.20 Bishop Estêvão Cardoso de Avellar, O.P. (transferred)
Euchaitæ 1972.06.28 Cardinal Bolesław Kominek (transferred)
Eudocia 1999.02.03 Bishop Jan Czerniak (died)
Eudocias 1933
Eudoxias 1994.11.16 Bishop Raul Silva Silva (died)
Eumenia 2001.12.20 Bishop Theodorus Gerardus Antonius Hendriksen (died)
Eurœa in Epiro 1965.08.03 Archbishop Alfonso Niehues (transferred)
Eurœa in Phœnicia 1976.01.14 Bishop Edoardo Piana Agostinetti (died)
Europus 1948.05.13 Bishop Daniel Ivancho (transferred)
Eutyme 1966.03.06 Bishop Jean-Barthélemy-Marie de Cambourg (transferred)
Ezerus 1957.07.06 Bishop Antonio Sévat, C.M. (died)
Famagusta 1974.04.01 Archbishop Giuseppe Schiavini (died)
Faustinopolis 1973.03.16 Bishop Bernard Czapliński (transferred)
Flavias 1969.08.20 Archbishop Marijan Oblak (transferred)
Furnos minor 2014.04.08 Bishop William Terrence McGrattan (57)Bishop William Terrence McGrattan (57) (transferred)
Gabæ 1996.05.14 Bishop Hanna Kaldany (died)
Gabula 1980.10.10 Archbishop Francis Carroll, S.M.A. (died)
Gadara 1973.10.31 Bishop Jean Cassaigne, M.E.P. (died)
Gangra 1989.02.28 Archbishop Antônio Ferreira de Macedo, C.SS.R. (died)
Garella 1972.03.25 Archbishop Francisco Javier Nuño y Guerrero (transferred)
Gargara 1964.02.12 Archbishop Gabriel Ganni (transferred)
Garin (Armenian Rite) 1972
Gaza 1964.02.24 Bishop James Henry Ambrose Griffiths (died)
Gazera 1985.09.04 Bishop Angel Rodríguez Gamoneda, O.S.A. (died)
Gerara 1956.08.04 Bishop Henri-Louis-Toussaint Vion (transferred)
Geras 1977.07.04 Bishop John Michael Fearns (died)
Gerasa 2011.06.15 Bishop Nicholas James Samra (69)Bishop Nicholas James Samra (69) (transferred)
Germa in Hellesponto 1966.02.24 Archbishop Lorenzo Gargiulo (transferred)
Germania in Dacia 1978.03.31 Bishop Dante Carlos Sandrelli (transferred)
Germanicia 1914.01.02 Bishop Everhard Illigens (died)
Germanicopolis 1968.02.24 Bishop Lionello Berti, O.M.I. (died)
Germia 1967.06.29 Cardinal Alfredo Pacini (transferred)
Gindarus 1965.12.18 Bishop Simon N’Zita Wa Ne Malanda (transferred)
Giustinianopolis in Galatia 1982.05.12 Archbishop Carmine Rocco (died)
Gomphi 1976.08.02 Bishop Valeriano Ludovico Arroyo Paniego, O.F.M. (died)
Gordoserba 1933
Gortyna 1987.01.12 Archbishop Victor Frederick Foley, S.M. (died)
Hadriani ad Olympum 1997.02.03 Bishop Aristide Pirovano, P.I.M.E. (died)
Hadrianopolis in Eprio 1964.04.10 Bishop Josef Freusberg (died)
Hadrianopolis in Honoriade 1985.02.11 Bishop Joseph Maria Pernicone (died)
Hadrianopolis in Pisidia 1970.12.20 Bishop Filemón Castellano (resigned)
Hadrianotheræ 1997.12.25 Archbishop Bronisław Dabrowski, F.D.P. (died)
Halicarnassus 1970.05.16 Bishop Bernard James Sullivan, S.J. (died)
Hardiania 1981.11.21 Archbishop Gennaro Maria Prata Vuolo, S.D.B. (transferred)
Hardianopolis in Hæmimonto 1997.10.25 Archbishop Lino Zanini (died)
Harpasa 1969.12.06 Bishop Stanislav Zela (died)
Hebron 1968.09.15 Bishop Pedro Massa, S.D.B. (died)
Helenopolis in Bithynia 1967.02.06 Bishop Wojciech Tomaka (died)
Helenopolis in Palæstina 1990.05.30 Bishop John Francis Hackett (died)
Heliopolis in Augustamnica 1935.11.26 Archbishop Gerald Patrick Aloysius O’Hara (transferred)
Heliopolis in Phœnicia 1965.08.23 Archbishop Ottavio De Liva (died)
Heliosebaste 1972.07.01 Bishop Florentino de Andrade e Silva (transferred)
Helos 1996.05.24 Bishop Joaquín Carmelo Borobia Isasa (78)Bishop Joaquín Carmelo Borobia Isasa (78) (transferred)
Hemeria 1957.02.03 Bishop Augusto Gianfranceschi (transferred)
Hemesa 1970.10.12 Archbishop Joseph Francis McGeough (died)
Hephæstus 1977.11.25 Bishop André-Gustave-Émile Leclerc (died)
Heraclea ad Latnum 1705.12.14 Bishop Kazimierz Łubieński (transferred)
Heraclea in Europa 1986.04.04 Archbishop Mario Cagna (died)
Heraclea Pelagoniæ 1933
Heraclea Salbace 1933
Heracleopolis magna 1973.03.05 Cardinal Paul-Pierre Philippe, O.P. (transferred)
Hermocapelia 1933
Hermonthis 2003.11.16 Bishop Augustine Eugene Hornyak, O.S.B.M. (died)
Hermopolis parva 1968.10.18 Cardinal James Darcy Freeman (transferred)
Hexamilium 1933
Hierapolis in Isauria 1976.01.16 Bishop José Alberto Lopes de Castro Pinto (transferred)
Hierapolis in Phrygia 1969.04.10 Archbishop Lorenzo Maria Balconi, P.I.M.E. (巴明善) (died)
Hierapolis in Syria 1982.08.20 Archbishop Antonio del Giudice (died)
Hierapolis in Syria (Syrian Rite) 1991.10.04 Archbishop Clément Georges Schelhoth (died)
Hierapolis in Syria (Greek-Melkite Rite) 1962.03.19 Cardinal Gabriel Acacius Coussa, B.A. (transferred)
Hierapytna 1970.12.11 Bishop Santos Moro Briz (resigned)
Hierissus 1974.12.24 Bishop Teodoro Eugenín Barrientos, SS.CC. (died)
Hierocæsarea 1994.12.31 Bishop Ernesto de Paula (died)
Hieropolis 1970.03.07 Archbishop Youhannan Semaan Issayi (transferred)
Hippos 1945.10.23 Bishop Nicanor Roberto Aguirre Baus (transferred)
Homona 1933
Hyda in Lycaonia 1933
Hyllarima 1964.01.17 Bishop Stefan Barela (transferred)
Hypæpa 1946.04.11 Bishop Raymond Aloysius Lane, M.M. (林化東) (transferred)
Hypselis 1997.07.14 Bishop Jesús Serrano Pastor, C.M.F. (died)
Hyrcanis 1933
Iabruda 1956.05.17 Bishop Henri Friteau, C.S.Sp. (died)
Iamnia 1965.03.16 Bishop Thomas Asagoro Wakida (トマ脇田浅五郎) (died)
Iasus 1939 Bishop Antonio Laubitz (resigned)
Ibora 1973.12.31 Bishop Vincent Victor Dereere, O.C.D. (died)
Iconium 1973.03.05 Cardinal Sergio Pignedoli (transferred)
Idebessus 1967.11.29 Bishop Baptist Mudartha (transferred)
Ilistra ?
