• Accueil
  • > Recherche : ordre malte france cra

30 octobre, 2018

Déclaration de Fidélité à l’ Enseignement immuable de l’Église sur le mariage

Classé dans : Non classé — andreadicaffa02 @ 10:55
Déclaration de Fidélité à l' Enseignement immuable de l'Église sur le mariage  top_tekst_fr
choisissez votre langue
en ancien président de l’IOR (Italie) Pr Massimo de Leonardis it archevêque émérite de Bologne es archevêque émérite de Riga (Lettonie) S. Exc. Mgr Athanasius Schneider fr B. cz choisissez votre langue Premiers signataires Pr Wolfgang Waldsteinde co-fondateur de la Société brésilienne pour la défense de la Tradition pt_2 directeur de la Société pour la protection de l’enfant à naître (Society for the Protection of Unborn Children-SPUC) et co-fondateur de Voice of the Family (Royaume Uni) Pr Ettore Gotti Tedeschi pt docteur en théologie pl économiste et banquier
3 évêque auxiliaire de Salzburg (Austria) S. Exc. Mgr Juan Rodolfo Laise6 évêque auxiliaire d’Astana (Kazakhstan) Pr Josef Seifert2 évêque émérite de San Luis (Argentine) R. P. Antonius Maria Mamsery6 Faculté de physique et mathématiques1 Famille et Propriété (TFP) et président de l’Institut Plinio Corrêa de Oliveira Institute (Brésil) John Smeaton
licznik_francuski fondateur
Premiers signataires
  • Pr Wolfgang Waldstein, professeur émérite de l’Université de Salzburg, membre de l’Académie pontificale pour la Vie (Autriche)
  • S. E. le Cardinal Jãnis Pujats, archevêque émérite de Riga (Lettonie)
  • S. Exc. Mgr Athanasius Schneider, évêque auxiliaire d’Astana (Kazakhstan)
  • Pr Josef Seifert, professeur de philosophie à l’Association internationale pour l’étude de la philosophie d’Édith Stein (IASPES), fondateur, recteur et professeur de l’Académie internationale de philosophie dans la Principauté de Liechtenstein (Autriche)
  • Dr Anca-Maria Cernea, présidente de la Fondation Ioan Barbus (Roumanie)
  • Dr Vincent-Jean-Pierre Cernea (Roumanie)
  • M. l’Abbé Efrem Jindráček, Vice doyen de la faculté de philosophie de l’Université St Thomas d’Aquin – Angelicum de Rome (Italie)
  • S. E. le Cardinal Carlo Caffarra, archevêque émérite de Bologne, Fondateur et premier président de l’Institut pontifical Jean Paul II pour les études sur le mariage et la famillefor (Italie)
  • S. E. le Cardinal Raymond Leo Burke, Patron de l’Ordre souverain et militaire de Malte (Vatican)
  • Mgr Nicola Bux, professeur à la faculté de théologie des Pouilles (Italie)
  • S. Exc. Mgr Andreas Laün, évêque auxiliaire de Salzburg (Austria)
  • S. Exc. Mgr Juan Rodolfo Laise, évêque émérite de San Luis (Argentine)
  • R. P. Antonius Maria Mamsery, Supérieur général des Missionnaires de la sainte Croix in Singida (Tanzanie)
  • R. P. Giovanni M. Scalese, B., Supérieur ecclésiastique de la mission sui iuris en Afghanistan
  • Abbé José María Iraburu, professeur émérite de théologie spirituelle de l’École de théologie d’Espagne du Nord ; président de la Gratis Date Foundation et éditeur du site InfoCatólica (Espagne)
  • Mgr Juan Claudio Sanahuja, docteur en théologie, professeur de théologie morale et des Sacrements, journaliste (Argentine)
  • Pr Alma von Stockhausen, professeur de philosophie et fondateur de l’Académie Gustav-Siewerth de Weilheim-Bielbronnen (Allemagne)
  • Pr Rudolf Hilfer, Faculté de physique et mathématiques, Institut de physique informatique à l’Université de Stuttgart (Allemagne)
  • Me Adolpho Lindenberg, co-fondateur de la Société brésilienne pour la défense de la Tradition, Famille et Propriété (TFP) et président de l’Institut Plinio Corrêa de Oliveira Institute (Brésil)
  • John Smeaton, directeur de la Société pour la protection de l’enfant à naître (Society for the Protection of Unborn Children-SPUC) et co-fondateur de Voice of the Family (Royaume Uni)
  • Pr Ettore Gotti Tedeschi, professeur, économiste et banquier, ancien président de l’IOR (Italie)
  • Pr Massimo de Leonardis, directeur du département de sciences politiques à l’Université catholique du Sacré Cœur – Milan (Italie)
  • Comte Giorgio Piccolomini (Italie)
  • Comtesse Felicitas Piccolomini (Italie)
  • Pr Tommaso Scandroglio, professeur d’éthique et bioéthique à l’Université européenne (Italie)
  • Pr Giovanni Turco, professeur de philosophie du droit public à l’Université d’ Udine (Italie)
  • S.A.I.R. le Prince Louis Gaston d’Orléans Bragance, Chef de la Maison impériale du Brésil
  • Pr Isobel Camp, professeur de philosophie à l’Université pontificale de St-Thomas d’Aquin – l’Angelicum de Rome (Royaume Uni)
  • S.A. le Duc Paul d’Oldenbourg (Allemagne)
  • S.A. la Duchesse Pilar d’Oldenbourg (Allemagne)
  • Prince Carlo Massimo (Italie)
  • Princesse Elisa Massimo (Italie)
  • Pr Paolo Pasqualucci, professeur émérite de philosophie du droit de la faculté de Jurisprudence, Université de Perugia (Italie)
  • Pr Corrado Gnerre, auteur et professeur de sciences religieuses (Italie)
  • S.A.I.R. le Prince Bertrand d’Orléans Bragance (Brésil)
  • Pr John Laughland, auteur, docteur en philosophie (Royaume Uni)
  • Pr Robert Lazu, auteur, docteur en philosophie (Roumanie)
  • David Magalhães, maître de conférence à la faculté de droit de l’Université de Coimbra (Portugal)
  • Pr Enrico Maria Radaelli, auteur, directeur de recherche au département de métaphysique du Beau de philosophie des Arts (Italie)
  • R. P. Brian Harrison, professeur émérite de théologie de l’Université pontificale catholique de Puerto Rico ; professeur-résident, Centre d’étude des Oblats de la Sagesse (États-Unis)
  • Pr Roberto de Mattei, professeur d’histoire moderne et contemporaine de l’Université européenne de Rome (Italie)
  • Abbé Marc Hausmann, docteur et professeur de philosophie (Autriche)
  • Abbé Alfredo Morselli, théologien et auteur (Italie)
  • S. Exc. l’Ambassadeur Emilio Barbarani (Italie)
  • S. Exc. l’Ambassadeur Héctor Riesle Contreras, ambassadeur émérite du Chili près le Saint Siège (Chili)
  • S. A. l’Archiduchesse Alejandra von Habsburg (Ambassadrice Hector Riesle Contreras) (Autriche, Chili)
  • Abbé Fernando Palacios, docteur en droit canon (Espagne)
  • Me James Bogle, avocat et président honoraire d’Una Voce International (Royaume Uni)
  • John-Henry Westen, co-fondateur et rédacteur en chef de LifeSiteNews.com (Canada)
  • Luis Fernando Pérez Bustamante, directeur d’InfoCatólica (Espagne)
  • Maria Guarini, directrice du site « Chiesa e Post Concilio » (Italie)
  • Me Caio Xavier da Silveira, co-fondateur de la Société brésilienne pour la défence de la Tradition, Famille et Propriété (TFP), président de la Fédération Pro Europa Christiana (France)
  • Pr Gianandrea de Antonellis, président de l’Institut européen de recherche, d’études et de formation (I.E.R.E.F.) (Italie)
  • Pr Mauro Faverzani, éditeur de « Radici Cristiane » (Italie)
  • Pr Federico Catani, auteur et docteur en sciences religieuses (Italie)
  • Guido Vignelli, auteur et chercheur sur la famille (Italie)
  • Maria Madise, coordinateur de Voice of the Family (Estonie)
  • Cristina Siccardi, écrivain et historienne (Italie)
  • Mario Navarro da Costa, directeur du Bureau Tradition, Famille, Propriété à Washington (États-Unis)
  • Mathias von Gersdorff, écrivain et conférencier (Allemagne)
  • Marquise Gabriella Spalletti Trivelli Coda Nunziante (Italie)
  • Virginia Coda Nunziante, présidente de Famiglia Domani (Italie)
  • Raúl del Toro, organiste et professeur d’orgue (Espagne)
  • María Arratíbel , professeur de musique (Espagne)
  • Daniel Iglesias Grèzes, secrétaire du Centre culturel catholique « Fe y Razón » (Uruguay)
  • Pedro Luis Llera Vázquez, directeur d’école catholique (Espagne)
  • David González Cea (pseudonyme Alonso Gracián), philosophe thomiste et écrivain (Espagne)
  • José Miguel Arráiz, catéchiste et fondateur d’ApologeticaCatolica.org (Venezuela)
  • Antonello Brandi, président de Pro Vita Onlus (Italie)
  • Suzanne Pearson, déléguée de l’Emperor Karl League of Prayer (États-Unis)
  • Paul N. King, président et fondateur du Paulus Institute for the Propagation of Sacred Liturgy (États-Unis)
  • Donna Fitzpatrick Bethell, président du conseil d’administration du Collège de Chrétienté, ancien sous secrétaire du ministère de l’Énergie (États-Unis)
  • Alessandra Nucci, écrivain et directrice de la revue Una Voce Grida (Italie)
  • Néstor Martínez, licencié en philosophie, professeur et écrivain, co-fondateur de « Fe y Razón » (Uruguay)
  • Pr Javier Paredes, professeur d’histoire contemporaine à l’Université d’Alcalà (Espagne)
  • Honorable magistrat Justin Shaw (Royaume Uni)
  • Madame Caroline Shaw (Royaume Uni)
  • Bruno Moreno, licencié en physique et études ecclésiastiques, écrivain et éditeur de Vita Brevis (Espagne)
  • Juan José Romero, éditeur et consultant en communication (Espagne)
  • Dr. Alberto Zelger, président du Centre culturel Nicolò Stenone (Italie)
  • Gianfranco Amato, président des Juristes pour la Vie, secrétaire national de Popollo della Famiglia (Italie)
Parmi les plusieurs milliers de signataires de la Déclaration de Fidelity, nous mentionnons ces noms:
  • The Most Reverend Taras Senkiv, Bishop of Stryi, UGCC, (Ukraine)
  • Prof. Don Roberto Spataro SDB, University Professor and Secretary of the Pontifical Academy for Latin (Italy)
  • Mary Clare Meney, National Assoc. of Catholic Families (Australia)
  • Dr. Thomas Ward, Vice-president and Founder of the National Association of Catholic Families, Corresponding member of the Pontifical Academy for life (UK)
  • Dr. Christopher J. Malloy, PhD, Professor of Theology, University of Dallas, Irving (USA)
  • The Honourable Gerhard Wallbank, Minister of the Eastern Caribbean Supreme Court (Virgin Islands)
  • Rev. Fr. Prof. Alberto Strumia, Professor of Mathematical Physics at the Universtiy of Bari (Italy)
  • Prof. Peter Kwasniewski, theologian and philosopher (USA)
  • Prof. Claudi Pierantoni, Professor of Medieval Philosophy at the University of Chile (Italy)
  • Rev. Fr. Claude Barthe, theologian and vaticanista (France)
  • Tatiana Osorio de Moscoso, Duchess of Montemar (Spain)
  • H.S.H. Princess Benigna Reuss (Spain)
  • Marquise Maria Negrotto Cambiaso (Italy)
  • Emanuele Amat di San Filippo (Italy)
  • Luisa of the Princes Colonna di Paliano (Italy)
  • Kevin Jones, Secretary of the Latin Mass Society – England & Wales (UK)
  • Rev. Fr. Mattia Tanel (Italy)
  • Rev. Fr. Vilmar Pavesi (Italy)
  • Giacomo Maria Prati (Italy)
  • Edoardo Mazzetti di Pietralata (Italy)
  • Rev. Fr. Mario Ramello (Italy)
  • Marta Piccolomini, Sesto al Reghena (Italy)
  • Rev. Fr. Stanislaus Maria Paradal (Italy)
  • Rev. Fr. Francesco M. Budani (Italy)
  • Piotr Sawicki, historian (Poland)
  • Rev. Fr. Addolorato Maria Kyeremeh (Cameroon)
  • Luka Popov, Director Association Pro Family (Croatia)
  • Rev. Fr. Kenneth Bolin, Army Chaplain, West Point (USA)
  • Rev. Fr. Dr. Martin Fohl (Germany)
  • Rev. Fr. Pedro Ruiz, Licentiate in Spiritual Theology (Spain)
  • Rev. Fr. Anthony Serviam Ball (UK)
  • Eric Puosi Ph.D., writer (Italy)
  • Francisco José Fernández de la Cigoña, writer (Spain)
  • Rev. Fr. Luis Joaquín Gómez Jaubert, Defender of the Bond (Tenerife, Spain)
  • Rev. Fr. Paul J. McDonald (Canada)
  • Rev. Fr. Nuno Serras Pereira, OFM (Portugal)
  • Rev. Fr. Paolo Siano (Italy)
  • Deacon Brian Burns (UK)
  • Rev. Fr. Sandro Carbone (Italy)
  • Rev. Fr. Alessandro Apollonio (Italy)
  • Rev. Fr. Dr. Athanasius McVay (Canada)
  • Rev. Fr. Anthony Pillari (UK)
  • Rev. Fr. Diego Baltz (Brazil)
  • Rev. Fr. Lucio Savogin, SDB (Italy)
  • Rev. Fr. Stefano Braconi (Italy)
  • Prof. Fabiano Anderson Pedroso (Brazil)
  • Rev. Fr. Vidko Podržaj (Slovenia)
  • Rev. Fr. Edmund Castronovo (USA)
  • Rev. Fr. Gianluigi Braga (Italy)
  • Rev. Fr. Mario Ramello (Italy)
  • Rev. Fr. Paolo Mazzoleni (Italy)
  • Rev. Fr. John Giglio Hawley (USA)
  • Rev. Fr. John Benedict Maria Ubuane (Nigeria)
  • Deacon Mark Harden (USA)
  • Rev. Fr. Seán Finnegan (USA)
  • Sister Marie Ignatius Clune (USA)
  • Rev. Fr. Justo Díaz Villarreal, OSA (Spain)
  • Rev. Fr. Adriano Bolognani (Brazil)
  • Rev. Fr. Donato Maria (Erik Maria) Donadello (Italy)
  • Rev. Fr. José-Apeles Santolaria de Puey y Cruells (Spain)
  • Borther Charles Anthony Jukes (UK)
  • Rev. Fr. Fabiano Montanaro (Italy)
  • Rev. Fr. Hernán Ducci (Chile)
  • Rev. Fr. Joseph Ganser (USA)
  • Rev. Fr. Paolo Crescini (Italy)
  • Rev. Fr. José Encarnación Losoya (USA)
  • Deacon Vincent Daigle (Canada)
  • Rev. Fr. Angelo Bisi, Motteggiana (Italy)
  • Rev. Fr. Francis Denton (Australia)
  • Rev. Fr. Steven Ledinich (Australia)
  • Rev. Fr. Steven Sanchez (USA)
  • Brother John Pail Ignatius Mary (USA)
  • Rev. Fr. Jaromir Gargos Oslavany (Czech Republic)
  • Rev. Fr. Dennis Gordon, FSSP (USA)
  • Rev. Fr. George Kocholickal (Kenya)
  • Rev. Fr. Antony Tumelty (UK)
  • Rev. Fr. Thierry Pluquet (Belgium)
  • Rev. Fr. Peter Morgan (UK)
  • Permanent Deacon René Duranson (France)
  • Rev. Fr. Thomas Achatz, ISPN (Austria)
  • Rev. Fr. Martin Michael Klein (Australia)
  • Prof. Loreno Lorenzon, Professor at the Superior Institute of Religious Science of Treviso and Vittorio Veneto (Italy)
  • Rev. Fr. Marco Begato (Italy)
  • Rev. Fr. Joseph Justice (USA)
  • Prof. Carlos Casanova, Professor of Law at the Catholic University of Chile (Venezuela)
  • Rev. Fr. Anders Hamberg, STL (Finland)
  • Rev. Fr. Tomáš Hajda (Czech Republic)
  • Christopher Ferrara, writer and lecturer (USA)
  • Rev. Fr. Antonín Damián Nohejl, III OP (Czech Republic)
  • Rev. Fr. Bartłomiej Koziej (Poland)
  • Brother Ambrogio Maria Canavesi (Italy)
  • Rev. Fr. Francisco de Assis de Souza, Itabaiana – SE (Brazil)
  • Deacon Edward Peitler, Ph.D. (USA)
  • Rev. Fr. Kenneth Riello (USA)
  • Rev. Fr. Donatello Iocco (Canada)
  • Deacon James Stanley (USA)
  • Rev. Fr. Fabio Castagnoli (Italy)
  • Sister Luisa De Vivo (Italy)
  • Rev. Fr. Dr. Kevin Bezner (USA)
  • James Lucier, Ph.D. (USA)
  • Rev. Fr. Alfonso Avilés Pérez (Ecuador)
  • Dom Marcello Cristofani della Magione (Italy)
  • Marco Sgroi, in charge of the Summorum Pontificum Pilgrimage, (Italy)
  • Rev. Fr. Junior Carlo Louisetti (Italy)
  • Countess Lucrezia Piccolomini Adami (Italy)
  • Roberto Marchesini, psychologist and writer (Italy)