Ilium 1968.02.07 Bishop Francesco Maria Franco (died)
Illiberi 2014.03.07 Bishop Cristián Contreras Villarroel (54)Bishop Cristián Contreras Villarroel (54) (transferred)
Ingila 1966.06.07 Bishop Armand Coupel (died)
Inis Cathaig 2013.07.31 Bishop Frank Joseph Caggiano (55)Bishop Frank Joseph Caggiano (55) (transferred)
Ioannina 1967.05.29 Bishop Glennon Patrick Flavin (transferred)
Ionopolis 1966.08.12 Bishop Hubert Joseph Paulissen, S.M.A. (died)
Ioppe 1965.10.14 Bishop Apollinaris William Baumgartner, O.F.M. Cap. (アポリナリス・バウムガートナー) (transferred)
Ios 1965.11.10 Bishop Michel Blecharczyk (died)
Iotapa in Isauria 1933
Iotapa in Palestina 1933
Ipsus 1950.04.01 Bishop Leo Fabiano Fahey (died)
Irenopolis in Cilicia 1975.07.04 Bishop Gaetano Michetti (transferred)
Irenopolis in Isauria 1971.05.11 Bishop George Alapatt (resigned)
Isauropolis 1971.03.30 Archbishop Philip Francis Pocock (transferred)
Isba 1966.10.03 Bishop Lionel Scheffer, O.M.I. (died)
Isinda 1994.10.24 Bishop Joseph William Regan, M.M. (died)
Iuliopolis 1981.07.16 Bishop Ioan Duma, O.F.M. Conv. (died)
Kaškar (Chaldean Rite) 2003.12.03 Cardinal Emmanuel III Delly (86)Cardinal Emmanuel III Delly (Emmanuel-Karim Delly) (86) (transferred)
Kearney 2013.12.18 Bishop Robert Peter Deeley (67)Bishop Robert Peter Deeley (67) (transferred)
Kharput (Armenian Rite) 1972
Knin 2013.11.14 Archbishop Sebastian Francis Shaw, O.F.M. (56)Archbishop Sebastian Francis Shaw, O.F.M. (56) (transferred)
Lacedæmonia 1967.04.27 Bishop José de Jesús Garcia Ayala (transferred)
Lagania 1971.02.23 Bishop Xavier Geeraerts, M. Afr. (died)
Lagina 1970.05.21 Bishop León Angel Olano y Urteaga, O.F.M. Cap. (died)
Lamia 1982.11.15 Bishop Henry Byrne, S.S.C.M.E. (transferred)
Lampsacus 1970.08.04 Bishop David Frederick Cunningham (transferred)
Lamus 1967.06.12 Bishop Sisto Mazzoldi, M.C.C.I. (transferred)
Laodicea ad Libanum 2012.08.21 Bishop Paul Bassim, O.C.D. (died)
Laodicea combusta 1933
Laodicea in Phrygia 1968.06.25 Archbishop Émile André Jean-Marie Maury (transferred)
Laodicea in Syria 1986.12.01 Archbishop Martin John O’Connor (died)
Lapithus 1933
Lappa 1973.07.22 Bishop Carlos de la Trinidad Borge y Castrillo (died)
Laranda 1965.01.06 Bishop Walfrido Teixeira Vieira (transferred)
Larissa in Syria 1987.09.09 Bishop Bonaventure Akiki, O.F.M. (died)
Larissa in Thessalia 1980.03.09 Archbishop Giuseppe Mojoli (died)
Lastaura in Lycia 1933
Latopolis 1964.12.12 Bishop Ernest Leo Unterkoefler (transferred)
Lauzadus 1964.03.25 Archbishop Vicente Angelo José Marchetti Zioni (transferred)
Lebedus 2000.01.17 Bishop Vasile Cristea, A.A. (died)
Lebessus 1968.01.16 Bishop Karmelo Zazinović (transferred)
Lemnus 1976.01.23 Archbishop François-Marie-Joseph Poirier (died)
Leontopolis in Augustamnica 1970.11.30 Archbishop Cornelius Bronsveld, M. Afr. (resigned)
Leotopolis in Pamphylia 1972.09.19 Archbishop Giuseppe D’Avack (resigned)
Lerus 1985.05.25 Cardinal Luigi Dadaglio (transferred)
Letopolis 1967.03.20 Bishop Jan Jaroszewicz (transferred)
Leucas 1974.09.21 Archbishop Ivan Bucko (died)
Leuce 1987.03.26 Bishop Vasile Louis Puscas (transferred)
Lidoricium 1933
Limnæ 1968.06.10 Bishop Francis Anthony Marrocco (transferred)
Limyra 1999.11.08 Bishop Alfons Karl Kempf (died)
Linoë 1959.06.21 Bishop Alfredo Maria Obviar y Aranda (transferred)
Lipara 1963.07.13 Bishop Alfredo Galindo Mendoza, M.Sp.S. (transferred)
Lititza 1933
Litomyšl 2010.06.14 Bishop Jaroslav Škarvada (died)
Livias 1972.10.21 Bishop Francesco Tortora, O.M. (transferred)
Lizicus 1933
Loryma 1974.11.07 Bishop Vittorio Longo (died)
Lugura 2013.11.28 Bishop Max Georg von Twickel (died)
Lunda 1981.08.21 Bishop Luís António Palha Teixeira, O.P. (died)
Lupadium ?
Lycaonia 1965.05.15 Archbishop Henri-Martin-Félix Jenny (transferred)
Lyrbe 1965.12.01 Bishop Alexander Mieceslaus Zaleski (transferred)
Lysias 1969.08.02 Bishop Federico Sargolini (died)
Lysinia 2014.03.29 Bishop Tadeusz Pikus (64)Bishop Tadeusz Pikus (64) (transferred)
Lystra 1968.07.03 Bishop Enrique A. Angelelli Carletti (transferred)
Maastricht 2012.02.10 Bishop Marcos Aurelio Pérez Caicedo (46)Bishop Marcos Aurelio Pérez Caicedo (46) (transferred)
Macra 1997.09.18 Archbishop John Dooley, S.S.C.M.E. (died)
Madytus 1964.09.21 Archbishop Józef Gawlina (died)
Magnesia ad Mæandrum 1962.11.12 Bishop John of the Cross Anyogu (transferred)
Magnesia ad Sipylum 1933
Magydus 1975.03.21 Bishop Vunibaldo Godchard Talleur, O.F.M. (died)
Maillezais 2009.02.09
Maina 1963.08.31 Bishop Pierre-Francis-Lucien-Anatole Boillon (transferred)
Maiumas Gazæ 1933
Mallus 1990.02.12 Bishop Joseph Peter Michael Denning (died)
Malus 1933
Mæonia 1933
Marasc (Armenian Rite) 2006.03.15 Archbishop Kévork Khazoumian (79)Archbishop Kévork Khazoumian (79) (transferred)
Marciana 1971.10.28 Bishop Pierre Brot (died)
Marcianopolis 1997.09.29 Archbishop Volodymyr Sterniuk, C.SS.R. (died)
Marcopolis 1969.12.05 Bishop Jazeps Rancans (died)
Mardin (Chaldean Rite) 1972
Mareotes 2013.04.08 Bishop Botros Fahim Awad Hanna (52)Bishop Botros Fahim Awad Hanna (52) (transferred)
Marida 1965.12.14 Bishop Jean Hermil (transferred)
Marmarizana 1933
Maronea 1948.11.04 Bishop Filippo Perlo, I.M.C. (died)
Martyropolis 1967.11.15 Archbishop João Resende Costa, S.D.B. (transferred)
Masclianæ 2013.12.13 Fr. Carlos Alberto Novoa de Agustini, O.F.M. Cap. (resigned)
Massimianopolis in Arabia 1926.10.11 Bishop William F. O’Hare, S.J. (died)
Massimianopolis in Palæstina 1980.06.18 Bishop Auguste Grimault, C.S.Sp. (died)
Massimianopolis in Pamphylia 1933
Massimianopolis in Rhodope 1970.01.09 Archbishop Adam Hefter (died)
Massimianopolis in Thebaide 1933
Mastaura in Asia 1968.03.15 Bishop Edward Jan Muszynski (died)
Matrega 1994.03.07 Bishop Rafael González Estrada (died)
Maturba 2013.11.29 Bishop José Luís Gerardo Ponce de León, I.M.C. (52)Bishop José Luís Gerardo Ponce de León, I.M.C. (52) (transferred)
Maximianæ ?
Maxita 2014.04.04 Bishop Michel Aupetit (63)Bishop Michel Aupetit (63) (transferred)
Medea 1982.08.17 Bishop Stephen Joseph Donahue (died)
Medianas Zabuniorum 1933
Megalopolis in Peloponneso 1933
Megara 1969.03.18 Bishop Charles A. Vanuytven, O. Praem. (died)
Mela 1975.09.28 Bishop Lucjan Bernacki (died)
Melitene 1967.04.13 Cardinal James Robert Knox (transferred)
Melitene (Armenian Rite) 2013.02.02 Bishop Jean Teyrouz, I.C.P.B. (72)Bishop Jean Teyrouz, I.C.P.B. (72) (transferred)
Meloë in Isauria 1964.09.26 Bishop Paulus Rusch (resigned)
Meloë in Lycia 1848.07.03 Bishop Girolamo Gavi (transferred)
Menelaites 1994.03.04 Bishop Octave-Marie Terrienne, M.S.C. (died)
Menois 1968.01.19 Bishop Vincent Gelat (died)
Merus 1933
Mesembria 2014.02.22 Cardinal Loris Francesco Capovilla (98)Cardinal Loris Francesco Capovilla (98) (transferred)
Mesotymolus 1933
Messene 1991.06.28 Cardinal Fiorenzo Angelini (97)Cardinal Fiorenzo Angelini (97) (transferred)
Metaba 1933
Metelis 1973.05.23 Bishop Joseph Francis Flannelly (died)
Metellopolis 1971.08.21 Bishop Amedeo Polidori (died)
Methone 1968.04.19 Bishop Bertoldo Bühl, O.F.M. (died)
Methymna 1966.11.17 Archbishop Manuel Nuñes Gabriel (transferred)
Metræ 1995.03.20 Bishop Amadeu González Ferreiros, O. de M. (died)
Metropolis in Asia 1992.08.29 Bishop Juan de Dios López de Victoria (died)
Metropolis in Pisidia 1933
Midaëum 1979.04.15 Bishop Ernesto Çoba (died)
Midila 2014.02.22 Cardinal Beniamino Stella (72)Cardinal Beniamino Stella (72) (transferred)
Miletopolis 1968.12.08 Bishop Juan Ricote Alonso (transferred)
Miletus 1970.10.17 Cardinal Salvatore Pappalardo (transferred)
Misthia 1967.04.16 Archbishop René Graffin, C.S.Sp. (died)
Mitylene 1981.10.17 Archbishop Maurílio Jorge Quintal de Gouveia (81)Archbishop Maurílio Jorge Quintal de Gouveia (81) (transferred)
Mnizus 1933
Mocissus 1964.03.24 Archbishop Gabrijel Bukatko (transferred)
Modra 1968.12.09 Bishop Manoel Könner, S.V.D. (died)
Monembasia 1933
Mopsuestia 1963.08.03 Bishop Joseph Gotthardt, O.M.I. (died)
Mossyna 1975.05.01 Bishop Oscar Sevrin, S.J. (died)
Mostene 1964.11.26 Bishop Leo Isidore Scharmach, M.S.C. (died)
Mosynopolis 1966.11.15 Bishop Rudolf Joseph Manfred Staverman, O.F.M. (transferred)
Mundinitza 1966.11.15 Bishop Ignatius John Doggett, O.F.M. (transferred)
Musbanda 1933
Mush (Armenian Rite) 1972