  • Prof. Dr. Hans-Heribert Derix , university professor (Germany)
  • Rev. Fr. Claudio Girlanda (Italy)
  • Rev. Fr. Camillo Magarotto (Italy)
  • Rev. Fr. Joao Carlos Teodoro (Brazil)
  • Prof. Wojciech Dobiński, scientist (Poland)
  • Prof. Kalah Williams, Director of Religious Education (USA)
  • Prof. Piotr Wisniowski, university professor (Poland)
  • Rev. Fr. David Bechtel, Wellsboro (USA)
  • Deacon Alois Nespor, FSSP (Czech Republic)
  • Rev. Fr. Francesco Solazzo, C.P. (Italy)
  • Ann Farmer (MA), writer and researcher (UK)
  • Michael Fagge, Assistant Professor of Theology (USA)
  • Marek Ziaja, Theologian (Poland)
  • Prof. Alexander Frain, M.A.C.D. (USA)
  • Prof. Patrick Powers, professor of philosophy, (USA)
  • Prof. Joao Titta Maurício, university professor (Portugal)
  • Rev. Fr. John Rice (UK)
  • William Fahey, President of the Thomas More College of Liberal Arts (USA)
  • Rev. Father Markielowski (Poland)
  • Prof. Melchiorre Livoti (Italy)
  • Rev. Fr. Gary Dickson (UK)
  • Rev. Fr. David Evans (UK)
  • Prof. José Lago (Spain)
  • Prof. Paolo Rizza (Italy)
  • Rev. Fr. Pio M. Idowu (UK)
  • Prof. Dr. Stephan Ernst Baldus M.D. (Germany)
  • Prof. Claudio Buzzi Di Marco (Italy)
  • Prof. Elmar Große-Klönne, professor of Mathematics (Germany)
  • Rev. Fr. Bogdan Tyc (Poland)
  • Prof. Ryan Topping, Professor at the Thomas More College (USA)
  • Prof. Marcin Babicz, historian and journalist (Poland)
  • Marcin Bąk, seminarian (Poland)
  • Prof. John McCarthy, Professor at the University of Manchester (USA)
  • Prof. Timothy J. Williams, Professor at the Franciscan University of Steubenville (USA)
  • Rev. Fr. Mugurel Puia (Romania)
  • Rev. Fr. Eduardo Cuadrado (Brazil)
  • Matheus Spézia de Oliveira, seminarian (Brazil)
  • Rev. Fr. Bogdan Krol (Poland)
  • Modesto Fernandez, President of Droit de Naître (France)
  • César Félix Sánchez Martínez, Director of Studies at the Archdiocesan Seminary of Arequipa (Peru)
  • Rev. Fr. Luciano Micheli (Italy)
  • Rev. Fr. Mark Morris, Pastor and Chaplain to the Caledonian University (UK)
  • Rev. Fr. Piotr Wróbel, Pastor (Poland)
  • Therese Carolan, pastoral team member (USA)
  • Rev. Fr. Roman Adam Kneblewski (Poland)
  • Prof. Maurizio Brunetti, university professor (Italy)
  • Łukasz Kaszuba, seminarian (Poland)
  • Rev. Fr. Sebastian Gilbert Iavorschi (Romania)
  • Rev. Fr. Bruno Antonio Verduci (Italy)
  • Prof. Marek Stachowiak, university professor (Poland)
  • Rev. Fr. Lawrence Kutz (USA)
  • Rev. Canon John Anthony Pintabone, KHS, historian (USA)
  • Raymond Belair, catechist and writer (USA)
  • Rev. Fr. Matthew C. MacDonald Somers (USA)
  • Kamil Belling, seminarian (USA)
  • Paolo Gasperini, religious education teacher (Italy)
  • Rev. Fr. Grzegorz Papciak Piotrkowice (Poland)
  • Jacek Rządkowski, theologian and composer (Poland)
  • Joseph Parackal John, seminarian (India)
  • Rev. Fr. Frank Domen (The Netherlands)
  • Rev. Fr. Luciano Dalla Costa (Italy)
  • Rev. Fr. George Mary Roth (UK)
  • Theresa Fleming, activist for Life and parish assistant (UK)
  • Prof. Cristian Rodríguez Iglesias, professor of theology (Argentina)
  • Dominie-Mary Stemp, catechist (UK)
  • Rev. Fr. Carlos Hamel (France)
  • Prof. Michel Bastit, Professor of Philosophy at the University of Bourgogne (France)
  • Prof. Pablo Augusto Marini, writer, philosopher and theologian (Argentina)
  • Reinhard Dörner, President of Kardinal-von-Galen-Kreis (Germany)
  • Rev. Fr. Juan Carlos Angulo Karam (Spain)
  • Rev. Fr. Joseph D. Santos Jr. (USA)
  • Rev. Fr. Luigi Re Cecconi (Italy)
  • Rev. Fr. Dr. Robert Farrell (UK)
  • Rev. Fr. Aaron N. Pribil, clerical oblate (Germany)
  • Rev. Fr. Salvatore Vitiello, university professor – Roma (Italy)
  • Rev. Fr. Damiano Cavallaro (Italy)
  • Rev. Fr. Angel Francisco Casabon Vicente (Brazil)
  • Prof. Antonio Toniolo, professor of Medicine (Italy)
  • Rev. Fr. Luciano Tiso (Italy)
  • Dr. Francesco Domaschio, President of Associazione Città e Famiglia (Italy)
  • Prof. Alberto Bosi, university professor (Italy)
  • Sister Maria Teresa Bator (Italy)
  • Michael Rocha, seminarian (USA)
  • Rev. Fr. Michael Sellers (UK)
  • Rev. Fr. Pierpaolo Cilla (Italy)
  • Rev. Fr. Michael Brown (UK)
  • Rev. Fr. Marino Ramadori (Italy)
  • Sister Costanza Salbego (Italy)
  • Rev. Fr. Christian Bünnigmann (Germany)
  • Rev. Fr. Petru Sescu (Romania)
  • Rev. Fr. Carlo Radrizzani, pastor (Italy)
  • Sister Mary Joseph Maling (UK)
  • Prof. Domenico del Nero, teacher and writer (Italy)
  • Rev. Fr. Richard Duncan, C.O. (UK)
  • Rev. Fr. Mario Piatti (Italy)
  • Rev. Fr. Andrew Johnson, pastor (USA)
  • Prof. Marcos Luis Blanco y Centurión, emeritus professor of Canon Law (Uruguay)
  • Rev. Fr. Joseph Matlak (USA)
  • Ana Pavelić, theologian (Croatia)
  • Rev. Fr. Gian Paolo Bretti (Italy)
  • Rev. Fr. Clemens of Saint Gabriel, OCD (Sweden)
  • Rev. Fr. Matthew Kauth, STD, Rector of St Joseph College Seminary (USA)
  • Rev. Fr. Massimo Macalli (Italy)
  • Prof. Giovanni (Gianni) Fochi, chemist and scientific journalist (Italy)
  • Prof. Mauro Giacomini, university professor (Kazakhstan)
  • Rev. Fr. Giovanni De Checchi (France)
  • Rev. Fr. Jan Franta (Germany)
  • Prof. Nicola Liberio, professor of religious education (Italy)
  • Rev. Fr. Giuseppe Tagliareni (Italy)
  • Prof. Kolos Ágoston, associate university professot (Hungary)
  • Anna Buoncristiani, journalist (Italy)
  • John Vennari, Director of Catholic Family News (USA)
  • Giorgio Nicolini, Director of Tele Maria (Italy)
  • Prof. Joaquín Reyes, Professor of Law at the Catholic University of Santiago (Chile)
  • Rev. Fr. Krzysztof Irek (Poland)
  • Prof. Ignacio Maria Gallo Ingrao, professor of philosophy (Argentina)
  • Dr. Richard Fitzgibbons, psychiatrist (USA)
  • Rev. Fr. Jorge Miguel Martínez Florentín (Paraguay)
  • Patryk Piotr Kostera, seminarian (Poland)
  • Daniele Caci, catechist (Italy)
  • Rev. Fr. Vernon F Clark, JCL (USA)
  • Rev. Fr. Richard Yevchak (USA)
  • Rev. Jan Mazur Monaco (Poland)
  • Rev. Padre Tomàs Alfonso Paz Pérez (Venezuela)
  • Kathy Sinnott, EWTN Radio Host (Ireland)
  • Prof. Vittorio Bertolini, professor of philosophy (Italy)
  • Paul Danello, Doctor in Civil and Canon Law (USA)
  • Rev. Fr. Thomas Crean, O.P., theologian (UK)
  • Rev. Fr. Alessandro Coniglio (Italy)
  • Rev. Fr. Ignacio Palacios Blanco, Professor of Philosophy at the San Ildefonso Centre for Theological Studies of Toledo (Spain)
  • Piotr Korycki, President of Genealogia Polska LLC (USA)
  • Prof. Jorge Horacio de la Calle, professor of Philosophy (Argentina)
  • Jiří Hanuš, Co-director of the Philarmonic Orchestra of Hradec Králové (Czech Republic)
  • Prof. Anna Hanušová, professor at Charles University (Czech Republic)
  • Rev. Fr. Simon Heans (UK)
  • Rev. Fr. Matthew Goddard (UK)
  • Joseph-Henri Fradet, Founder and Director of Christendom Restoration Society (USA)
  • Rev. Fr. Stanislaw Morawski (Italy)
  • Sarah Jirak, professor of theology (USA)
  • Rev. Fr. Didier Baccianti (Switzerland)
  • Rev. Fr. Rafael Gonzalez Bustillos (France)
  • Carmela Spuria, religious education teacher (Italy)
  • Deacon Nick Donnelly, journalist and writer (UK)
  • Rev. Fr. Godofroy Upartho Unega (Congo)
  • David Pietrusza, historian and writer (USA)
  • Rev. Fr. Michał Woźnicki, SDB (Poland)
  • Brother Bruno Cassalibus, hermit (Canada)
  • Rev. Fr. Michael T. Barry (USA)
  • Sister Weruska Caterina Luna, O.S.S. (Italy)
  • Rev. Fr. Miguel Galvez (USA)
  • Rev. Fr. Ninian Doohan (UK)
  • Prof. Mario Correa Bascuñán, Professor of Law and former university rector (Chile)
  • Rev. Fr. Raymond Blake, pastor (UK)
  • Rev. Fr. Diego Rodrigo Pildain (The Netherlands)
  • Rev. Fr. John Lawrence M. Polis (Italy)
  • Phillip Bellini, Director of Religious Education (USA)
  • Carlos Gonzalez-Chavez, religious education teacher (USA)
  • Rev. Fr. James Clark (UK)
  • Prof. Paul Crawford, university professor (USA)
  • Rev. Fr. Alex Hill (UK)
  • Dr. Judith Marie Gentle, theologian (USA)
  • Rev. Fr. David R. Belland (USA)
  • Oyvind Iustinus Lone, theology student (Italy)
  • Rev. Fr. Steven Scherrer, MM, ThD (USA)
  • Prof. Alonso Jaramillo de Andrade, ecclesiastical historian (Colombia)
  • Ted Huerena, Headmaster of the St. Louis de Montfort Academy (USA)
  • Rev. Fr. John Paul Mount (Australia)
  • Rev. Fr. Acton (Canada)
  • Rev. Fr. Paulino Toral (Equador)
  • Maria Amelia Volz, theologian (USA)
  • Francesco De Gol, seminarian (Italy)
  • Angelica Saldaña, theologian (USA)
  • Paolo Gulisano, doctor and writer (Italy)
  • Rev. Fr. Kevin Kinchang Anak Chundi (Malaysia)
  • Brother Andrea Ingribello (Italy)
  • Rev. Fr. Maycon Zaidan Alves Lopes (Brazil)
  • Rev. Fr. Xavier Ryckeboer, professor of theology (Argentina)
  • Rev. Fr. Miguel Ángel Saiz Cerreda (Spain)
  • Rev. Fr. Zdenko Králik, Chaplain (Slovakia)
  • Rev. Fr. Otto Michael Schneider, pastor (Sweden)
  • Mendonça Correia, canonist (Portugal)
  • Rev. Fr. Srećko Rimac (Croatia)
  • Sister M. Cecilia Pia Manelli, religious (Italy)
  • Prof. Brad Miner, Faith & Reason Institute (USA)
  • Rev. Fr. Hernán Gabriel Barreto (Argentina)
  • Lucrecia Rego de Planas, writer, Founder of the portal Catholic.net (Mexico)
  • Prof. Martin Brown, former professor of philosophy (Canada)
  • Rev. Fr.. Francis Butler, Josephite Fathers (USA)
  • Prof. Nelson Tepedino, Professor at the Department of Philosophy at Simón Bolívar University (Venezuela)
  • Filip Mazurczak, Catholic journalist (USA)
  • Rev. Fr. Robert Adriano Brisman Polanco (Dominican Republic)
  • Rev. Fr. Siegfried M. Lang (Austria)
  • Very Rev. Msgr. John Fritz, FSSP, pastor (USA)
  • Prof. Carlos Freile, Director of the Academy of Ecuadorian Ecclesiastical History (Ecuador)
  • Brother André Marie Villarrubia, Prior (USA)
  • Francesca Pannuti, philosopher and writer (Italy)
  • Adam Miller, writer (USA)
  • Rev. Fr. Sergio Demartini, monk (USA)
  • Rev. Fr. Milan Tisma (Chile)
  • Pierre de Lauzun, writer and economist (France)
  • Prof. Jean Barbey, University Professor for Medieval Law (France)
  • Mrs. Catherine Barbey (France)
  • Prof. Jacopo Parravicini, Physicist at the University of Milano-Bicocca (Italy)
  • Dr. Oscar Botta, Doctor, Director for La Vida y la Familia (Argentina)
  • Rev. Fr. Robert Dodaro, O.S.A., Professor of Patristic Theology at the Pontifical Lateran University (Cidade do Vaticano)
  • Rev. Fr. Horacio Bojorge, S.J., Professor of Theology and writer (Uruguay)
  • Raffaele Tiscar, Vice-Secretary General to the President of the Council of Ministers (Italy)
  • Claudio Circelli, President of the Associazione Casa Mariana Editrice (Italy)
  • Gianpaolo Barra, Editor of Novate Milanese (Italy)
  • Miguel Ángel Fuentes, Doctor of Moral Theology, specialising in Marriage and Family (Argentina)
  • Rev. Fr. Bryan W. Jerabek, J.C.L., Parish priest, marriage tribunal judge for the Diocese of Birmingham, AL (USA)
  • Jacopo Parravicini, Physicist at Milano-Bicocca University (Italy)
  • Prof. Eric E. Puosi, Ph.D, Professor of Fundamental Theology and History of the Reformation (Italy)
  • Jason Adkins, Executive Director & General Counsel Minnesota Catholic Conference (USA)
  • Sister Noemi Pedrotti (Italy)
  • Tomas Rochford, High School teacher and Catechist (Canada)
  • Rev. Fr. Francesco Gaetta (Italy)
  • Rev. Fr. Juan Valdéz Solowij (Argentina)
  • Rev. Fr. Andrew Michael Walter, Pastor in the Diocese Of Bridgeport, CT (USA)
  • Amanda Peter, Pharmacist and author (UK)
  • Rev. Fr. Roberto Castiglione, S.D.B., missionary, teacher of philosphy (Nigeria)
  • Rev. Fr. Ricardo Cardoso (Portugal)
  • Rev. Fr. Leonard F. Villa, Pastor (USA)
  • Prof. Angelo Maria Vitale, Professor of Philosophy at the University of Salerno (Italy)
  • Patrick Delaney, High School teacher of Theology (USA)
  • Rev. Fr. Edwin Vissers (The Netherlands)
  • Rev. Fr. Juan Antonio Gómez Medina (Spain)
  • Timothy Capps, Author (USA)
  • Alberto Mensi, Professor of Philosophy (Argentina)
  • Rev. Fr. Jose Manuel Villanueva (Uruguay)
  • Prof. Hugo Alberto Verdera, University professor and journalist (Argentina)
  • Rev. Fr. Juan Fernando García Budinich, Priest (Chile)
  • Sister Maria Angelica Celocia, S.F.I. (Italy)
  • Rev. Fr. Thomas Joseph Hennigan (Spain)
  • Rev. Fr. Francisco Perez (Venezuela)
  • Sister Maria Teresina Custodio Ancona (Italy)
  • Prof. Massimo Mallucci De Mulucci, lawyer, Professor of Family Law (Italy)
  • Sister Suzette Cortes (Italy)
  • Rev. Fr. Duarte Sousa Lara (Portugal)
  • Sister Amanda Khoo (UK)
  • Edmundo Gelonch Villarino, Professor and writer (Argentina)
  • Rev. Fr. Daniel Katacic, monk (Croatia)
  • Rev. Fr. Christian Vegna, O.F.M. (Italy)
  • Rev. Fr. Gabriele Mangiarotti, in charge of Culturacattolica.it (Italy)
  • Rev. Fr. Terrence Brennan (USA)
  • Rev. Fr. Miroslav Cerny, univeristy professor (Czech Republic)
  • Prof. Alessandro Manzani, Professor of History at the Luigi Paolini Superior Institute (Italy)
  • Prof. John Rao, Associate Professor of History (USA)
  • Prof. Marco di Matteo, Professor of Italian and Latin Literature (Italy)
  • Matthew Zamoyski, Writer (Poland)
  • Rev. Fr. Jerzy Pikulinski (USA)
  • Rev. Fr. Samuel Weber, O.S.B. (USA)
  • Brian McCauley, Director of Religious Education (USA)
  • Rev. Fr. Stefano Tartabini (Italy)
  • Rev. Fr. Mugurel Puia (Romania)
  • Rev. Fr. Ronald Piepmeyer (USA)
  • Rev. Fr. Giuseppe Privitera (Italy)
  • Rev. Fr. David Palmer (UK)
  • Matthew Smith, Seminarian (USA)
  • Rev. Fr. Nick Wichert (USA)
  • Rev. Fr. Francisco Godinez (USA)
  • Br. Ryan Carnes, O.F.S. (USA)
  • Carol Goodson, Catechist for RCIA (USA)
  • Joseph Rubio, Catechist (USA)
  • Benedikt Timpe, Seminarian (German)
  • Rev. Fr. Matt McAuslin (New Zealand)
  • Matteo Baldan, Consecrated, Fiesso d’Artico (Italy)
  • Rev. Fr. James Torpey (USA)
  • Rev. Fr. Patrick Fixsen (USA)
  • Rev. Fr. Dr. Franz Ehgartner (Austria)
  • Rev. Fr. Jessie Martinez, O.C.D.S. (USA)
  • Andrew Mcgovern, M.T.S., theology teacher (USA)
  • Rod Treat, Webmaster/Social Media Manager – Diocese of Tulsa (USA)
  • Deacon Christopher Baker, Cathedral of St. Joseph, Jefferson City (USA)