Musti in Numidia 2009.11.28 Bishop Peter Štumpf, S.D.B. (51)Bishop Peter Štumpf, S.D.B. (51) (transferred)
Mylasa 1966.05.14 Bishop Peregrin de la Fuente Néstar, O.P. (died)
Myndus 1973.01.20 Archbishop Enrico Bartoletti (transferred)
Myra 1967.06.29 Cardinal Egidio Vagnozzi (transferred)
Myrica 1991.07.27 Bishop Maximiliano Spiller, C.S.I. (died)
Myrina 1984.09.11 Bishop Alfred-Jean-Félix Ancel, Ist. del Prado (died)
Nacolia 1973.05.02 Archbishop Joseph Rabbani (died)
Nasala 1933
Naucratis 1933
Naupactus 1977.09.25 Archbishop Roberto Ronca (died)
Nauplia 1995.09.18 Bishop Andrei Katkoff, M.I.C. (died)
Nazareth 1989 Archbishop Giuseppe Carata (resigned)
Nazianzus 1999.04.24 Bishop Miguel Mykycej, F.D.P. (79)Bishop Miguel Mykycej, F.D.P. (79) (transferred)
Nea Aule 1933
Nea Valentia 1933
Neapolis in Arabia ? Bishop Pedro Mirabal Ayllón (resigned)
Neapolis in Caria 1933
Neapolis in Cypro 1933
Neapolis in Isauria 1933
Neapolis in Palæstina 1988.06.28 Cardinal Jacques Martin (transferred)
Neapolis in Pisidia 1967.05.25 Archbishop Pietro Sigismondi (died)
Neila 1972.06.09 Bishop Róbert Pobožný (died)
Neocæsarea in Bithynia 1903.06.22 Archbishop Luigi Lazzareschi (transferred)
Neocæsarea in Ponto 1967.07.30 Archbishop Antonin-Fernand Drapier, O.P. (died)
Neocæsarea in Syria 1988.10.24 Bishop Marcel-Pierre-Armand Riopel (died)
Nephelis 1982.11.24 Bishop José Alfonso Tscherrig, C.SS.R. (died)
Neve 1963.09.09 Cardinal William John Conway (transferred)
Nicæa 1976.04.10 Archbishop Ilario Alcini (died)
Nicæa parva 1996.12.05 Archbishop Paolino Limongi (died)
Nicius 1970.12.01 Bishop Peter Rogan, M.H.M. (died)
Nicomedia 1969.04.28 Cardinal Paolo Bertoli (transferred)
Nicopolis ad Iaternum 1878.03.04 Bishop John MacDonald (transferred)
Nicopolis ad Nestum 1981.01.30 Archbishop John Gordon (died)
Nicopolis in Armenia 1944.03.02 Bishop Jules-Joseph Cénez, O.M.I. (died)
Nicopolis in Epiro 1971.06.11 Archbishop Joseph-Paul Strebler, S.M.A. (resigned)
Nicopsis 1966.10.12 Archbishop Juan C. Sison (transferred)
Nicosia 1990.04.30 Archbishop Aurelio Signora (died)
Nilopolis 1978.01.10 Archbishop Luis Sánchez-Moreno Lira (resigned)
Nisibis 1968.07.18 Archbishop José de la Cruz Turcios y Barahona, S.D.B. (died)
Nisibis (Maronite Rite) 1974.05.18 Archbishop Pietro Sfair (died)
Nisyrus 1969.08.08 Bishop Auguste Joseph Gaudel (died)
Novæ Patræ 1967.09.16 Archbishop Angelo Innocent Fernandes (transferred)
Nubia 2011.12.29 Archbishop Paul Antaki (died)
Numericus 1933
Nysia in Asia 1933
Nyssa 2012.10.07 Bishop Roman Danylak (died)
Oasis magna 1933
Oca 1933
Odessus 1970.10.07 Archbishop Xavier Ferdinand J. Thoyer, S.J. (died)
Olba 1992.09.18 Bishop Augustine Danglmayr (died)
Olbia 1978.05.26 Bishop Arcângelo Cerqua, P.I.M.E. (resigned)
Olena 1995.06.14 Bishop Clemente Geiger, C.PP.S. (died)
Olympus 1975.06.06 Bishop Segundo García Fernández, S.D.B. (died)
Ombi 1966.02.03 Archbishop António de Castro Xavier Monteiro (transferred)
Onchesmus 1933
Œnoanda 1965.12.18 Bishop Francis Xavier Sanguon Souvannasri (transferred)
Onuphis 1966.11.15 Bishop Francis John Doyle, M.S.C. (transferred)
Opus 1980.10.04 Bishop Lawrence-Patrick Whelan (died)
Orcistus 1967.07.13 Bishop Paul Piché, O.M.I. (transferred)
Oreus 1966.04.28 Archbishop Ildefonso Maria Sansierra Robla, O.F.M. Cap. (transferred)
Orisa 1992.05.19 Bishop Józef Kurpas (died)
Orthosia in Phœnicia 1964.02.07 Cardinal Narciso Jubany Arnau (transferred)
Orthosias in Caria 1911.03.23 Bishop Godfried Marschall (died)
Orymna 1933
Otrus 1995.04.22 Bishop Charles-Joseph Lemaire, M.E.P. (惠化民) (died)
Oxyrynchus 1966.01.04 Archbishop Juan Manoel González Arbeláez (died)
Pachnemunis 1965.12.21 Bishop Eusebio Septimio Mari, O.F.M. Cap. (died)
Palæopolis in Asia 1967.05.06 Cardinal Emmanuel III Delly (86)Cardinal Emmanuel III Delly (Emmanuel-Karim Delly) (86) (transferred)
Palæopolis in Pamphylia 1985.04.25 Bishop Ioan Dragomir (died)
Palmyra 1983.03.02 Bishop Giuseppe Rossi (died)
Paltus 1967.07.15 Cardinal Maximilien de Fürstenberg (resigned)
Pamphilus 1933
Panemotichus 1976.11.12 Bishop John Zhang Bi-de (張弼德) (died)
Panephysis 1933
Panopolis 1968.12.26 Bishop Zygmunt Choromański (died)
Paphus 1973.08.14 Bishop Jeremiah Francis Minihan (died)
Pappa 1933
Paralus 1972.06.23 Bishop Johannes Olav Smit (died)
Parætonium 1964.02.11 Bishop Frans Joseph Bruls Canisius, S.M.M. (transferred)
Parembolæ in Palæstina 1933
Parembolæ in Phœnicia 1979.03.18 Bishop Abdallah Nujaim (died)
Parium 1968.03.11 Archbishop Philippe Nguyễn Kim Ðiền (transferred)
Parlais 1967.06.12 Bishop William Zephyrine Gomes (transferred)
Parnassus 2002.05.08 Bishop Adolfo Luís Bossi, O.F.M. Cap. (died)