  • Henri Courivaud, conference organiser at the Faculty of Law at the University of Lyon III (France)
  • Sister Claudia Lo Sterzo (UK)
  • Prof. Antonio De Santi, thelogy and religious education (Italy)
  • Constance Louise Taylor, retired RN catechist (USA)
  • Sheryl Collmer, Writer and speaker (USA)
  • Rev. Fr. Riccardo Vaninetti, Pastor (Italy)
  • Javier Castillo, theology teacher (USA)
  • Adam Pittman, Seminarian (USA)
  • Tobias Kokot, Theologian (Germany)
  • Dawn McGinley, Director of Catholic Campus Ministry at Mississippi State University (USA)
  • Rev. Fr. Giorgio Bellei, Pastor (Italy)
  • Very Rev. Canon Paolo Piccoli (Italy)
  • Rev. Fr. Todd Petersen (USA)
  • Rev. Fr. Dwight Campbell (USA)
  • Rev. Fr. Domingos Miguel da Fonseca Coelho (Portugal)
  • Br. Mauricio Rangel Huerta (Mexico)
  • Prof. Fausto Zamboni, Professor and author (Brazil)
  • Juan Ignacio Moreno-Luque Casariego, Judge of the Superior Tribunal of Justice of the Canary Islands (Tenerife, Spain)
  • Rev. Fr. Timothy Sauppe, S.T.L., Pastor (USA)
  • Anthony Gal, teology student (Australia)
  • Rev. Fr. Jesús Fernández Rodríguez (Spain)
  • Prof. Antonio Ramón Peña Izquierdo, Professor of History and Religion (Spain)
  • Rev. Fr. Donald Bauer (USA)
  • Rev. Fr. Sean Thornton (UK)
  • Michele Ciapetti, Religious (Italy)
  • Rev. Fr. Eusebio Capel, Licentiate in Law (Spain)
  • Very Rev. Canon Gérard Trauchessec (France)
  • Rev. Fr. Gustavo Carlavan (Argentina)
  • Rev. Fr. Daniel Sánchez, pychologist (USA)
  • Patrick Craine, Journalist (Canada)
  • Rev. Fr. Rubén Eduardo Martínez-Cordero (Ecuador)
  • Edgardo Juan Cruz Ramos, President of Una Voce Puerto Rico (Puerto Rico)
  • Rev. Fr. Salvatore Mangatia (Italy)
  • Rev. Fr. Duarte Filipe Andrade Gomes (Portugal)
  • Rev. Fr. Tiziano Trenti (Italy)
  • Prof. Adelia De Miguel, Professor of Psychology at the University of La Laguna (Tenerife, Spain)
  • Stefano Branz, relisgious education teacher (Italy)
  • Rev. Fr. Custodio Ballester (Spain)
  • Andrew Roelands, Seminarian (Canada)
  • Michele Antonelli, Religious (Italy)
  • Rev. Msgr. Raymond Goehring, canon lawyer (USA)
  • Count Francesco Zucchini (Italy)
  • Werner Rothenberger, high scool rector (Germany)
  • Mary Agnew, catholic school teacher (USA)
  • Rev. Fr. Marcello Stanzione, Parish priest (Italy)
  • S.E. Mons. Adriano Langa, OFM, Bishop of Inambane (Mozambique)
  • S.E. Mons. Jonas Kauneckas, Bishop of Panevezys (Lithuania)
  • S.E. Mons. Anthony Lee Kok Hin, Emeritus Bishop of Miri (Malesia)
  • Rev. Don Andrew Pinsent, Priest, Professor and Writer Oxford (UK)
  • Rev. Fr. Štěpán Maria Filip, OP, Theologian, University Professor Olomouc (Czech Republic)
  • Prof. Hermes Rodrigues Nery, President of National Pro-life and Pro-family Association São Bento do Sapucaí – SP (Brazil)
  • Constance Louise Taylor ofs, Catechist Ormond Beach Fl. (USA )
  • Antonio Jesús Rodriguez Cruz , Ombudsman Baesa (Spain)
  • María Carmen Cátedra Rascón, Ombudsman Baesa (Spain)
  • Rev. Fr. Jean Susini, Priest Monaco (Monaco)
  • Prof. Oliver Gottschalk, Religion and Latin Professor Trumau (Austria )
  • Rev. Fr. Simon Ascherl, Parish Priest Ellmau (Austria)
  • Rev. Don Michael Pritz, Parish Priest Ellmau (Austria )
  • ev. Fr. Jaroslav Broz, Theology Professor University of Prague (Czech Republic)
  • Rev. Fr. Vivien Somda Domebeimwin, Priest Innsbruck (Austria)
  • Sister Maria Veronica Lasca , Nun FI Rome (Italy)
  • Rev. Fr. Joseph Galea, Priest Zabbar (Malta)
  • Sister Maria Angelica Pia Ruzzenenti , Nun Verona (Italy)
  • Rev. Fr. Settimio Maria Manelli, Priest Albenga (Italy)
  • Rev. Fr. Robert Farrell, Priest Manchester (UK)
  • Rev. Fr. Prof. Franz Schlegl, Priest Vienna (Austria)
  • Rev. Fr. Parinya Samerpitak , Priest Rome (Italy)
  • Rev. Fr. Antonio Riva, Priest Mazzo di Rho (Mi) (Italy)
  • Prof. Seamus Kane, Religion Professor Glasgow (UK)
  • Rev. Fr. Philipp Faschinger, Priest Thalwil (Swiss)
  • Rev. Fr. Gerhard Schrafstetter, Parish Priest Sonntag (Austria)
  • Rev. Fr. Gerhard Henning, Priest Juscimeira (Brazil)
  • Rev. Fr. Rainer Geuder, Priest Unterlamm (Austria)
  • Rev. Fr. Dr. Adolf Fugel, Priest Kreuzlingen (Swiss)
  • Hans-Jürgen Reichhardt, Catechist Neukirchen an der Enknach (Austria)
  • Rev. Br. Giuseppe Aringoli OFM, Religious Brother Narni (Italy)
  • Rev. Fr. Georg Josef Erhart, Priest Weyarn (Germany)
  • Deacon Johannes (Hans) Reintjes, Deacon Haelen (Netherlands )
  • Prof. Luca Pignataro, Philosophy and History Professor Rome (Italy)
  • Franz Ripplinger, Pastoral Assistant Vorderweidenthal (Germany)
  • Prof. J. Hans Benirschke, Philosophy Professor Ellwangen (Germany)
  • Prof. Marie-Agnès Vrignaud, Professor Fontaine-Simon (France)
  • Deacon Michael Krämer, Religious man Eichstätt (Germany)
  • Rev. Fr. Laurent Koch, Priest Monheim (Germany)
  • Rev. Fr. Theo Irrgang STD, Spiritual Director Cologne (Germany)
  • Deacon Diether Hofmacher, Religious man Nassenfels (Germany)
  • Sister Maria Carmela Mussi , Religious woman FI Frattocchie (Italy)
  • Sister Monica Tan, Religious woman FI Frattocchie (Italy)
  • Sister Maria Gemma Nazareno , Religious woman FI Frattocchie (Italy)
  • Rev. Fr.Vincenzo Pawlos, Priest Alessandria (Italy)
  • Rev. Fr. Roger Ibounigg, Parish Priest Pöllau (Austria)
  • Mark Retter, University Student – Cambridge University Cambridge (UK)
  • Rev. Fr. Peter Irving, Priest Long Beach (USA )
  • Rev. Fr. Stefan Haimerl, Priest Regensburg (Germany)
  • Prof. Ladislav Starek, Technology University of Bratislava Bratislava (Slovakia )
  • Felizitas Küble, Journalist Münster (Germany)
  • Rev. Fr. Ladis Cizik, Priest Pittsburgh (USA )
  • Prof. Matteo Salonia, University Professor Liverpool UK (UK)
  • Deacon Dr. Martin Hofer, Religion Professor Melk (Austria)
  • Sister Maria Maximiliana Kama, Religious woman FI Avellino (Italy)
  • Sister Maria Michela Cozzolino , Religious woman FI Roma (Italy)
  • Sister Maria Gemma Faiella , Religious woman FI Roma (Italy)
  • Prof. Arturo López Quintela, University Chemistry-Physics Professor Compostella Santiago d.C. (Spain)
  • Rev. Fr. Michele Capodiferro, Priest Gravina in Puglia (Italy)
  • Alessandro Calderoni, Seminarian Tulsa (USA )
  • Prof. Derik Castillo Guajard , Metropolitan Autonomous Univ. Toluca (Mexico)
  • Rev. Fr. Felice Prosperi, Priest San Ginesio (Italy)
  • Mauro Visigalli, Lawyer Codogno (Italy)
  • Sister Maria Assumpta Rodriguez , Religious woman FI Roma (Italy)
  • Rev. Fr. Leonardo Sacco, S. Maria Assunta Archipriest Pietrabbondante (Italy)
  • Sister Maria Pia Chiara Bosco , Religious woman FI Rome (Italy)
  • Rev. Fr. Erich Markus Kuen, Priest Tulln (Austria )
  • Prof. Francesca Romana Poleggi, Teacher and Writer Fregene (Italy)
  • Prof. Natividad Nebot Calpe, Spanish Language and Literature Valenzia (Spain)
  • Rev. Fr. Jack Geudens, Priest Landsgraaf (Netherlands )
  • Rev. Fr. Norbert van der Sluis, Priest Sint Anthonis (Netherlands)
  • Rev. Fr. Eros Mario Pellizzari , Hospital Chaplain San Donà di Piave (Italy)
  • Prof. Maike Hickson, Professor and Journalist Front Royal (USA )
  • Prof. Robert Hickson , University Professor, Army Officer Ret. Front Royal (USA )
  • Cathleen L. Maley, Consecrated Life Saint Louis Missouri (USA)
  • Prof. Samuel Azasu , Associated University Professor Johannesburg (South Africa)
  • Rev. Fr. Raphaël Granges, Priest Menzingen (Swiss)
  • Jeanne Rudbeck, Editor and Writer Stockholm (Sweden)
  • Rev. Fr. Thomas Dorn, Cincinnati Archdiocese Priest Covington (USA)
  • Rev. Fr. Alfred Kronshage Bäcker , Priest Irndorf (Germany)
  • Michelle Kaufman, Family Life International NZ Auckland (New Zealand)
  • Sister Maria Pia Peluso, Religious woman FI Alassio (Italy)
  • Rev. Fr. Teodulo Esguerra, Priest Malolos (Philippines)
  • Rev. Fr. Giovanni Ferrara , Padova Diocese Priest Marino (Rm) (Italy)
  • Prof. Ivo Kerže, Philosophy Professor Slovenska Bistrica (Slovenia)
  • Rev. Fr. Christopher Markellos , Priest Somers Point (USA)
  • Kimberly Walters , Sacred Music Director Irving (USA)
  • Sister M. Daniella Pia Potot, Religious woman FI Cebu City (Philippines)
  • Rev. Fr. Juan Benjamín Castro Zavalía, Priest Santiago del Estero (Argentina)
  • Prof. Gianni Borgo, History and Philosophy Professor Milan (Italy)
  • Rev. Fr. Marc Massaer, Priest Dreumel (Netherlands)
  • Rev. Fr. Paolo Pirlo, Priest Manila (Philippines)
  • Rev. Fr. Martin Slaughter, Priest Los Angeles (USA)
  • Rev Brother Jardel Maciel dos Santos, Religious man Varjota (Brazil)
  • Sister M. Santina Pia Labastida, Religious woman FI Agusan del Sur (Philippines)
  • Sister M. Gabriella Avila, Religious woman FI Cebu City (Philippines)
  • Sister Florence Wahome, Religious woman London (UK)
  • On. Nathalie Roy, Writer and journalist Montréal (Canada)
  • Rev. Fr. Martin Laird , Priest Plaucheville (USA)
  • Rev. Fr. Jack Geudens, Priest Landgraaf (Netherlands )
  • Rev. Fr. Louis Di Rocco, Priest Westport (Canada)
  • Rev. Fr. Tam Tran, Priest Silver Spring (USA)
  • Rev. Fr. Daniel Augustine Oppenheimer, CRNJ, Canons Prior of New Jerusalem Charles Town (USA)
  • Sister M. Regina Mietitore, Religious woman FI Alassio (Italy)
  • Sister M. Teresa Ortega, Religious woman FI Naga City (Philippines)
  • Sister M. Consolatrice Scozzare, Religious woman FI Red BanK (USA)
  • Mr. Antoni Bańkowski, Film Director Writer Łódź (Poland)
  • Rev. Fr. Fernando Pascual, Priest, Philosophy Professor Rome (Italy)
  • Rev. Fr. Ladislav Šofranko SJ, Priest Bratislava (Slovakia )
  • Rev. Fr. Francisco Javier Sánchez Pereira, Priest El Valle, Melegís (Spain)
  • Sister Maria Maddalena di Gasparro , Religious woman Rome (Italy)
  • Rev. Fr. Giuseppe Mascanzoni, Priest Verona (Italy)
  • Rev. Fr. Jaime Zegarra, Priest Tacna (Peru )
  • Rev. Fr. Jan Lamparski, Parish Priest Velburg (Germany )
  • Mrs. Jeanine Gilis, “31 years faithful divorced” Kontich (Belgium)
  • Conductor Humberto Jorge Aguilera, Lyric Singer and University Professor Aguascalientes (Mexico)
  • Prof. Ricardo Lara Colón, Science Professor Aguascalientes (Mexico)
  • Rev. Fr. Timothy Hufffman, Priest Steubenville (USA)
  • Rev. Fr. Bradley Greer, Priest Steubenville (USA)
  • Rev. Fr. Gilberto Díaz Alvarez , Priest San Luis Potosí (Mexico)
  • Rev. Anastasie Duma, Monk Giroc (Romania)
  • Sister M. Jesusa Ordineza, Religious woman FI Cebu (Philippines)
  • Sister M. Joan Grace Quisio , Religious woman FI San Isidro Leyte (Philippines)
  • Mr. Georges Buscemi, Presidente Québec-Vie Montréal (Canada)
  • Prof. Paulo Roberto Andrada Pacheco , University Professor, Psychologist Sao Paulo (Brazil)
  • Rev. Fr. Walmor Zucco, Dehonian Priest Sao Paulo (Brazil)
  • Rev. Don Carlos Ruiz, Priest Cadalso de los Vidrios (Spain)
  • Rev. Fr. Carlos Valerio Batista de Aguiar, Priest Saquarema (Brazil)
  • Prof. Márcio Andrade, University Professor Belo Horizonte (Brazil)
  • Prof. Rodrigo Konrath, University Professor São Carlos-SC (Brazil )
  • Jean Pierre Moreau, Writer and Journalist Troyes (France )
  • Prof. Augusto Merino, University Professor Santiago (Chile)
  • Prof. Diego Quiñones Estévez, Religion and Catholic Moral Professor, Writer Malaga (Spain)
  • Rev. Fr. Alessandro Fini, Priest Marano sul Panaro (Italy)
  • Prof. Maria José Batista Arenales, University Professor Presidente Prudente (Brazil)
  • Marcos Aurélio Câmara Portilho Castellanos , Federal Attorney São José dos Campos (Brazil)
  • Rev. Fr. Tobias Unnerstål, Parish Priest Gothenburg (Sweden)
  • Rev. Benedict Hardy, Monk Elgin (UK )
  • Prof. Pablo Ramos de Sá, Professor Brasilia (Brazil )
  • Rev. Fr. Robert Pasley, Priest Berlin, NJ (USA)
  • Prof. Mauricio Rohrer, Pedagogy Professor Concordia (Argentina)
  • Rev. Fr. Algirdas Dauknys, Parish Priest Panevezys (Lithuania )
  • Rev. Don Disán Vázquez, Priest Chihuahu (Mexico )
  • Prof. Richard Fell, University Professor, Physics Burlington (USA)
  • Alicia Bruno, Youth Pastoral Coordinator Barnegat (USA)
  • Rev. Fr. Dariusz Pudelko, Priest Snowidza (Poland)
  • Rev. Madre Maria Urdaneta , Religious woman Baybay, Leyte (Philippines)
  • Sister Maria Augustine Fernandez , Religious Lapu-Lapu City (Philippines)
  • Suor Rey-Ann Lourdes Agravante , Religious woman Bicol (Philippines)
  • Wolfgang Goderski, Religion Professor Brilon (Germany)
  • Rev. Fr. Adolphus Iroegbu , Priest Luxemburg (Luxemburg )
  • Religious Community “Mount Thabor Opus Maria (OMTOM)” , Akure, Ondo State (Nigeria)
  • Rev. Fr. Markus Schwald, Priest Candelaria (Philippines)
  • Sister Maria Edith Renfrew, Diocesan Hermit Arisaig (UK)
  • Prof. Maria Polo y Callejo , University Professor Perugia (Italy)
  • Prof. John Heard, Universitario Professor Kirksville (USA)
  • Mr. Dominick Azzara, Pastoral Assistant Clarksville ( USA)
  • Rev. Fr. Giampaolo Garatti, Priest Gallarate (Italy)
  • Prof. Ana Maria Jurado, Catechist and History Professor B.A. Cap.Fed. (Argentina)
  • Deacon William Strathmann , Deacon Pittsburgh (USA)
  • Maria Schultz, Pastoral Coordinator Lake City (USA)
  • Rev. Fr. Raimondo Sanfilippo , Priest Palermo (Italy)
  • Sister M. Coronacion Tigley, Religious woman FI Cebu City (Philippines)
  • Madre Viola Katalin Hegyi, Discalced Carmelite Budapest (Hungary)
  • Danja Kloibhofer , Religion Professor Neumarkt an der Ybbs (Austria)
  • Rev. Friar Rosarrio Joseph Mary Anbessa-Ebanks, Friar Gosport (UK)
  • Rev. Fr. Valero Martínez San Miguel, Priest Lima (Peru )
  • Rev. Fr. Francis Sasinowski, Priest St Aubin-Jersey (UK)
  • Rev. Fr. Daniel Hesko, Parish Priest Middletown (USA)
  • Rev. Canon Adrian Sequeira, Priest Rome (Italy)
  • Sister Maria Fatima Djegui, Religious woman Thio (Benin)
  • Rev. Fr. Carlos Augusto Mesa Posada, Priest Medellin (Colombia)
  • Mr. Alber Frick, Religion Professor Freiburg im Breisgau (Germany)
  • Deacon Thomas Voigt, Deacon Großharthau (Germany)
  • Rev. Don Yves-Marie Couët, Priest Loué (France)
  • Rev. Fr. Vaughn Treco, Priest-Chaplain Plymouth (USA)
  • Sister Maria of the Annunciation OCD, Carmelite Rydebäck (Sweden)
  • Rev. Fr. Lucas Simonutti, Priest Santa Fe (Argentina)
  • Rev. Friar Francis of Sorrowful and Immaculate Heart of Mary , Franciscan Hermit St. Mary’s (USA)
  • Rev. Fr. Andrew Knapik, Priest Cleveland, OH. (USA)