Paros 1977.07.06 Bishop Francesco Bertoglio (died)
Patræ 1971.08.26 Archbishop Luigi Fogar (died)
Pedachtoë 1967.08.18 Archbishop Hilaire Marie Vermeiren, M.S.C. (died)
Pegæ 1973.02.12 Bishop Innocenzo Alfredo Russo, O.F.M. (died)
Pella 2002.03.04 Bishop Pedro Grau y Arola, C.M.F. (died)
Peltæ 1950.03.28 Bishop Stephen Stanislaus Woznicki (transferred)
Pelusium 1965.04.10 Archbishop Patrick Mary O’Donnell (transferred)
Pergamum 1994.09.08 Bishop John Michael Bilock (died)
Perge 1970.01.03 Archbishop Joseph Angel Poli, O.F.M. Cap. (died)
Peristasis 1718.10.12 Bishop Thomas Joseph Nicolson (died)
Peritheorium 1933
Perperene 1933
Perrhe 1976.01.05 Bishop Henri Joseph Marie Belleau, O.M.I. (died)
Perta 1965.11.19 Archbishop Joseph Angel Poli, O.F.M. Cap. (transferred)
Pessinus 1971.01.15 Archbishop Gabriel Ganni (transferred)
Petinessus 1966.06.21 Archbishop Victor Frederick Foley, S.M. (transferred)
Petnelissus 1981.08.19 Bishop Joachim Ammann, O.S.B. (died)
Petra in Ægypto 1938.12.03 Bishop Joseph-Jean-Baptiste Hallé (transferred)
Petra in Lazica 1739.02.16 Bishop Jean Vivant (died)
Petra in Palæstina 1970.12.04 Archbishop Alfredo Silva Santiago (resigned)
Phacusa 1984.01.20 Bishop Francisco Xavier Elias Pedro Paulo Rey, T.O.R. (died)
Phæno 1933
Pharan 1976.01.14 Bishop Guilio Barbetta (died)
Pharbæthus 1986.06.25 Bishop Francisco Espino Porras (died)
Pharsalus 1972.07.22 Bishop Giuseppe Cognata, S.D.B. (died)
Phaselis 1970.07.27 Bishop José Candida Piñol y Batres (died)
Phasis 1976.05.28 Archbishop Arturo Mery Beckdorf (died)
Phatanus 1965.03.26 Bishop Youhanna Nueir, O.F.M. (transferred)
Phellus 1933
Philæ 1965.11.05 Bishop Luis Francisco Irizar Salazar, O.C.D. (died)
Philadelphia in Arabia 1995.05.04 Bishop Julian Groblicki (died)
Philadelphia in Lydia 1970.11.26 Bishop Augustin Arce Mostajo (resigned)
Philadelphia minor 1968.12.30 Bishop Bernardo Leonardo Fey Schneider, C.SS.R. (transferred)
Philippi 1968.01.11 Cardinal Duraisamy Simon Lourdusamy (90)Cardinal Duraisamy Simon Lourdusamy (90) (transferred)
Philippopolis in Arabia 1963.08.10 Cardinal Giovanni Colombo (transferred)
Philippopolis in Thracia 1967.04.01 Archbishop Emile-Arsène Blanchet (died)
Philomelium 1966.05.23 Bishop James John Hogan (transferred)
Phoba 1987.11.19 Bishop José Félix Pintado Blasco, S.D.B. (died)
Phocæa 1965.01.07 Bishop William Richard Arnold (died)
Phœnice 1970.11.16 Bishop Charles-Léo Nelligan (resigned)
Photice 1978.05.26 Bishop Joaquim de Lange, C.S.Sp. (resigned)
Phragonis 1933
Phulli 1964.08.16 Archbishop Willem Pieter Adrian Maria Mutsaerts (died)
Phytea 2000.11.22 Bishop Heinrich Pachowiak (died)
Pinara 1974.07.21 Bishop Alejandro Menchaca Lira (died)
Pionia 1965.08.19 Archbishop José Armando Gutiérrez Granier (transferred)
Pitanæ 1966.06.07 Bishop John Jobst, S.A.C. (94)Bishop John Jobst, S.A.C. (94) (transferred)
Platæa 1965.12.24 Bishop Pedro Luis Maria Galibert, T.O.R. (died)
Platamon 1933
Plestia 2013.07.14 Bishop Thaddeus Joseph Jakubowski (died)
Plotinopolis 1993.04.20 Bishop Pavlo Vasylyk (transferred)
Podalia 1969.06.29 Bishop Antonio D’Erchia (transferred)
Pogla 1982.05.12 Bishop Gregório Alonso Aparicio, O.A.R. (died)
Polemonium 1978.05.26 Bishop Estanislau Arnoldo van Melis, C.P. (resigned)
Polybotus 1965.08.05 Bishop Tomas Wilczynski (died)
Polystylus 1965.04.29 Bishop Louis-August Chorin, M.E.P. (died)
Pœmanenum 1933
Pompeiopolis in Cilicia 1965.04.05 Archbishop Johann Evangelist Müller (died)
Pompeiopolis in Paphlagonia 1966.12.06 Archbishop Jean Delay (died)
Porphyreon 1995.03.12 Bishop Petrus Canisius Jean van Lierde, O.S.A. (died)
Porthmus 1933
Prænetus 1965.02.20 Bishop Manuel de Jesus Pereira (transferred)
Preslavus 1977.07.07 Archbishop Benedetto Falcucci (died)
Priene 1966.10.09 Bishop Jacques Le Cordier (transferred)
Proconnesus 1963.05.24 Archbishop Cornelio Sebastiano Cuccarollo, O.F.M. Cap. (died)
Prostanna 1933
Prusa 1976.02.26 Bishop Gregorio Elias Olazar Muruaga, C.P. (died)
Prusa (Armenian Rite) 1972
Prusias ad Hypium 1967.09.15 Cardinal José Salazar López (transferred)
Prymnessus 1933
Pselchis 1933
Psibela 1933
Ptolemais in Phœnicia 1988.09.12 Bishop Edmundo Luís Kunz (died)
Ptolemais in Thebaide 1965.12.07 Cardinal Pietro Parente (transferred)
Pucheriopolis 2013.01.15 Bishop Michel Pollien (died)
Pudentiana 2013.09.23 Bishop Shelton Joseph Fabre (50)Bishop Shelton Joseph Fabre (50) (transferred)
Pyrgos 1988.02.08 Archbishop Savino Bernardo Maria Cazzaro Bertollo, O.S.M. (89)Archbishop Savino Bernardo Maria Cazzaro Bertollo, O.S.M. (89) (transferred)
Rachlea 1933
Raphia 1964.11.25 Bishop John Willem Nicolaysen Gran, O.C.S.O. (transferred)
Ratiaria 2005.05.24 Archbishop Marian Oles (died)
Rew-Ardashir (Chaldean Rite) 1979.12.20 Archbishop Joseph Cheikho (died)
Rhædestus 1966.04.28 Bishop Carlos Horacio Ponce de Léon (transferred)
Rhandus 1995.10.27 Bishop Jan-Wawrzyniec Kulik (died)
Rhesaina 1972.01.21 Bishop Gerardo Valencia Cano, M.X.Y. (died)
Rhinocorura 1967.11.29 Bishop Arthur Francis Fox (transferred)
Rhizæum 1980.01.30 Archbishop Francesco Lardone (died)
Rhodiapolis 1965.11.15 Bishop Jean-Louis-Antoine-Joseph Coudert, O.M.I. (died)
Rhodopolis 1969.11.24 Archbishop José Gonçalves da Costa, C.SS.R. (transferred)
Rhoga 1933
Rhoina 1968.11.10 Archbishop Ferdinand Périer, S.J. (died)
Rhosus 1967.07.13 Bishop Marc Lacroix, O.M.I. (transferred)
Rhusium 1971.03.07 Archbishop Alberto Castelli (died)
Rutabo 2009.01
Sabadia 1967.07.31 Archbishop Leo Christopher Byrne (transferred)
Saccæa 1966.12.14 Archbishop Joseph Lawrence Wilhelm (transferred)
Sagalassus 1964.03.15 Bishop Fortunato da Veiga Coutinho (transferred)
Saint-Papoul 2009.02.09
Sais 1980.07.21 Bishop Amand Hubert, S.M.A. (died)
Saittæ 1933
Sala 1962.01.27 Bishop Floyd Lawrence Begin (transferred)
Salamias 1957.11.07 Archbishop Leo Peter Kierkels, C.P. (died)
Salamis 1995.12.18 Archbishop Joseph Guo Ruo-shi (Kuo Joshih), C.D.D. (郭若石) (died)
Salona 1964.12.16 Bishop Alain-Sébastien Le Breton, S.M.M. (died)
Samos 1974.03.09 Bishop Giuseppe Olivotti (died)
Samosata 1967.06.26 Cardinal Pericle Felici (transferred)
Sanavus 1969 Bishop Mario Renato Cornejo Radavero (resigned)
Sardes 1976.05.24 Cardinal Giuseppe Maria Sensi (transferred)
Sarepta 1977.06.29 Bishop Luis Andrade Valderrama, O.F.M. (died)
Sariphæa 1933
Sæsina 1978.05.26 Bishop Adalberto Domingos Marzi, O.F.M. Cap. (resigned)
Sata 1981.07.29 Bishop James Edward Walsh, M.M. (華理柱) (died)
Satala in Armenia 1977.01.26 Bishop Salvador Herrera y Pinto, O.F.M. (died)
Satala in Lydia 1819.10.22 Bishop Nikodem Puzyna (died)
Sauatra 1964.02.02 Bishop Jean-Marie Mazé, M.E.P. (died)
Sbida 1966.06.21 Bishop John Hubert Macey Rodgers, S.M. (transferred)
Scarphea 1933
Scepsis 1933
Schedia 1933
Sciathus 1933
Scopelus in Hæmimonto 2003.09.07 Bishop Ivan Marghitych (died)
Scopelus in Thessalia 1933
Scutarium 1864.11.25 Bishop Mihály Fogarassy (transferred)
Scyrus 1971.12.10 Bishop Bernhard Schräder (died)
Scythopolis 2005.06.10 Archbishop Joseph-Marie Raya (died)
Sebaste (Armenian Rite) 2006.12.24 Archbishop Nerses Der Nersessian, C.A.M. (died)
Sebaste in Cilicia 2000.08.23 Bishop Cesario D’Amato, O.S.B. (died)
Sebaste in Palæstina 1997.07.19 Bishop Guerino Dominique Picchi, O.F.M. (died)
Sebaste in Phrygia 1958.03.02 Bishop Ferenc Rogacs (transferred)
Sebastea 1989.07.27 Archbishop Luigi Punzolo (died)
Sebastopolis in Abasgia 1969.04.28 Cardinal Giuseppe Paupini (transferred)
Sebastopolis in Armenia 1990.11.13 Bishop Léonce Tchantayan (died)
Sebastopolis in Thracia 1978.04.24 Bishop Andrés Sapelak, S.D.B. (94)Bishop Andrés Sapelak, S.D.B. (94) (transferred)
Sebela 1964.11.13 Bishop Oddo Bernacchia (died)
Sebennytus 1933
Seert 1992
Sela 1970.06.04 Archbishop Calogero Lauricella (transferred)
Seleucia ferrea 1785.02.14 Cardinal Giuseppe Maria Doria Pamphilj (transferred)
Seleucia in Isauria 1971.08.31 Archbishop William Mark Duke (died)
Seleucia Pieria 1980.04.15 Archbishop Jules Georges Kandela (died)
Seleucobelus 1933
Selge 1959.01.06 Archbishop João Batista Portocarrero Costa (died)
Selinus 1966.06.21 Archbishop Pierre-Paul-Émile Martin, S.M. (transferred)
Selymbria 1987.07.16 Archbishop Emile-Joseph Socquet, M. Afr. (died)
Semnea 1970.09.12 Bishop Gerhard Schaffran (transferred)
Serbia 1933
Sergentza 1970.03.24 Bishop Emilio Sosa Gaona, S.D.B. (died)
Sergiopolis 1970.01.06 Archbishop Antonio Taffi (died)
Serigene 1994.10.21 Bishop Kajetán Matoušek (died)
Serræ 1967.07.29 Archbishop Angelo Paino (died)
Setea 1984.09.16 Bishop Louis Abel Caillouet (died)
Sethroë 1933
Sibidunda 1933
Siblia 1933
Sicyon 1933
Side 1973.03.05 Cardinal Umberto Mozzoni (transferred)
Sidon 1999.09.02 Archbishop Romolo Carboni (died)
Sidyma 1974.12.30 Bishop Karl Reiterer, M.H.M. (died)
Silandus 1968.02.12 Bishop James Albert Duffy (died)
Silyum 1964.08.11 Archbishop Anthony Jordan, O.M.I. (transferred)
Sinda 1987.11.17 Bishop Thomas Bernard Pearson (died)
Siniandus 1972.06.28 Bishop Józef Drzazga (transferred)
Sinope 1985.06.05 Bishop Joseph Maria Reuß (died)
Sion 1968.09.23 Archbishop Luis Alonso Muñoyerro (died)
Skálholt 2008.04.21 Bishop Alphonsus Maria H.A. Castermans (died)