29 mars, 2015

Eglise catholique en Alsace

Classé dans : Non classé — andreadicaffa02 @ 4:54

 

pentecote 2015

rechercher sur le site :
Information de votre paroisse :
——– Choisissez votre paroisse ——–ACHENHEIMADAMSWILLERALBEALLENWILLERALTECKENDORFALTENACHALTENHEIMALTENSTADTALTKIRCHALTORFALTWILLERAMMERSCHWIHRAMMERTZWILLERANDLAUANDOLSHEIMAPPENWIHRARTOLSHEIMARTZENHEIMASCHBACHASPACHASPACH LE BASASPACH LE HAUTASSWILLERATTENSCHWILLERAUBUREAUENHEIMAVENHEIMAVOLSHEIMBAERENDORFBALBRONNBALDENHEIMBALDERSHEIMBALGAUBALLERSDORFBALSCHWILLERBALTZENHEIMBAN DE LA ROCHEBANTZENHEIMBAREMBACHBARRBARTENHEIMBARTENHEIM LA CHAUSSEEBASSEMBERGBATTENHEIMBATZENDORFBEBLENHEIMBEHLENHEIMBEINHEIMBELLAMAGNYBENDORFBENFELDBENNWIHRBERENTZWILLERBERG ET THALBERGBIETENBERGHEIMBERGHOLTZBERGHOLTZ-ZELLBERNARDSWILLERBERNARDVILLEBERNOLSHEIMBERNWILLERBERRWILLERBERSTETTBERSTHEIMBETSCHDORFBETTENDORFBETTLACHBETTWILLERBIBLISHEIMBIEDERTHALBIESHEIMBIETLENHEIMBILTZHEIMBILWISHEIMBINDERNHEIMBIRKENWALDBIRLENBACHBISCHHEIM CHRIST ROIBISCHHEIM ST LAURENTBISCHHOLTZBISCHOFFSHEIMBISCHWIHRBISCHWILLERBISELBISSERTBITSCHHOFFENBITSCHWILLER THANNBLAESHEIMBLANCHERUPTBLIENSCHWILLERBLODELSHEIMBLOTZHEIMBOERSCHBOESENBIESENBOLLWILLERBOLSENHEIMBOOFZHEIMBOOTZHEIMBOSSELSHAUSENBOSSENDORFBOURBACH LE BASBOURBACH LE HAUTBOURG BRUCHEBOURGHEIMBOUXWILLER 67BOUXWILLER 68BRECHAUMONTBREITENAUBREITENBACHBREITENBACH (68)BREMMELBACHBRETTENBREUSCHWICKERSHEIMBRINCKHEIMBRUEBACHBRUMATHBRUNSTATT S GEORGESBRUNSTATT STE ODILEBUETHWILLERBUHLBUHLBURBACHBURNHAUPT LE BASBURNHAUPT LE HAUTBUSCHWILLERBUSTBUSWILLERBUTTENCARSPACHCERNAYCHALAMPECHATENOISCHAVANNES SUR L’ETANGCLEEBOURGCLIMBACHCOLMAR – SAINT ANTOINECOLMAR – SAINT JOSEPHCOLMAR – SAINT LEONCOLMAR – SAINT PAULCOLMAR – SAINTE MARIECOLMAR – ST MARTINCOLMAR ST FRANCOIS D’ASSISECOLMAR-ST VINCENT DE PAULCOLROY LA ROCHECOSSWILLERCOURTAVONCRASTATTCROETTWILLERDACHSTEINDAHLENHEIMDAHLUNDENDAMBACHDAMBACH LA VILLEDANGOLSHEIMDANNEMARIEDAUBENSANDDAUENDORFDEHLINGENDESSENHEIMDETTWILLERDIDENHEIMDIEBOLSHEIMDIEDENDORFDIEFFENBACH AU VALDIEFFENBACH L. WOERTHDIEFFENTHALDIEFMATTENDIEMERINGENDIETWILLERDIMBSTHALDINGSHEIMDINSHEIM SUR BRUCHEDOLLERENDOMFESSELDONNENHEIMDORLISHEIMDOSSENHEIMDOSSENHEIM/ZINSELDRACHENBRONNDRULINGENDRUSENHEIMDUNTZENHEIMDUPPIGHEIMDURLINSDORFDURMENACHDURNINGENDURRENBACHDURRENENTZENDURSTELDUSENBACHDUTTLENHEIMEBERBACHEBERBACH SELTZEBERSHEIMEBERSMUNSTERECKARTSWILLERECKBOLSHEIMECKWERSHEIMEGLINGENEGUISHEIMEICHHOFFENELBACHELSENHEIMEMLINGENENGWILLERENSISHEIMENTZHEIMEPFIGERCKARTSWILLERERGERSHEIMERNOLSHEIMERNOLSHEIM-LES-SAVERNEERSTEINESCHAUESCHBACHESCHBACH AU VALESCHBOURGESCHENTZWILLERESCHWILLERETEIMBESETTENDORFEYWILLERFALKWILLERFEGERSHEIMFELDBACHFELDKIRCHFELLERINGFERRETTEFESSENHEIMFESSENHEIM LE BASFISLISFLAXLANDENFLEXBOURGFOLGENSBOURGFORSTFELDFORSTHEIMFORT LOUISFORTSCHWIHRFOUCHYFRANKENFRECONRUPTFRELANDFRIEDOLSHEIMFRIESENFRIESENHEIMFROENINGENFROESCHWILLERFROHMUHLFULLERENFURCHHAUSENFURDENHEIMGALFINGUEGAMBSHEIMGEISHOUSEGEISPITZENGEISPOLSHEIMGEISPOLSHEIM GAREGEISWASSERGEISWILLERGERSTHEIMGERTWILLERGEUDERTHEIMGILDWILLERGIMBRETTGINGSHEIMGOERLINGENGOERSDORFGOLDBACHGOMMERSDORFGOTTENHOUSEGOTTESHEIMGOUGENHEIMGOXWILLERGRANDFONTAINEGRASSENDORFGRAUFTHALGRENDELBRUCHGRENTZINGENGRESSWILLERGRIESGRIESBACHGRIESBACH AU VALGRIESHEIM PRES MOLSHEIMGRIESHEIM SUR SOUFFELGRUNENWALDGRUSSENHEIMGUEBERSCHWIHRGUEBWILLER – NOTRE-DAMEGUEBWILLER – SAINT LEGERGUEMARGUEVENATTENGUEWENHEIMGUMBRECHTSHOFFENGUNDERSHOFFENGUNDOLSHEIMGUNGWILLERGUNSBACHGUNSTETTHABSHEIMHACHIMETTEHAEGENHAGENBACHHAGENTHAL LE BASHAGENTHAL LE HAUTHAGUENAU – SAINT-GEORGESHAGUENAU – SAINT-JOSEPHHAGUENAU – SAINT-NICOLASHANDSCHUHEIMHANGENBIETENHARSKIRCHENHARTHOUSEHARTMANNSWILLERHATMATTHATTENHATTSTATTHAUSGAUENHECKENHEGENEYHEGENHEIMHEIDOLSHEIMHEIDWILLERHEILIGENBERGHEILIGENSTEINHEIMERSDORFHEIMSBRUNNHEITERENHEIWILLERHELFRANTZKIRCHHENFLINGENHENGWILLERHERBITZHEIMHERBSHEIMHERMERSWILLERHERRLISHEIMHERRLISHEIM P/COLMARHERSBACHHESINGUEHESSENHEIMHETTENSCHLAGHILSENHEIMHINDISHEIMHINDLINGENHINSBOURGHINSINGENHINTERFELDHIPSHEIMHIRSCHLANDHIRSINGUEHIRTZBACHHIRTZFELDENHOCHFELDENHOCHSTATTHOCHSTETTHOELSCHLOCHHOENHEIMHOERDTHOFFENHOHATZENHEIMHOHENGOEFTHOHFRANKENHEIMHOHRODHOHWILLERHOLTZHEIMHOLTZWIHRHOMBOURGHORBOURG WIHRHOUSSENHUNAWIHRHUNDSBACHHUNINGUEHUNSPACHHURTIGHEIMHUSSEREN LES CHATEAUXHUSSEREN WESSERLINGHUTTENDORFHUTTENHEIMICHTRATZHEIMILLFURTHILLHAEUSERNILLKIRCH GRAFF N DAMEILLKIRCH GRAFFENSTADENILLZACHIMBSHEIMINGENHEIMINGERSHEIMINGOLSHEIMINGWILLERINNENHEIMIRMSTETTISSENHAUSENISSENHEIMITTERSWILLERITTLENHEIMJEBSHEIMJETTERSWILLERJETTINGENJUNGHOLTZ-THIERENBACHKAIDENBOURGKALTENHOUSEKAPPELENKATZENTHALKAUFFENHEIMKAYSERSBERGKEFFENACHKEFFENDORFKEMBSKEMBS LOECHLEKERTZFELDKESKASTELKESSELDORFKIENHEIMKIENTZHEIMKIFFISKILSTETTKINDWILLERKINGERSHEIM – S. ADELPHEKINGERSHEIM – STE ELISABETHKINTZHEIMKIRCHBERGKIRCHHEIMKIRRBERGKIRRWILLERKLEINFRANKENHEIMKLEINGOEFTKLINGENTHALKNOERINGUEKNOERSHEIMKOESTLACHKOETZINGUEKOGENHEIMKOLBSHEIMKRAUTERGERSHEIMKRAUTWILLERKRIEGSHEIMKRUTHKUHLENDORFKUNHEIMKURTZENHOUSEKUTTOLSHEIMKUTZENHAUSENLA BROQUELA CLAQUETTELA PETITE PIERRELA VANCELLELA WALCKLA WANTZENAULABAROCHELALAYELAMPERTHEIMLAMPERTSLOCHLANDERSHEIMLANDSERLANGENSOULTZBACHLAPOUTROIELARGITZENLAUBACHLAUTENBACHLAUTENBACH-ZELLLAUTERBOURGLAUWLE BONHOMMELE HOHWALDLEIMBACHLEITERSWILLERLEMBACHLEUTENHEIMLEVONCOURTLEYMENLICHTENBERGLIEBENSWILLERLIEBSDORFLIEPVRELIGSDORFLIMERSHEIMLINGOLSHEIM S JEAN BAPTISTELINGOLSHEIM STE CROIXLINSDORFLINTHALLIPSHEIMLITTENHEIMLIXHAUSENLOBSANNLOCHWILLERLOGELBACH-WINTZENHEIMLOGELHEIMLOHRLORENTZENLUCELLELUEMSCHWILLERLUPSTEINLUTRANLUTTENBACH PRES MUNSTERLUTTERLUTTERBACHLUTZELHOUSEMACKENHEIMMACKWILLERMAENNOLSHEIMMAGNYMAGSTATT LE BASMAGSTATT LE HAUTMAISONSGOUTTEMALMERSPACHMANSPACHMARCKOLSHEIMMARIENTHALMARLENHEIMMARMOUTIERMASEVAUXMATTSTALLMATZENHEIMMEISTRATZHEIMMELSHEIMMEMMELSHOFFENMENSCHHOFFENMERKWILLER PECHELBRONNMERTZENMERTZWILLERMERXHEIMMETZERALMEYENHEIMMICHELBACHMICHELBACH LE BASMICHELBACH LE HAUTMIETESHEIMMINVERSHEIMMITSCHDORFMITTELBERGHEIMMITTELHAUSBERGENMITTELHAUSENMITTELSCHAEFFOLSHEIMMITTELWIHRMITTLACHMITZACHMODENHEIMMOERNACHMOLLAUMOLLKIRCHMOLSHEIMMOMMENHEIMMONSWILLERMONT STE ODILEMONTREUX JEUNEMONTREUX VIEUXMOOSCHMOOSLARGUEMORSBRONNMORSCHWILLERMORSCHWILLER LE BASMORTZWILLERMOTHERNMUESPACHMUESPACH LE HAUTMUHLBACH SUR BRUCHEMUHLBACH SUR MUNSTERMULHAUSENMULHOUSE – SACRE-COEURMULHOUSE – SS.PIERRE & PAULMULHOUSE BOURTZWILLERMULHOUSE DORN  S.FRANC.D’ASSISEMULHOUSE DORN S BARTHELEMYMULHOUSE DORN S LUCMULHOUSE DORNACH STE THERESEMULHOUSE ST ETIENNEMULHOUSE ST FRIDOLINMULHOUSE ST JEAN BOSCOMULHOUSE ST JOSEPHMULHOUSE STE GENEVIEVEMULHOUSE STE JEANNE D’ARCMULHOUSE STE MARIEMUNCHHAUSENMUNCHHOUSEMUNDOLSHEIMMUNSTERMUNTZENHEIMMUNWILLERMURBACHMUSSIGMUTTERSHOLTZMUTZENHOUSEMUTZIGNAMBSHEIMNATZWILLERNEEWILLERNEHWILLERNEUBOISNEUF BRISACHNEUGARTHEIMNEUHAEUSELNEUNHOFFENNEUNKIRCHNEUVE EGLISENEUWILLERNEUWILLER LA ROCHENEUWILLER LES SAVERNENIEDERALTDORFNIEDERBRONN LES BAINSNIEDERBRUCKNIEDERENTZENNIEDERHASLACHNIEDERHAUSBERGENNIEDERHERGHEIMNIEDERLAUTERBACHNIEDERMODERNNIEDERMORSCHWIHRNIEDERNAINIEDERROEDERNNIEDERSCHAEFFOLSHEIMNIEDERSEEBACHNIEDERSOULTZBACHNIEDERSTEINBACHNIFFERNORDHEIMNORDHOUSENOTHALTENOBENHEIMOBERBRONNOBERBRUCKOBERDORF (67)OBERDORF (68)OBERENTZENOBERHASLACHOBERHAUSBERGENOBERHERGHEIMOBERHOFFENOBERHOFFEN SUR MODEROBERKUTZENHAUSENOBERLARGOBERLAUTERBACHOBERMODERNOBERMORSCHWIHROBERMORSCHWILLEROBERNAIOBERROEDERNOBERSAASHEIMOBERSCHAEFFOLSHEIMOBERSOULTZBACHOBERSTEINBACHODERENODRATZHEIMOERMINGENOFFENDORFOFFENHEIMOFFWILLEROHLUNGENOHNENHEIMOHNHEIMOLTINGUEOLWISHEIMORBEYORBEY LES HUTTESORBEY PAIRISORSCHWIHRORSCHWILLEROSENBACHOSTHEIMOSTHOFFENOSTHOUSEOSTWALDOTTERSTHALOTTERSWILLEROTTMARSHEIMOTTROTTOTTWILLERPETERSBACHPETIT LANDAUPFAFFENHEIMPFAFFENHOFFENPFALZWEYERPFASTATTPFETTERHOUSEPFETTISHEIMPFULGRIESHEIMPLAINEPLOBSHEIMPREUSCHDORFPRINTZHEIMPUBERGPULVERSHEIMQUATZENHEIMRAEDERSDORFRAEDERSHEIMRAMMERSMATTRANGEN-MITTELKURTZRANRUPTRANSPACHRANSPACH LE BASRANSPACH LE HAUTRANTZWILLERRATZWILLERRAUWILLERREGUISHEIMREICHSFELDREICHSHOFFENREICHSTETTREIMERSWILLERREINHARDSMUNSTERREININGUEREIPERTSWILLERREITWILLERRETSCHWILLERRETZWILLERREUTENBOURGREXINGENRHINAURIBEAUVILLERICHTOLSHEIMRICHWILLERRIEDHEIMRIEDISHEIM – ST J. BAPTISTERIEDISHEIM – STE. AFRERIEDISHEIM N DAME PERP SECORIEDSELTZRIEDWIHRRIESPACHRIMBACH PRES GUEBWILLERRIMBACH PRES MASEVAUXRIMBACH-ZELLRIMSDORFRINGELDORFRINGENDORFRIQUEWIHRRITTERSHOFFENRIXHEIMRIXHEIM ILE NAPOLEONRODERENRODERNROESCHWOOGROGGENHOUSEROHRROHRWILLERROMAGNYROMANSWILLERROMBACHROMBACH LE FRANCROPPENHEIMROPPENTZWILLERRORSCHWIHRROSENAUROSENWILLERROSENWILLERROSHEIMROSSFELDROSTEIGROTHAUROTHBACHROTTROTTELSHEIMROUFFACHROUNTZENHEIMRUEDERBACHRUELISHEIMRUMERSHEIMRUMERSHEIM LE HAUTRUSSRUSTENHARTSAALESSAASENHEIMSAESSOLSHEIMSAINT AMARINSAINT BERNARDSAINT COSMESAINT HIPPOLYTESAINT JEAN SAVERNESAINT LOUIS – N.D. DE PAIXSAINT LOUIS – ST-LOUISSAINT LOUIS BOURGFELDENSAINT MARTINSAINT MAURICESAINT NABORSAINT PIERRESAINT PIERRE BOISSAINT ULRICHSAINTE CROIX EN PLAINESAINTE MARIE AUX MINESSALENTHALSALMBACHSANDSARRE UNIONSARREWERDENSAULXURESSAUSHEIMSAVERNESCHAEFFERSHEIMSCHAFFHOUSESCHAFFHOUSE SUR ZORNSCHALKENDORFSCHARRACHBERGHEIMSCHEIBENHARDSCHERLENHEIMSCHERWILLERSCHILLERSDORFSCHILTIGHEIM – STE FAMILLESCHILTIGHEIM IMM. CONCEPTIONSCHIRLENHOFSCHIRMECKSCHIRRHEINSCHLEITHALSCHLIERBACHSCHNERSHEIMSCHOENAUSCHOENBOURGSCHOENENBOURGSCHOPPERTENSCHWABWILLERSCHWARTZBACHSCHWEBWILLERSCHWEIGHOUSESCHWEIGHOUSE PRES THANNSCHWEIGHOUSE S/MODERSCHWENHEIMSCHWINDRATZHEIMSCHWOBENSCHWOBSHEIMSEEBACHSELESTAT NOTRE DAME DE PAIXSELESTAT ST GEORGESSELTZSENGERNSENTHEIMSEPPOIS LE BASSEPPOIS LE HAUTSERMERSHEIMSESSENHEIMSEWENSICKERTSIEGENSIERENTZSIEWILLERSIGOLSHEIMSILTZHEIMSINGRISTSONDERNACHSONDERSDORFSOPPE LE BASSOPPE LE HAUTSOUFFELWEYERSHEIMSOUFFLENHEIMSOULTZSOULTZ LES BAINSSOULTZ SOUS FORETSSOULTZBACH LES BAINSSOULTZERENSOULTZMATTSPACHBACHSPECHBACH LE BASSPECHBACH LE HAUTST BLAISE LA ROCHEST LOUIS LA CHAUSSEE S PIERRESTAFFELFELDENSTAFFELFELDEN ROSSALMENDSTAMPOUMONTSTATTMATTENSTE CROIX AUX MINESSTE MARIE MINES – ST LOUISSTEIGESTEINBACHSTEINBOURGSTEINBRUNN LE BASSTEINBRUNN LE HAUTSTEINSELTZSTEINSOULTZSTERNENBERGSTETTENSTILLSTORCKENSOHNSTOSSWIHRSTOTZHEIMSTRASBOURG – BON PASTEURSTRASBOURG – CATHEDRALESTRASBOURG – ELSAUSTRASBOURG – N.D. LOURDESSTRASBOURG – SACRE COEURSTRASBOURG – ST CHRISTOPHESTRASBOURG – ST JEAN BAPTISTESTRASBOURG – ST JEAN BOSCOSTRASBOURG – ST LOUISSTRASBOURG – ST VINCENT PAULSTRASBOURG – STE MADELEINESTRASBOURG – T. STE TRINITESTRASBOURG CHRIST RESSUSCITESTRASBOURG ROB. – ST LOUISSTRASBOURG ST ALOYSESTRASBOURG ST AMANDSTRASBOURG ST ANTOINESTRASBOURG ST ARBOGASTSTRASBOURG ST BENOITSTRASBOURG ST BERNARDSTRASBOURG ST FLORENTSTRASBOURG ST IGNACESTRASBOURG ST JOSEPHSTRASBOURG ST LEONSTRASBOURG ST MAURICESTRASBOURG ST PIERRE LE JEUNESTRASBOURG ST PIERRE VIEUXSTRASBOURG ST URBAINSTRASBOURG STE BERNADETTESTRASBOURG STE JEANNE D’ARCSTRUETHSTRUTHSTUNDWILLERSTUTZHEIMSUNDHOFFENSUNDHOUSESURBOURGTAGOLSHEIMTAGSDORFTHALTHANNTHANNENKIRCHTHANVILLETIEFFENBACHTRAENHEIMTRAUBACH LE BASTRAUBACH LE HAUTTRIEMBACH AU VALTRIMBACHTROIS EPISTRUCHTERSHEIMTURCKHEIMUBERACHUEBERSTRASSUFFHEIMUFFHOLTZUHLWILLERUHRWILLERUNGERSHEIMURBEISURBESURMATTURSCHENHEIMUTTENHEIMUTTENHOFFENUTTWILLERVALFFVENDENHEIMVIEUX FERRETTEVIEUX THANNVILLAGE NEUFVILLEVOEGTLINSHOFFENVOELLERDINGENVOGELGRUNVOLGELSHEIMVOLKSBERGWACKENBACHWAHLBACHWAHLENHEIMWALBACHWALBOURGWALDHAMBACHWALDIGHOFFENWALDOLWISHEIMWALHEIMWALTENHEIMWALTENHEIM SUR ZORNWANGENWANGENBOURG-ENGENTHALWASSELONNEWASSERBOURGWATTWILLERWECKOLSHEIMWEGSCHEIDWEILERWEINBOURGWEISLINGENWEITBRUCHWEITERSWILLERWENGELSBACHWENTZWILLERWERENTZHOUSEWESTHALTENWESTHOFFENWESTHOUSE MARMOUTIERWESTHOUSE PRES BENFELDWETTOLSHEIMWEYERWEYERSHEIMWICKERSCHWIHRWICKERSHEIMWIDENSOLENWIHR AU VALWILDENSTEINWILDERSBACHWILLERWILLER SUR THURWILLGOTTHEIMWILSHAUSENWILWISHEIMWIMMENAUWINGENWINGEN SUR MODERWINGERSHEIMWINKELWINTERSHOUSEWINTZENBACHWINTZENHEIMWINTZENHEIM (68)WINTZFELDENWISCHESWISSEMBOURGWITTELSHEIM – S. MICHELWITTELSHEIM AMELIE II CH ROWITTELSHEIM GRAF. N.D. ROS.WITTELSHEIM LANGENZUGE J.BOSWITTENHEIM – SAINTE BARBEWITTENHEIM – SAINTE MARIEWITTENHEIM FERN. ANNA S.CHRWITTENHEIM JEUNE BOISWITTERNHEIMWITTERSDORFWITTERSHEIMWITTISHEIMWIWERSHEIMWOELLENHEIMWOERTHWOLFERSDORFWOLFGANTZENWOLFISHEIMWOLFSKIRCHENWOLSCHHEIMWOLSCHWILLERWOLXHEIMWUENHEIMZAESSINGUEZEHNACKERZEINHEIMZELLENBERGZELLWILLERZELSHEIMZILLISHEIMZIMMERBACHZIMMERSHEIMZINSWILLERZITTERSHEIMZOEBERSDORFZUTZENDORF
AGENDA DES MANIFESTATIONS
Mars2015
L Ma Me J V S D
23 24 25 26 27 28 1
2 3 4 5 6 7 8
9 10 11 12 13 14 15
16 17 18 19 20 21 22
23 24 25 26 27 28 29
30 31 1 2 3 4 5
NOTRE ÉMISSION RADIO
btn radio rencontre 2

Écoutez Rencontre Catholique dans son intégralité
Retrouvez les anciennes émissions

btn webtv

btn projet diocesain2014

1000ans-cathedrale

maladies curie

Eglise catholique en Alsace btn_actualites

Déclarations de l'Evêque

Don en ligne

Newsletter

btn messesinfos

Partez en pélerinage

Église Catholique en France

www.eglise.catholique.fr

www.eglisse.catholique.fr

btn rencontrer-jesus

btn findevie

btn_blogBioethique

www.eglisse.catholique.fr

Vous êtes ici : Accueil

banniere-a-la-une

Prions aux intentions de l’Église Universelle :
- Prions pour que, en cette année dédiée à la vie consacrée, les religieuses et les religieux redécouvrent la joie de suivre le Christ et s’engagent avec zèle au service des pauvres.

Prions pour l’évangélisation :
- Prions pour que tous les croyants et tous les hommes de bonne volonté collaborent à la paix.

Mgr Martin Bogner, vicaire général, est décédé subitement

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 13:28 Publié le vendredi 27 mars 2015 10:08

martin bogner webMgr Martin Bogner, vicaire général du diocèse de Strasbourg, est décédé subitement jeudi 26 mars aux environs de 17h, victime d’un arrêt cardiaque, alors qu’il trouvait dans la salle d’attente de son cardiologue pour un rendez-vous médical. Les pompiers appelés d’urgence n’ont pas réussi le sauver.

Mgr Grallet, archevêque de Strasbourg actuellement à Lourdes pour la Conférence des évêques de France a appris avec énormément de tristesse la nouvelle, perdant un compagnon fidèle et précieux, portant la responsabilité, entre autre, des ressources humaines du diocèse.

Les obsèques de Mgr Bogner seront présidées par Mgr Grallet le mercredi 1er avril à 14h30 en la cathédrale de Strasbourg. L’inhumation suivra au cimétière de Aschbach.

Monseigneur Martin BOGNER, né le 27 janvier 1949 à Aschbach, de parents cultivateurs.

Messe chrismale : le mardi 31 mars à 18h30

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:46 Publié le vendredi 27 mars 2015 14:15

messechrismaleLa messe chrismale sera célébrée le mardi 31 mars à 18h30 en la cathédrale de Strasbourg.

Bernard Xibaut en précise la signification.

Parmi les célébrations de la Semaine Sainte figure à une place originale celle de la Messe chrismale. Elle a ceci de particulier qu’elle est unique dans chaque diocèse et qu’elle doit être célébrée en principe le matin du Jeudi Saint, sachant qu’il est possible, pour des raisons pastorales, de l’anticiper à un autre jour de la Semaine Sainte. Dans notre diocèse, elle est célébrée le soir du Mardi Saint.