Soldaia 1971.11.29 Bishop José Romão Martenetz, O.S.B.M. (transferred)
Soli 1964.03.26 Bishop Humphrey Bright (died)
Sophene 1970.01.02 Bishop Patrick Shanley, O.C.D. (died)
Sora 1967.06 Bishop Alonso Manuel Escalante, M.M. (died)
Soteropolis 2005.10.06 Archbishop Ettore Cunial (died)
Sozopolis in Pisidia 1933
Sozusa in Libya 1989.12.11 Bishop Guido Attilio Previtali, O.F.M. (died)
Sozusa in Palæstina 1970.11.20 Bishop Francis Joseph McSorley, O.M.I. (died)
Spello 2012.05.13 Bishop Antoine Nguyễn Văn Thiện (died)
Stadia 1968.03.08 Bishop Aloysius John Wycislo (transferred)
Stagoi 1933
Stauropolis 1971.06.19 Archbishop Gabriel Thohey Mahn-Gaby (86)Archbishop Gabriel Thohey Mahn-Gaby (86) (transferred)
Stectorium 1966.06.21 Bishop Pierre-Auguste-Antoine-Marie Guichet, M.S.C. (transferred)
Stobi 1969.06.30 Bishop Roman Richard Atkielski (died)
Strathearn 2013.10.15 Bishop Sébastien Muyengo Mulombe (55)Bishop Sébastien Muyengo Mulombe (55) (transferred)
Stratonicea in Caria 1977.02.06 Bishop Carlos Guillermo Hartl de Laufen, O.F.M. Cap. (died)
Stratonicea in Lydia 1933
Strongoli 2013.06.11 Bishop Olavio López Duque, O.A.R. (died)
Strongyle 1933
Subaugusta 2012.02.10 Bishop Filippo Giannini (died)
Subrita 1933
Sufar 2013.09.27 Bishop Ernst Gutting (died)
Sugdæa 1970.12.07 Archbishop Thomas Roberts, S.J. (resigned)
Sura 1973.01.27 Bishop Stefano Hász (died)
Syca 1933
Sycomazon 1933
Syedra 1960.07.22 Bishop Frederic Osterrath, O.S.B. (died)
Syene 1984.04.13 Bishop John Benjamin Grellinger (died)
Synaus 2001.08.03 Bishop Leo-Karel Jozef De Kesel (died)
Synnada in Phrygia 1970.12.10 Archbishop Marcel-François Lefebvre, C.S.Sp. ▼ (resigned)
Tabala 1969.12.26 Bishop Johannes Ross, S.J. (ヨハネス・ロス) (died)
Tagritum (Syrian Rite) 2012.12.03 Archbishop Jules Mikhael Al-Jamil (died)
Taium 1962.01.27 Bishop Hugh Aloysius Donohoe (transferred)
Tamasus 1984.05.14 Bishop José Rincón Bonilla (died)
Tamiathis 1966.03.31 Bishop Antonio Cece (transferred)
Tanagra 1983.03.26 Bishop Stanisław Jakiel (died)
Tanais 1965.09.08 Bishop Agustín Adolfo Herrera (transferred)
Tanis 1973.06.14 Bishop José Joaquim Gonçalves (transferred)
Tanudaia 2013.02.03 Bishop Joseph O. Egerega (died)
Tapasa 1933
Tarsus 1973.03.05 Cardinal Luigi Raimondi (transferred)
Taua 1971.11.29 Bishop Elias Coueter (transferred)
Tavium 1965.07.08 Bishop Carlo Niemira (died)
Tegea 2006.12.05 Bishop Bernard Matthew Kelly (died)
Teglata in Numidia 2011.02.02 Bishop Francisco Antonio Nieto Súa (65)Bishop Francisco Antonio Nieto Súa (65) (transferred)
Tell-Mahrê 1933
Telmissus 1990.10.23 Bishop George Martin Kuzma (transferred)
Temenothyræ 1933
Temnus 1966.03.05 Archbishop Francis James Furey (transferred)
Tenedus 1971.01.07 Cardinal Giovanni Canestri (95)Cardinal Giovanni Canestri (95) (transferred)
Tentyris 1972.09.11 Bishop Jean-Rosière-Eugène Arnaud, M.E.P. (died)
Teos 1996.12.28 Bishop Edward Gerard Hettinger (died)
Terenuthis 1973.12.13 Bishop Biagio Sigibaldo Kurz, O.F.M. (died)
Termessus 1981.05.25 Bishop Neemeh Simaan (died)
Termini Imerese 2012.08.09 Bishop Jean-Yves Nahmias (56)Bishop Jean-Yves Nahmias (56) (transferred)
Ternobus 1967.06.29 Cardinal Antonio Samorè (transferred)
Teuchira 1946.09.26 Bishop François-Arsène-Jean-Marie-Eugène Lemasle, M.E.P. (died)
Thasus 1989.03.11 Bishop Carl Schmidt (died)
Thaumacus 1943.11.21 Bishop Gustave-Georges-Arsène Vandaele, M.E.P. (died)
Thebæ 1965.02.01 Archbishop Angelo Rotta (died)
Thebæ Phthiotides 1989.12.15 Bishop Alfonso Höfer Hombach, C.M. (died)
Thennesus 1971.10.16 Bishop Primo Gasbarri (transferred)
Theodoropolis 1957.11.07 Bishop George Calavassy (died)
Theodosiopolis in Arcadia 1967.09.12 Archbishop Arrigo Pintonello (transferred)
Theodosiopolis in Armenia 1964.02.22 Bishop Horacio Arturo Gómez Dávila (transferred)
Thermus basilicæ 1968.06.24 Bishop Angelo Giuseppe Jelmini (died)
Thérouanne 2009.02.09
Thespiæ 1971.08.29 Bishop Luigi Civardi (died)
Thessalonica 1967.07.15 Cardinal Carlo Grano (resigned)
Thmuis 1964.08.10 Bishop Pierre-Armand-Albert-Lucien Fallaize, O.M.I. (died)
Thois 1966.11.21 Bishop David Picão (transferred)
Thucca in Numidia 2013.04.24 Bishop Liro Vendelino Meurer (59)Bishop Liro Vendelino Meurer (59) (transferred)
Thyatira 1991.10.28 Bishop Myron Michael Daciuk, O.S.B.M. (transferred)
Tiberias 1966.11.29 Bishop Raffaele Macario (transferred)
Tiberiopolis 1964.09.10 Archbishop Adolfo Rodríguez Herrera (transferred)
Tigava 2013.04.10 Bishop Bernhard Rieger (died)
Titiopolis 1967.03.15 Bishop Pedro Francisco Luna Pachón, O.F.M. (died)
Tituli in Numidia 2013.09.10 Archbishop Peter Paul Prabhu (died)
Tityassus ?