Trois points méritent d’être particulièrement éclaircis car ils sont souvent mal compris :

5è centenaire de la naissance de Sainte Thérèse d’Avila

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:57 Publié le vendredi 27 mars 2015 09:52

thérès davilaL’Ordre du Carmel déchaussé célèbre le samedi 28 mars le cinquième centenaire de la naissance de sa fondatrice, Sainte Thérèse de Jésus, Docteur de l’Eglise, plus connue sous le nom de Sainte Thérèse d’Avila.

Le Carmel de Marienthal invite à fêter cet anniversaire lors d’une célébration eucharistique au Carmel le samedi 28 mars à 8h15.

Vivre les jours saints avec les séminaristes

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:40 Publié le vendredi 27 mars 2015 14:40

triduum seminaireTu es un jeune homme de plus de 17 ans et souhaites vivre durant les trois jours les plus importants de l’année chrétienne un moment fort de prière d’enseignement et de vie fraternelle joyeuse en compagnie des futurs prêtres du diocèse de Strasbourg. Viens rejoindre les séminaristes du jeudi saint au dimanche de Pâques.

Ce temps fort se déroule au Grand Séminaire Sainte Marie Majeure de Strasbourg et les offices sont célébrés à la cathédrale Notre-Dame de Strasbourg autour de notre archevêque.

Du jeudi 2 avril à 18h au dimanche 5 avril après le déjeuner. Libre participation aux frais

Inscription auprès du P. Didier Dehan 2 rue des Frères à Strasbourg. Tél : 03 88 36 03 28

Après un tiers de millénaire, demeurer ensemble

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:56 Publié le vendredi 27 mars 2015 14:44

respirePour le vendredi Saint, 3 avril, les deux communautés proposent un chemin de croix oecuménique à 12h départ de Saint-Pierre-le -Jeune protestant, étape au temple Neuf et arrivée à la cathédrale à 13h. Ce même jour à 18h30 Respire, une heure ailleurs propose une médiattion sur le vendredi saint, le déchirement du monde.

Ecouter l’interview de Rudi Popp, pasteur du temple Neuf

Méditation autour de la Semaine Sainte

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 16:00 Publié le vendredi 27 mars 2015 14:24

semainesainteEn ouverture de la Semaine Sainte, nous vous proposons la méditation de François Wernert, curé de Saint-Nicolas et de Saint Joseph à Haguenau :

21 septembre, 2013

Ordre de Malte et mission dans 3 Centres de Rétention Administrative

Classé dans : Non classé — andreadicaffa02 @ 21:38

Centres de Rétention Administrative

Pour répondre à son obligation d’information et d’accompagnement juridique des personnes retenues dans les Centres de Rétention Administrative (CRA), le Ministère de l’Immigration, de l’Identité Nationale et du Développement Solidaire a sélectionné, sur appel d’offre, cinq associations dont l’Ordre de Malte France, qui interviennent depuis le 1er janvier 2010 dans les CRA de Lille (59), Metz (57) et Geispolsheim (67).

Retrouvez tous les communiqués de presse concernant nos actions dans les Centres de Rétention Administrative

Une coordination nationale

  • assure l’encadrement et le suivi des équipes d’accompagnateurs juridiques des 3 CRA ;
  • est l’interface des partenaires associatifs et institutionnels ;
  • active des réseaux d’interprètes, de bénévoles, d’associations…

 

Au niveau local

Accompagnement juridique

Pour permettre le plein exercice effectif des droits des personnes retenues en application de l’article R. 553-14 du CESEDA, l’Ordre de Malte France assure des prestations d’accueil, d’information, de conseil et d’accompagnement juridique.
Dans les centres de rétention de Lille-Lesquin, Metz et Strasbourg-Geispolsheim, les équipes de juristes de l’Ordre de Malte France informent les personnes retenues de leurs droits et, à leur demande, les accompagnent dans leurs démarches de :

  • recours contentieux auprès des juridictions administratives et judiciaires ;
  • recours contentieux d’urgence : référés liberté, référés suspension, saisine CEDH (article 39), ;
  • recours gracieux ou hiérarchiques ;
  • demande d’asile ou de réexamen ;
  • toute autre démarche permettant l’exercice des droits.

L’action des accompagnateurs juridiques se concentre en grande partie dans les premiers jours de la rétention, compte tenu de la brièveté des délais imposés par la procédure.

guillements gris ouvrIl m’arrive de penser que je ne suis pas seulement juriste mais à certains égards secouriste car l’urgence fait partie intégrante des conditions dans lesquelles nous exerçons notre mission d’accompagnateur juridique en rétention. Les délais d’exercice du droit au recours et le nombre d’arrivée, nous imposent de réagir rapidement et efficacement. Le Centre de rétention de Metz accueille des enfants de tout âge, des femmes et des hommes, de toute nationalité. Nous devons nous adapter face à toutes les situations d’urgence, qu’elles soient administratives, juridiques, médicales ou sociales et apporter une solution optimale, afin de respecter les droits des personnes retenues.guillements gris ferm

Intervenante du CRA de Metz

Les équipes de l’Ordre de Malte France dans les CRA

Strasbourg-Geispolsheim

Mail

Tél fixe : 03 88 39 70 08

Fax : 03 88 84 83 65

Tél portable : 06 88 36 31 99

Horaires des permanences physiques de l’OMF :

  • Le lundi de 9h à 12h et de 13h à 17h
  • Du mardi au vendredi de 9h à 12h et de 13h à 17h30
  • Le samedi de 9h à 12h

En dehors de ces horaires de présence, une permanence téléphonique est assurée sur le téléphone portable les samedis de 14h à 17h et les dimanches et jours fériés de 11h à 16h.

 

Lille-Lesquin

Mail

Tel fixe : 03 20 85 25 59

Fax : 03 20 85 24 92

Portable : 06 88 36 89 20

Horaires des permanences physiques de l’OMF :

  • Lundi de 9h à 12h et de 13h30 à 17h30
  • Mardi au vendredi de 9h à 12h et de 13h30 à 18h
  • Samedi de 9h à 12h et de 13h30 à 17h30

En dehors de ces horaires de présence, une permanence téléphonique est assurée sur le téléphone portable les dimanches et jours fériés de 10h à 18h.

 

Metz-Queuleu

Mail

Tel fixe : 03 87 36 90 08

Fax : 03 87 50 63 98

Portable : 06 88 36 00 03

Horaires des permanences physiques de l’OMF :

  • Lundi de 9h à 12h30 et de 13h30 à 17h00
  • Mardi au vendredi de 9h à 12h30 et de 13h30 à 17h30
  • Samedi de 9h à 12h30 et de 13h30 à 17h00

En dehors de ces horaires de présence, une permanence téléphonique est assurée sur le téléphone portable les dimanches et jours fériés de 10h à 18h.

 

Les associations en charge de l’accompagnement juridique dans les centres de rétention administrative en France Métropolitaine :

1 juillet, 2012

Mots clefs mois de juin 2012 Mots-clefs Moteur de recherche 1 11 2.58 (non fournis) Google 2 6 1.41 roland garros plus belle la vie unblog Google 3 5 1.17 saint andré caffa Google 4 5 1.17 padre pinkus Google 5 5 1.17 www.escrocs.net Google 6 4 0.94 Google 7 4 0.94 Google 8 3 0.70 patriarcat de kerneguez Google 9 3 0.70 caneche du espagne Google Images 10 3 0.70 Google 11 3 0.70 logo federation compagnonnique de france Google 12 3 0.70 Google 13 3 0.70 calendrier liturgique Google Images 14 3 0.70 manoir de kerneguez Google 15 3 0.70 lucio andrade mandula Google Images 16 3 0.70 Google 17 3 0.70 tenente carabinieri Google Images 18 3 0.70 dimanche des rameaux Google Images 19 3 0.70 francis brignon Google 20 3 0.70 ginette buon le mans Google Images Mots-clefs Moteur de recherche 21 3 0.70 Google 22 3 0.70 plus belle la vie déprogrammé Google 23 3 0.70 les eglises catholiques apostoliques et galic Google 24 2 0.47 i servi di maria in italia Google Images 25 2 0.47 Google 26 2 0.47 festa di maria ss della consolatrice palermo Google Images 27 2 0.47 déprogrammations roland garros Google 28 2 0.47 formaposte pour sénior Google 29 2 0.47 + elizbeth @live.co.uk @hotmail.co.uk @aol.co Yahoo 30 2 0.47 association manoir de kerneguez lannion Google 31 2 0.47 pere auzenet Yahoo 32 2 0.47 notre dame de kerneguez activites 2012 Google 33 2 0.47 véjus sainte rita Google 34 2 0.47 browne@yahoo.com@aol.com@hotmail.co.uk »txt »20 Google 35 2 0.47 VITE TSVEI Google Images 36 2 0.47 a25alibo@yahoo.com Yahoo 37 2 0.47 mr andre di italy@hotmail.com.it contatto ema Google 38 2 0.47 cadavres d enfants en syrie Google 39 2 0.47 escrocs.net Google 40 2 0.47 Google Mots-clefs Moteur de recherche 41 2 0.47 eglise orthodoxe autocephale d’europe Yahoo 42 2 0.47 sant’andrea di caffa Google 43 2 0.47 pascual vilaplana associats monkey biz Google Images 44 2 0.47 pere ephrem manoir de’ kerneguez Google 45 2 0.47 marc helfer Google Images 46 2 0.47 manoir de kerneguez Google 47 2 0.47 www.google.it/imgres?um=1 Google Images 48 2 0.47 ANNICK EINHORN Google 49 2 0.47 l eglise orthodoxe seule veritable eglise Google 50 2 0.47 Google 51 2 0.47 plus belle la vie deprogrammee roland garros Google 52 2 0.47 monseigneur carmelo lima Google 53 2 0.47 bertrand marconnet Google 54 2 0.47 ufap strasbourg Google 55 2 0.47 eglise orthodoxe autocephale d’europe Google 56 2 0.47 Association Maison de la Citoyenneté Mondial Google Images 57 2 0.47 une vieille ne court que si une chevre lui vo Google 58 2 0.47 message du père nieuviarts Google 59 2 0.47 come richiedere onoreficenza cavaliere Google 60 2 0.47 eglise orthodoxe autocephale d’europe Mots-clefs Moteur de recherche 61 2 0.47 anita soro@yahoo.com Yahoo 62 2 0.47 Google 63 2 0.47 noel chrétien Google Images 64 2 0.47 Google 65 2 0.47 andy millns mondial motorsport Google Images 66 2 0.47 père d. auzenet Google 67 2 0.47 carmelitane scalzie di vitorchiano Google 68 2 0.47 père dominique auzenet Google 69 2 0.47 vin de messe de l’ardèche Google 70 2 0.47 escrocs.net Google 71 2 0.47 manoir de kerneguez lannion 22 Google 72 1 0.23 bintangjaya@yahoo.com@gmail.com@hotmail.com@y Yahoo 73 1 0.23 vitto e alloggio in conventi a napoli Google 74 1 0.23 saint andré de caffa Google 75 1 0.23 shappero shoes miami florida Yahoo 76 1 0.23 priere de saint andre de crete Google 77 1 0.23 monastei e chiese ss trinita ortodoxe abbando Google 78 1 0.23 Google 79 1 0.23 patriacat de kerneguez Google 80 1 0.23 marc helferMots-clefs Moteur de recherche 81 1 0.23 come richiedere il cavalierato Google 82 1 0.23 i priori maggiori monastero di pontida Yahoo 83 1 0.23 manoir de kerneguez Google 84 1 0.23 ordine sant’andrea Google 85 1 0.23 comment emmerder la sncf Google 86 1 0.23 éparchie apostolique des rites orientaux Google 87 1 0.23 Raffaele G@yahoo.co.uk Google 88 1 0.23 www.google.ca/imgres?hl=fr Google Images 89 1 0.23 calendrier liturgique Google Images 90 1 0.23 KERNEGUEZ Google Images 91 1 0.23 « maurice auberger » évêque Google 92 1 0.23 0296431648 Google 93 1 0.23 cognomi ebrei in calabria palermo gaeta Google 94 1 0.23 validite de l episcopat de monseigneur andre Google 95 1 0.23 Sermon, @YAHOO.nl,@HOTMAILnl,@MAIL.nl Yahoo 96 1 0.23 rosa esquenasi jazz grec Google 97 1 0.23 qui va piano va solo proverbe traduction Google 98 1 0.23 proverbe impara l arte e metti lo da parte Google 99 1 0.23 brenda.gasu@yahoo.com Yahoo 100 1 0.23 Ellen Simenoff General Manager Google Images Mots-clefs Moteur de recherche 101 1 0.23 calendrier liturgique Google Images 102 1 0.23 ssusanminister85@gmail.com Yahoo 103 1 0.23 Mgr Michel STAFFIERO Google 104 1 0.23 rameau Google Images 105 1 0.23 padre russo + servi di maria Google 106 1 0.23 pere ephrem carmello Google 107 1 0.23 articles alimentaires publicité mensongaire Google 108 1 0.23 www.google.be/imgres?hl=fr Google Images 109 1 0.23 aelfla vie de saint Martin destous Google 110 1 0.23 madonna di fatima itinerante morimondo Google 111 1 0.23 @YAHOO.CN @yahoo.de @yahoo.FR LEE « 2011″ -SCA Yahoo 112 1 0.23 heiligen andreas kaffa Google 113 1 0.23 (president ) contact @mail.ru, @yahoo.co.in,@ Google 114 1 0.23 Olga.hl@atlas.cz @mail.cz @gmail.cz @web.cz Yahoo 115 1 0.23 Mrg senegal @yahoo.fr @ymail.com Google 116 1 0.23 2012@yahoo.com, @indiatime.com, @ymail.com, @ Google 117 1 0.23 eglise orthodoxe kerneguez mère jeanne Google 118 1 0.23 come richiedere onorificenze cavalierato Google 119 1 0.23 telkomsa.net,yahoo.co.za,rockmail.com Yahoo 120 1 0.23 madre suor maria michela clarissa san giovann Goo Mots-clefs Moteur de recherche 121 1 0.23 Google 122 1 0.23 calendrier liturgique Google Images 123 1 0.23 la où il y a un vieillard aucune pirogue Google 124 1 0.23 calendrier liturgique Google Images 125 1 0.23 Google 126 1 0.23 pere auzenet Google 127 1 0.23 lucio pinkus Google 128 1 0.23 jacques nieuviarts blog Google 129 1 0.23 tradure fatti in là che tu mi tingi Google 130 1 0.23 kerneguez Google 131 1 0.23 la classe non è acqua proverbe italien Google 132 1 0.23 proverbes italien deuil Google 133 1 0.23 www.google.co.in/imgres?um=1 Google Images 134 1 0.23 efrem carmelo lima Google 135 1 0.23 chapelle hopital hautepierre Google 136 1 0.23 kerneguez lannion Google 137 1 0.23 une vieille ne court que si une chèvre mange Google 138 1 0.23 convento gaeta ospitalita Google 139 1 0.23 •monastero di san paolobenedettinevia deser Google 140 1 0.23 père jacques nieuvarts assomptioniste Google Google Mots-clefs Moteur de recherche 141 1 0.23 • convento dell’immacolata monache benedett Google 142 1 0.23 apparizione consolatrice degli afflitti goriz Google 143 1 0.23 henry @yahoo.ur@aol.com@msn.com@net.com@hotma Google 144 1 0.23 eglise orthodoxe autocéphale d’europe Google 145 1 0.23 jacques nieuviarts 2012 Google 146 1 0.23 annaba ippona Google 147 1 0.23 monastero di nostra signore di valserena mona Google 148 1 0.23 maison d’arret animaux Google 149 1 0.23 affaire CAFFA Patricia Yahoo 150 1 0.23 come ottenere una onorificenza Google 151 1 0.23 charles@hotmail,live,gmail,yahoo.fr,com 2011 Google 152 1 0.23 Google 153 1 0.23 cavaliere sant andrea di caffa Google 154 1 0.23 don matteo ferrari amandoli contatti x ospita Google 155 1 0.23 sono sono le undici e mezzo e pepeta non si v Google 156 1 0.23 armée du salut chastagner Google 157 1 0.23 gomez-permias@gmx.com @hotmail.com Yahoo 158 1 0.23 un âne affamé avance mieux qu’un lion repus Google 159 1 0.23 iyalla plc ovi com Google Images 160 1 0.23 marc helfer strasbourg Google Mots-clefs Moteur de recherche 161 1 0.23 da chi mi fido, mi guardi dio, da chi non mi Google 162 1 0.23 @yahoo.se @hotmail.com @gmail.com Yahoo 163 1 0.23 escrocs.net Google 164 1 0.23 joe manuel penteado e silva carreira, supreme Google 165 1 0.23 john @yahoo.fr Yahoo 166 1 0.23 nannie bottigheimer + baden, germany Google 167 1 0.23 kerneguez manoir Google 168 1 0.23 proverbes italiens traduits Google 169 1 0.23 Monastero di Santa Grata Monache Bendettine V Google 170 1 0.23 marc helfer Google Images 171 1 0.23 andré de caffa Google 172 1 0.23 primat kerneguez Google 173 1 0.23 succession apostolique mgr de la thibauderie Google 174 1 0.23 dimanches des rameaux Google Images 175 1 0.23 www.google.fr/imgres?um=1 Google Images 176 1 0.23 steve dell @hotmail.fr @live.fr @msn.com @liv Google 177 1 0.23 quel sort plus triste pour un chien que de n’ Google 178 1 0.23 manoir de kerneguez lannion Google 179 1 0.23 santissima trinità padri passionisti napoli Google 180 1 0.23 e-mail contacte directeur @ymail.com @gmail.c Yahoo Google Mots-clefs Moteur de recherche 181 1 0.23 boleman hungarian artist chambery Google 182 1 0.23 Kalpita@rediffmail.com,@bol.net.in Yahoo 183 1 0.23 avec jacques nieuviarts Google 184 1 0.23 femmes prison 2012 Google 185 1 0.23 francis brignon Google 186 1 0.23 vin de messe nicolas Google 187 1 0.23 la padella disse al paiolo : fatti in là che Google 188 1 0.23 Google 189 1 0.23 come ottenere onorificenze Google 190 1 0.23 www escros net Google 191 1 0.23 basilio bertoglio Google 192 1 0.23 wisdom dell @hotmail.fr @live.fr @msn.com @li Google 193 1 0.23 eglise orthodoxe autocéphale d’europe Google 194 1 0.23 sammel in u k @yahoo.co.uk txt 2011 Google 195 1 0.23 jin@yahoo.com@hotmail.com@rediffmail.com@gmai Google 196 1 0.23 une inscription inédite de teano de campanie Google 197 1 0.23 boleman hungarian artist rue basse du chateau Google 198 1 0.23 @ @ @ @ hotmail.com @ yahoo.co.uk @ yahoo.co Google 199 1 0.23 saint andré de caffa Google 200 1 0.23 recherche feuilleton de plus belle la vie du Google Mots-clefs Moteur de recherche 201 1 0.23 padre lucio pinkus Google 202 1 0.23 taillefine mensongere Google Images 203 1 0.23 servi di maria italia meridionale Google 204 1 0.23 raymond kohler diacre Google 205 1 0.23 union chretienne de saint chaumond Google Images 206 1 0.23 eparchie orthodoxe apostolique Google 207 1 0.23 mgr bernard violeau Google 208 1 0.23 patriarche boris 1er Google 209 1 0.23 ordine militare internazionale s.maria di caf Google 210 1 0.23 traduction de Cuor forte Vince cattiva sorte Google 211 1 0.23 giovanni maria taddei Google 212 1 0.23 vraie eglise orthodoxe Google 213 1 0.23 ospitalità monastero suore lecce Google 214 1 0.23 escrocs.net Google 215 1 0.23 publicité taillefine Google Images 216 1 0.23 Michel Abeniacar equity and debt Google Images 217 1 0.23 Jeff @yahoo.com.au « @yahoo.ca » -scam -scammar Yahoo 218 1 0.23 calendrier liturgique Google Images 219 1 0.23 yves mannheimer lycee ampere classe Google 220 1 0.23 come ottenere onorificenze Google Mots-clefs Moteur de recherche 221 1 0.23 mambo basset griffon Google Images 222 1 0.23 dimanche des rameaux Google Images 223 1 0.23 frati servi di maria Google Images 224 1 0.23 negociant vin de messe Google 225 1 0.23 contact @hotmail.fr @yahoo.fr 2012 e-mail no Google 226 1 0.23 calendrier liturgique Google Images 227 1 0.23 l’oiseau apporte le rameau Google Images 228 1 0.23 priorato di san benedetto belbo Google 229 1 0.23 « giovanni maria taddei » Google 230 1 0.23 sussin henri Google Images 231 1 0.23 chiesa siro antiochena basilio bertoglio Google 232 1 0.23 signification du proverbe africain alors que Google 233 1 0.23 on-line gratuiti uomini in cerca di amore e i Google 234 1 0.23 restitution thermes vieil evreux Google Images 235 1 0.23 père d. auzenet Google 236 1 0.23 nancyyedima4@live.com Google 237 1 0.23 « jacques sommet » Google 238 1 0.23 manoir de kerneguez Google 239 1 0.23 mgr théophile cherruault Google 240 1 0.23 convento santa scolastica buggiano castello Google Mots-clefs Moteur de recherche 241 1 0.23 www.google.fr/imgres?num=10 Google Images 242 1 0.23 bonfiglioli pipe bologna Google Images 243 1 0.23 kerneguez manoir Google Images 244 1 0.23 l’eglise orthodoxe autocephale d’europe Google 245 1 0.23 ordine sant’andrea de caffa Google 246 1 0.23 pèlerinage sain augustin algérie Google 247 1 0.23 cazals avocate Google Images 248 1 0.23 manoir de kerneguez lannion Google 249 1 0.23 pere ephrem manoir de’ kerneguez Google 250 1 0.23 buon viso a cattiva sorte traduit Google 251 1 0.23 www zenit org french subscribe html Google 252 1 0.23 Conséquence de l’occultisme Google 253 1 0.23 a testa bianca spesso cervella manca explicat Google 254 1 0.23 Google 255 1 0.23 ordine di sant’andrea di caffa Google 256 1 0.23 ordre malte osj Google 257 1 0.23 calendrier liturgique Google Images 258 1 0.23 étiquette vin de messe Google 259 1 0.23 padre pinkus Google 260 1 0.23 +Calendarier Yahoo Mots-clefs Moteur de recherche 261 1 0.23 Google 262 1 0.23 www.google.com/imgres?start=117 Google Images 263 1 0.23 proverbes italiens traduits Google 264 1 0.23 benedettine vie sant appollinare assisi Yahoo 265 1 0.23 kerneguez manoir Google 266 1 0.23 Monastero di San Domenico Monache Domenicane Google 267 1 0.23 adorazione perpetua del ss. sacramento saler Google 268 1 0.23 les connectés du jour@yahoo.fr @gmail.com @y Google 269 1 0.23 convento di san francesco frati francescani c Google 270 1 0.23 has matheus echene been arrested in hong kong Google 271 1 0.23 ordre malte pontifical osj Google 272 1 0.23 andreadicaffa02.unblog.fr Google 273 1 0.23 proverbe italien sole Google 274 1 0.23 soiree francaise stuttgart 22.06.2012 Google 275 1 0.23 convento della madonna della pace padri devon Google 276 1 0.23 deir rafat Google Images 277 1 0.23 fw 2012@hotmail.fr hotmail.com live.fr@yahoo. Google 278 1 0.23 Google 279 1 0.23 frati serviti di maria napoli Google 280 1 0.23 ordre régulier saint jean terre sainte Google Mots-clefs Moteur de recherche 281 1 0.23 Google 282 1 0.23 pitbull magri Google Images 283 1 0.23 notre dame de follina Google 284 1 0.23 escrocs.net Google 285 1 0.23 y @yahoo.co.th @hotmail.com @aol.com Yahoo 286 1 0.23 www.decennie.org Google 287 1 0.23 « maile@yahoo.hc » @aol.com »@gmail.com » @msn.co Yahoo 288 1 0.23 tap touche st andre apotre Google 289 1 0.23 oliviawillamsd@yahoo.in Google Images 290 1 0.23 col tempo e con la paglia maturano le nespole Google 291 1 0.23 proverbes italien traduits Google 292 1 0.23 la padella disse al paiolo : fatti in là che Google 293 1 0.23 marc helfer strasbourg Google 294 1 0.23 assomptionnistes jacques Google 295 1 0.23 addolorata al molo Google Images 296 1 0.23 néofrancaise Google 297 1 0.23 francis sylvain sikel 17 rue de la colonie pa Google 298 1 0.23 basilio bertoglio Google 299 1 0.23 monaci cistecensi a milano Google 300 1 0.23 frère wright Google

Classé dans : Non classé — andreadicaffa02 @ 20:26

 

 

google-site-verification: googledce923eff1f8acfc.html

 

 

<a href= »http://info.flagcounter.com/M4WA »><img src= »http://s09.flagcounter.com/map/M4WA/size_s/txt_000000/border_CCCCCC/pageviews_0/viewers_0/flags_0/ » alt= »Flag Counter » border= »0″></a>

Mots-clefs Moteur de recherche
1 11 2.58 Google
2 6 1.41 Google
3 5 1.17 Google
4 5 1.17 Google
5 5 1.17 Google
6 4 0.94  Frères Servites de Marie Google
7 4 0.94  Ordre des Pères Servites de Marie Google
8 3 0.70 Google
9 3 0.70 Google Images
10 3 0.70 Google
11 3 0.70 Google
12 3 0.70  Sette Santi Fondatori Google
13 3 0.70 Google Images
14 3 0.70 Google
15 3 0.70 Google Images
16 3 0.70  Servi di Maria Comune di Saviano Napoli Google
17 3 0.70 Google Images
18 3 0.70 Google Images
19 3 0.70 Google
20 3 0.70 Google ImagesMots-clefs Moteur de recherche 21 3 0.70Google 22 3 0.70

Google 23 3 0.70

Google 24 2 0.47

Google Images 25 2 0.47

Google 26 2 0.47

Google Images 27 2 0.47

Google 28 2 0.47

Google 29 2 0.47

Yahoo 30 2 0.47

Google 31 2 0.47

Yahoo 32 2 0.47

Google 33 2 0.47

Google 34 2 0.47

Google 35 2 0.47

Google Images 36 2 0.47

Yahoo 37 2 0.47

Google 38 2 0.47

Google 39 2 0.47

Google 40 2 0.47

Google                                                  Mots-clefs Moteur de recherche 41 2 0.47

Yahoo 42 2 0.47

Google 43 2 0.47

Google Images 44 2 0.47

Google 45 2 0.47

Google Images 46 2 0.47

Google 47 2 0.47

Google Images 48 2 0.47

Google 49 2 0.47

Google 50 2 0.47

Google 51 2 0.47

Google 52 2 0.47

Google 53 2 0.47

Google 54 2 0.47

Google 55 2 0.47

Google 56 2 0.47

Google Images 57 2 0.47

Google 58 2 0.47

Google 59 2 0.47

Google 60 2 0.47

Mots-clefs Moteur de recherche 61 2 0.47

Yahoo 62 2 0.47

Google 63 2 0.47

Google Images 64 2 0.47

Google 65 2 0.47

Google Images 66 2 0.47

Google 67 2 0.47

Google 68 2 0.47

Google 69 2 0.47

Google 70 2 0.47

Google 71 2 0.47

Google 72 1 0.23

Yahoo 73 1 0.23

Google 74 1 0.23

Google 75 1 0.23

Yahoo 76 1 0.23

Google 77 1 0.23

Google 78 1 0.23

Google 79 1 0.23

Google 80 1 0.23

marc helferMots-clefs Moteur de recherche 81 1 0.23

Google 82 1 0.23

Yahoo 83 1 0.23

Google 84 1 0.23

Google 85 1 0.23

Google 86 1 0.23

Google 87 1 0.23

Google 88 1 0.23

Google Images 89 1 0.23

Google Images 90 1 0.23

Google Images 91 1 0.23

Google 92 1 0.23

Google 93 1 0.23

Google 94 1 0.23

Google 95 1 0.23

Yahoo 96 1 0.23

Google 97 1 0.23

Google 98 1 0.23

Google 99 1 0.23

Yahoo 100 1 0.23

Mots-clefs Moteur de recherche 101 1 0.23

Google Images 102 1 0.23

Yahoo 103 1 0.23

Google 104 1 0.23

Google Images 105 1 0.23

Google 106 1 0.23

Google 107 1 0.23

Google 108 1 0.23

Google Images 109 1 0.23

Google 110 1 0.23

Google 111 1 0.23

Yahoo 112 1 0.23

Google 113 1 0.23

Google 114 1 0.23

Yahoo 115 1 0.23

Google 116 1 0.23

Google 117 1 0.23

Google 118 1 0.23

Google 119 1 0.23

Yahoo 120 1 0.23

Goo

 

Mots-clefs Moteur de recherche 121 1 0.23

Google 122 1 0.23

Google Images 123 1 0.23

Google 124 1 0.23

Google Images 125 1 0.23

Google 126 1 0.23

Google 127 1 0.23

Google 128 1 0.23

Google 129 1 0.23

Google 130 1 0.23

Google 131 1 0.23

Google 132 1 0.23

Google 133 1 0.23

Google Images 134 1 0.23

Google 135 1 0.23

Google 136 1 0.23

Google 137 1 0.23

Google 138 1 0.23

Google 139 1 0.23

Google 140 1 0.23

Google

Google

 

Mots-clefs Moteur de recherche
141 1 0.23 Google
142 1 0.23 Google
143 1 0.23 Google
144 1 0.23 Google
145 1 0.23 Google
146 1 0.23 Google
147 1 0.23 Google
148 1 0.23 Google
149 1 0.23 Yahoo
150 1 0.23 Google
151 1 0.23 Google
152 1 0.23 Google
153 1 0.23 Google
154 1 0.23 Google
155 1 0.23 Google
156 1 0.23 Google
157 1 0.23 Yahoo
158 1 0.23 Google
159 1 0.23 Google Images
160 1 0.23 Google                                                  Mots-clefs Moteur de recherche 161 1 0.23

Google 162 1 0.23

Yahoo 163 1 0.23

Google 164 1 0.23

Google 165 1 0.23

Yahoo 166 1 0.23

Google 167 1 0.23

Google 168 1 0.23

Google 169 1 0.23

Google 170 1 0.23

Google Images 171 1 0.23

Google 172 1 0.23

Google 173 1 0.23

Google 174 1 0.23

Google Images 175 1 0.23

Google Images 176 1 0.23

Google 177 1 0.23

Google 178 1 0.23

Google 179 1 0.23

Google 180 1 0.23

Yahoo

Google                                                  Mots-clefs Moteur de recherche 181 1 0.23

Google 182 1 0.23

Yahoo 183 1 0.23

Google 184 1 0.23

Google 185 1 0.23

Google 186 1 0.23

Google 187 1 0.23

Google 188 1 0.23

Google 189 1 0.23

Google 190 1 0.23

Google 191 1 0.23

Google 192 1 0.23

Google 193 1 0.23

Google 194 1 0.23

Google 195 1 0.23

Google 196 1 0.23

Google 197 1 0.23

Google 198 1 0.23

Google 199 1 0.23

Google 200 1 0.23

Google

Mots-clefs Moteur de recherche 201 1 0.23

Google 202 1 0.23

Google Images 203 1 0.23

Google 204 1 0.23

Google 205 1 0.23

Google Images 206 1 0.23

Google 207 1 0.23

Google 208 1 0.23

Google 209 1 0.23

Google 210 1 0.23

Google 211 1 0.23

Google 212 1 0.23

Google 213 1 0.23

Google 214 1 0.23

Google 215 1 0.23

Google Images 216 1 0.23

Google Images 217 1 0.23

Yahoo 218 1 0.23

Google Images 219 1 0.23

Google 220 1 0.23

Google

Mots-clefs Moteur de recherche
221 1 0.23 Google Images
222 1 0.23 Google Images
223 1 0.23 Google Images
224 1 0.23 Google
225 1 0.23 Google
226 1 0.23 Google Images
227 1 0.23 Google Images
228 1 0.23 Google
229 1 0.23 Google
230 1 0.23 Google Images
231 1 0.23 Google
232 1 0.23 Google
233 1 0.23 Google
234 1 0.23 Google Images
235 1 0.23 Google
236 1 0.23 Google
237 1 0.23 Google
238 1 0.23 Google
239 1 0.23 Google
240 1 0.23 Google

Mots-clefs Moteur de recherche
241 1 0.23 Google Images
242 1 0.23 Google Images
243 1 0.23 Google Images
244 1 0.23 Google
245 1 0.23 Google
246 1 0.23 Google
247 1 0.23 Google Images
248 1 0.23 Google
249 1 0.23 Google
250 1 0.23 Google
251 1 0.23 Google
252 1 0.23 Google
253 1 0.23 Google
254 1 0.23 Google
255 1 0.23 Google
256 1 0.23 Google
257 1 0.23 Google Images
258 1 0.23 Google
259 1 0.23 Google
260 1 0.23 YahooMots-clefs Moteur de recherche 261 1 0.23Google 262 1 0.23

Google Images 263 1 0.23

Google 264 1 0.23

Yahoo 265 1 0.23

Google 266 1 0.23

Google 267 1 0.23

Google 268 1 0.23

Google 269 1 0.23

Google 270 1 0.23

Google 271 1 0.23

Google 272 1 0.23

Google 273 1 0.23

Google 274 1 0.23

Google 275 1 0.23

Google 276 1 0.23

Google Images 277 1 0.23

Google 278 1 0.23

Google 279 1 0.23

Google 280 1 0.23

Google                                                  Mots-clefs Moteur de recherche 281 1 0.23

Google 282 1 0.23

Google Images 283 1 0.23

Google 284 1 0.23

Google 285 1 0.23

Yahoo 286 1 0.23

Google 287 1 0.23

Yahoo 288 1 0.23

Google 289 1 0.23

Google Images 290 1 0.23

Google 291 1 0.23

Google 292 1 0.23

Google 293 1 0.23

Google 294 1 0.23

Google 295 1 0.23

Google Images 296 1 0.23

Google 297 1 0.23

Google 298 1 0.23

Google 299 1 0.23

Google 300 1 0.23

Google

3 avril, 2012

Ordre Régulier de Saint Jean de Terre Sainte O.S.J. une confrérie au service de la Sainte Église de Jésus Christ

Classé dans : Non classé — andreadicaffa02 @ 19:19

 

Histoire
du
Prieuré de France

l’Ordre Régulier de Saint Jean de Terre Sainte

O.S.J.