Tium 1970.04.30 Bishop Alfredo Maria Cavagna (died)
Tokat (Armenian Rite) 2012.07.28 Bishop Vartan Achkarian, C.A.M. (died)
Tortiboli 2009.07.25 Bishop Joseph Vũ Duy Thống (61)Bishop Joseph Vũ Duy Thống (61) (transferred)
Tracula 1966.12.25 Bishop John van Sambeek, M. Afr. (died)
Traianopolis in Phrygia 1967.05.05 Bishop Humberto Lara Mejía, C.M. (transferred)
Traianopolis in Rhodope 1968.01.12 Archbishop Albert-Pierre Falière, M.E.P. (died)
Tralles in Asia 1974.08.21 Bishop Emanuele Galea (died)
Tralles in Lydia 1933
Transmarisca 1933
Trapezopolis 1990.03.14 Bishop Ioan Ploscaru (transferred)
Trapezus 1912.02.28 Archbishop Edmund Stonor (died)
Trapezus (Armenian Rite) 2002.01.28 Bishop Hovhannes Tertsakian, C.A.M. (died)
Trebenna 1966.04.04 Archbishop Paul Francis Leibold (transferred)
Tremithus 1966.01.03 Bishop Cândido Rubens Padín, O.S.B. (transferred)
Tricca 1966.05.16 Bishop Robert Costanzo Lagae, O.P. (died)
Tripolis in Lydia 1550.08 Bishop Pedro Gil Falcón (died)
Tripolis in Phœnicia 1902.03.01 Bishop Jean-Baptiste Grosgeorge, M.E.P. (died)
Troas 1971.01.23 Bishop Joseph-Alphonse Baud, M.S.F.S. (resigned)
Trocmades 1968.08.14 Bishop Karol Pekala (died)
Troina 2013.09.24 Bishop Raúl Martín (56)Bishop Raúl Martín (56) (transferred)
Trœzene 1933
Tunes 2014.03.10 Archbishop Francesco De Nittis (died)
Tunnuna 2013.12.11 Bishop Stephen Robson (63)Bishop Stephen Robson (63) (transferred)
Turres Concordiæ 2013.11.19 Bishop Joseph Frans Lescrauwaet, M.S.C. (died)
Tyana 1975.08.03 Archbishop Primo Principi (died)
Tymandus 1919.12.09 Bishop Aloysius Pareparambil (died)
Tymbrias 1967.11.04 Bishop Henry Edmund Donnelly (died)
Tyriæum 1984.10.27 Bishop Angel Muzzolón, S.D.B. (died)
Tyrus 1984.05.31 Archbishop Bruno Wüstenberg (died)
Uchi maius 2011.12.28 Bishop Remídio José Bohn (63)Bishop Remídio José Bohn (63) (transferred)
Urima 1966.11.15 Archbishop Johannes Höhne, M.S.C. (transferred)
Urusi 2013.07.19 Archbishop Julian Charles Porteous (64)Archbishop Julian Charles Porteous (64) (transferred)
Utica 2014.02.11 Bishop Léon Hégelé (died)
Uzalis 2011.11.08 Archbishop Edmundo Ponziano Valenzuela Mellid, S.D.B. (69)Archbishop Edmundo Ponziano Valenzuela Mellid, S.D.B. (69) (transferred)
Vaga 2011.07.11 Bishop André Gazaille (67)Bishop André Gazaille (67) (transferred)
Vaison 2009.02.09
Valentia 1933
Vamalla 2013.09.25 Bishop Timothy Joseph Lyne (died)
Vanariona 2013.05.18 Archbishop Józef Piotr Kupny (58)Archbishop Józef Piotr Kupny (58) (transferred)
Vardimissa 2011.04.21 Bishop Mosè Marcia (70)Bishop Mosè Marcia (70) (transferred)
Vasada 1980.05.04 Bishop Johann Wember, M.S.F. (died)
Vegesela in Numidia 2013.05.06 Bishop Severo Aparicio Quispe, O. de M. (died)
Velebusdus 1989.11.18 Cardinal José Manuel Estepa Llaurens (88)Cardinal José Manuel Estepa Llaurens (88) (transferred)
Velicia 1968.06.19 Bishop Eduard Nécsey (died)
Verinopolis 1982.11.22 Cardinal Serafim Fernandes de Araújo (89)Cardinal Serafim Fernandes de Araújo (89) (transferred)
Verissa 1965.03.25 Archbishop Felício César da Cunha Vasconcellos, O.F.M. (transferred)
Vescera 2013.02.23 Bishop José Gustavo Ángel Ramírez, M.X.Y. (died)
Xanthe 1561.06.04 Bishop Guillermo Casador (transferred)
Xanthus 2003.03.18 Archbishop Bruno Bernard Heim (died)
Xois 1933
Zabulon 1727.04.01 Bishop Louis Champion de Cicé, M.E.P. (died)
Zagylis 1933
Zaliche 1990.04.30 Bishop Gustavo Posada Peláez, M.X.Y. (transferred)
Zapara 1976.06.03 Bishop Juan Nicolasora Nilmar (transferred)
Zaratovium 1933
Zarzela 1933
Zela 1964.07.07 Archbishop José María García Lahiguera (transferred)
Zenobias 2004.09 Bishop Andraos Abouna (transferred)
Zenopolis in Isauria 2010.12.20 Archbishop Giovanni Ferrofino (died)
Zenopolis in Lycia 1779.08.29 Bishop Francisco de Lemos de Faria Pereira Coutinho (transferred)
Zephyrium 1966.07.26 Archbishop André Charles Collini (transferred)
Zeugma in Mesopotamia 1902.09.15 Cardinal John Murphy Farley (transferred)
Zoara 2001.08.25 Bishop Wacław Skomorucha (died)
Zorava 1971.01.27 Bishop Peter Willekens, S.J. (died)
Zorolus 1979.03.01 Bishop Kazimierz Jan Majdański (transferred)
Zygana 1933
Zygris 2012.11.12 Bishop Michel Hrynchyshyn, C.SS.R. (died)

as of 2014.04.08
See Also

Titular Sees

Vacant Sees

Recent Appointments

© 2014 GCatholic.org

12345

riogrande |
aidoCopro |
zokafric |
Unblog.fr | Créer un blog | Annuaire | Signaler un abus | l'actue des starlette
| Pont Tracy-Lanoraie
| texia1904