 

La période ancienne
(de 1050 à 1798 )

 

Jérusalem : L’Ordre, fut fondé vers 1050 à Jérusalem, pour soigner et défendre, au nom de la Foi chrétienne, les pèlerins et les malades, quelles que soient leurs nations ou religions.

Chypre : Après la prise de Jérusalem par les Sarrasins (1187) et la chute de Saint-Jean d’Acre (1291), l’Ordre s’arrête provisoirement à Chypre, avant de conquérir l’Ile de Rhodes (1310).

Rhodes : 1310 : installation à Rhodes. L’Ordre devient souverain et s’organise en Grands Prieurés et Prieurés. Partout en Europe, ses Commanderies et Hospices soignent les pèlerins et les malades.
L’Ordre développe une puissante marine de guerre propre à défendre la Chrétienté en Méditerranée, et qui servira d’Ecole des cadres pour toutes les marines d’Europe.

1480 : premier grand siège de Rhodes par les Turcs.

1522 : second siège, qui se terminera par un départ forcé.

Malte : 1530 : L’Empereur Charles-Quint offre l’Ile de Malte comme refuge à l’Ordre, qui s’y établit en 1530.
Fin de la période ancienne : la Révolution française confisque tous les biens de l’Ordre en France (1792) puis dans presque toute l’Europe, ce qui ruine pratiquement toute activité caritative et hospitalière de l’Ordre.

En Juin 1798, Bonaparte, en route pour l’Egypte, s’empare de l’Ile de Malte et l‘Ordre est dispersé.

Russie : Octobre 1798 : Un nombre important de Chevaliers de Saint-Jean se réfugie à Saint-Pétersbourg, à la cour du Tsar Paul I.

 

 Ordre Régulier de Saint Jean de Terre Sainte  O.S.J. une confrérie au service de la Sainte Église de Jésus Christ
Ancienne commanderie de Chanonat

 

La période moderne
(depuis 1798)

 

LES DATES MARQUANTES

1798 (12 juin) : Bonaparte s’empare de Malte. Le Grand Maître Ferdinand de Hompesch lui remet, sans combattre, tous les droits sur Malte. L’Ordre est dispersé et perd (définitivement) toute souveraineté territoriale.
Le Tsar Paul 1er de Russie est élu Grand Maître de l’Ordre (novembre 1798) et Hompesch démissionne officiellement.
N.B. : Depuis 1113, l’Ordre était reconnu et maintes fois confirmé dans sa totale indépendance quant à l’établissement de sa Règle et à l’élection de son Grand Maître (cf. Bulle Pastoralium nobis, 10 juin 1779).
Le Grand Maître Tsar Paul 1er fonde le Grand Prieuré Orthodoxe de Russie pour les Chevaliers orthodoxes et protestants : l’Ordre devient organiquement « oecuménique ».

1805 : le Pape Pie VII, influencé par Napoléon 1er et contre tout droit, s’oppose à l’élection d’un Grand Maître de l’Ordre et, prenant le controle des Prieurés italiens, fonde l’Ordre de Malte pontifical, strictement catholique, à la tête duquel il nomme un Lieutenant Grand Maître. L’Ordre dit « de Malte » sera autorisé par le Pape Léon XIII à élire son premier Grand Maître en 1879.
A partir de 1805, il n’y a plus de lien juridique entre l’Ordre de Malte, qui n’existe pas en Russie, et l’Ordre de Saint Jean de Jérusalem (branche Russe et oecuménique) qui continuera son existence en Russie jusqu’à la Révolution de 1917.
Son esprit et ses valeurs se perpétuent également dans l’institution du Corps des Pages et les Chevaliers Gardes. 1917 : l’Ordre de Saint Jean de Jérusalem OSJ disparaît de Russie, et retrouve le chemin de l’exil, parfois en groupes qui restent isolés, en Europe et aux Etats Unis, où son siège est d’abord fixé, avant d’être transféré en France.

1959 : l’OSJ fonde le Prieuré de France actuel.

1967 : le Prieuré de France fonde le Prieuré de Bretagne et s’allie avec l’Ordre Danois de Malte (Den Danske Malteser Orden) qui devient le Prieuré du Danemark de l’OSJ.

1999 (5 juin) : Suite à un procès intenté par l’Ordre de Malte, et pour éviter toute confusion, l’OSJ a pris le nom d’ ORDRE REGULIER DE SAINT JEAN DE TERRE SAINTE – DE LA TRADITION RUSSE DES CHEVALIERS HOSPITALIERS OECUMENIQUES CHRETIENS, ainsi qu’un Emblème particulier: la croix blanche grecque à huit pointes, utilisée autrefois par l’Ordre en Terre Sainte et à l’époque de Rhodes.

Juin 2000 : une Charte d’Alliance des Ordres Oecuméniques Chrétiens de Saint Jean de Jérusalem est signée par l’OSJ selon les huit critères d’adhésion nécessaires :
Christianisme, oecuménicité, démocratie interne selon la tradition ancienne, historicité, transparence comptable de l’action hospitalière ou caritative, statuts légaux, chevalerie chrétienne, exemplarité de vie des membres.
L’OSJ, Ordre international, est articulé en Prieurés
(voir Organisation de l’OSJ)

Décembre 2005 : Le 27 décembre 2005 les Prieurés de Bretagne et du Danemark ont décidé de se séparer de l’Ordre Régulier de Saint Jean de Terre Sainte et ont créé un nouvel ordre, le supremus ordo domus hospitalis sancti johannis hierosolymitani.

Aujourd’hui : L’Ordre Régulier de Saint Jean de Terre Sainte est constitué du seul Prieuré de France.
Le Chef de l’Ordre est Yvain Jouveau du Breuil (élu en 2006)

N.B.: L’OSJ n’a aucun lien avec:
- La Communauté Saint Jean
- La Fraternité Monastique de Jérusalem
- Le Most Venerable Order of Saint John
- L’Ordre de Malte pontifical
- L’Ordre de Saint-Jean – Grand Bailliage de Brandebourg
- L’Ordre de Saint Lazare de Jérusalem
- L’Ordre du Saint Sépulcre de Jérusalem

 

 
Ancienne commanderie de Chanonat

 

 email2Sm

Sommaire

Page d’accueil

Adresses

Publications

Page suivante

2 janvier, 2012

Calendrier liturgique Ordre Servites de Marie 2011 2012 Calendario Liturgico dell’ Ordine Servi di Maria 2011 2012

Classé dans : Non classé — andreadicaffa02 @ 16:37

Nota :

Utilizzare il calendario liturgico dell’ Ordine dei Servi di Maria significa prima di tutto saper trovare in esso il nocciolo eterno ,l’ elemento di testimonianza evangelica vissuta e trasmessa da un importante e consistente schiera di santi e sante di quest’ Ordine religioso.La vita di questi Frati rappresenta per noi la fedeltà all’ intera Tradizione e questa fedeltà non significa essere fedeli all’ autorità esterna del passato ma un legame vivente con la pienezza dell’ esperienza della Chiesa Una e Universale.

Per i membri dell’ Ordine di Sant’ Andrea di Caffa utilizzare il Calendario Liturgico dell’ Ordine dei Servi di Maria non è soltanto un argomento storico o sentimentale .La Tradizione trasmessa dalla vita di numerosi Frati Servi di Maria vissuti nell’ Italia meridionale non si riduce a un’ archeologia ecclesiastica.

I membri dell’ Ordine di Sant’ Andrea di Caffa non si limitano a seguire il testo del Calendario Liturgico OSM ma lo considerano un prezioso strumento di aiuto per organizzare meglio la vita liturgica e spirituale dell’ Ordine di Sant’ Andrea di Caffa.

Quando i membri del nostro ordine hanno scelto nel 2008 di vivere la spiritualità servitana trasmessa senza interruzione dal 1233 ,essi hanno scelto di viverla nnelle circostanze dove Dio ha voluto farli vivere con l’ obbligo di ricordarsi cio’ che l’ Ordine dei Frati Servi di Maria ha sempre et dovunque manifestato attraverso il suo tesoro spirituale reso prezioso dalla vita dei Frati dell’ Ordine di Santa Maria.

Il Calendario Liturgico OSM anche quest’ anno ci indicherà le date del ritorno alla Casa del Padre dei Frati vissuti nell’ Italia meridionale . Padre Girolamo Russo,Padre Giuseppe Portesine,Padre Antonino Mautone,Padre Bonfiglio Mautone,Padre Andrea D’Andrea,Padre Raffaele Montanino,Padre Pio Casciello e tantissimi altri .

Adottare un calendario liturgico dell’ Ordine dei Frati Servi di Maria significa anche vivere l’ unità nella Fede benchè non vi siano legami canonici .Vivere quell’ Unità data alla Chiesa delle origini che è l’ opzione di ciascuno di noi e di noi tutti uniti,quella pienezza a cui noi tutti aspiriamo in ogni momento della nostra esistenza comunitaria.

La testimonianza di questi Frati Servi di Maria,vissuti nei conventi di Napoli,Palma Campania,Saviano,Alvignano,Prata Sannita,Manduria,Taranto,Siracusa ecc, ci aiuta a conservare la pienezza della Chiesa di Gesù Cristo perchè la nostra prima vocazione risiede nella crescita di ciascuno di noi in questa pienezza.

Il resto,e noi lo crediamo, ci sarà dato in abbondanza perchè la Divina Provvidenza sta agendo silenziosamente e un giorno vicino o lontano l’ Italia meridionale assistera alla rifioritura di numerosi conventi dei Servi di Maria grazie alla semina che fu fatta da questi santi frati.

Calendrier liturgique Ordre Servites de Marie 2011 2012 Calendario Liturgico dell' Ordine Servi di Maria 2011 2012 glisephotopadregirolamorussoservodimariaPadre Girolamo Maria Russo fondatore della Provincia dell’ Italia Meridionale

dell’ Ordine dei Frati Servi di Maria

 

 

 

 

 

ORDO
CELEBRANDI
OFFICIUM DIVINUM ET MISSAM
SECUNDUM
CALENDARIUM ROMANUM GENERALE
ET PROPRIUM
ORDINIS FRATRUM SERVORUM
BEATAE MARIAE VIRGINIS
PRO ANNO LITURGICO
2011 – 2012
FRATRIS
ANGELI M. RUIZ GARNICA
PRIORIS GENERALIS
IUSSU EDITUS
In copertina
Stemma dell’Ordine
da una balaustra
della chiesa di «Notre-Dame de la Défense»
in Montréal (sec. XX)
ROMAE
CURIA GENERALIS O.S.M. – S. MARCELLO AL CORSO, 5
2011
EXPLICATIO ABBREVIATIONUM
Omnia quae ad hoc Calendarium
spectant mittantur ad:
CLIOS
Servi di Maria
Viale Trenta Aprile, 6
00153 Roma (RM), Italia
e-mail: cliosm@gmail.com
A.
AC
ant.
Ap. App.
Ben.
CIC
CMBMV
Co.
Comm.
CP
Cp.
D.
Diac.
dic.
dom.
E. Epp.
Ev
hebd.
H. m.
IH
IM
Ld.
lect.
Magn.
M. Mm.
Off.
Off. lect.
om.
or.
Ord.
Pp.
P.
PE.
pf.
Pr.
pr.
ps. pss.
Psalt.
Rel.
rel.
R. RR.
Scr.
seq.
Vp.
V.
Abbas
Normae de anno liturgico et calendario
antiphona, ae
Apostolus, i
canticum Benedictus in Laudibus
Codex Iuris Canonici
Collectio Missarum de b. Maria V.
Commune Sanctorum
Communicantes in Canone Romano
Instructio de calendariis propriis
Completorium
Doctor
Diaconus
dicitur, dicuntur
dominica
Episcopus, Episcopi
evangelium
hebdomada
Hora media (i.e. Tertia, Sexta, Nona)
Institutio generalis de Liturgia Horarum
Institutio generalis Missalis Romani
Laudes matutinae
Lectio, lectiones
canticum Magnificat ad Vesperas
Martyr, Martyres
Officium
Officium lectionis
omittitur, omittuntur
oratio
Ordinarium divini Officii
Papa
Presbyter
Prex eucharistica
praefatio`
Proprium de Tempore vel Sanctorum
proprius
psalmus, psalmi
Psalterium
Religiosus, Religiosa
reliqua
responsorium, responsoria
Scriptura
sequens
Vesperae
Virgo
ABBREVIATIONS
A
AC
ant.
Ap. App.
Ben.
CIC
CMBMV
Co.
Comm.
CP
Cp.
D.
Diac.
dic.
dom.
E. Epp.
Ev
hebd.
H. m.
IH
IM
Ld.
lect.
Magn.
M. Mm.
Off.
Off. lect.
om.
or.
Ord.
Pp.
P.
PE.
pf.
Pr.
pr.
ps. pss.
Psalt.
Rel.
rel.
R. RR.
Scr.
seq.
Vp.
V.
Abbot
Norms for the liturgical year and calendar
Antiphon [s]
Apostles [s]
Benedictus or Canticle of Zecchariah at Laudsor Morning Prayer
Code of Canon Law
Collection of masses of the Blessed Virgin Mary
Common of Saints
Communicantes ( in union with the whole Church)
in the Roman Canon
Instruction on proper calendars
Compline or Night Prayer
Doctor
Deacon
is [are] said
Sundays
Bishop [s]
Gospel
Week
Daytime Prayer (Midmorning, Midday, Midafternoon)
General Instruction on the Liturgy of the Hours
General Instruction on the Roman-Missal
Lauds or Morning Prayer
Reading [s]
Magnificat or Canticle of Mary
Martyr [s]
Office
Office of Readings
is [are] omitted
prayer
Ordinary of the Office
Pope
Presbyter
Eucharistic Prayer
Preface
Proper of the Seasons or the Saints
Proper
Psalm [s]
Psalter
Religious
Remainder
Responsory, responsories
Scriptures
Sequence
Vespers or Evening Prayer
Virgin
PRO CALENDARIO ANNI LITURGICI
2011 – 2012
Celebrationes mobiles
I Adventus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Sanctae Familiae . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
Epiphania Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
- ubi in dominicam transfertur. . . . . . . . . . . . . . . . . . 8
Baptisma Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
- ubi Epiphania Domini in dominicam
transfertur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Dies Cinerum . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Dominica Resurrectionis . . . . . . . . . . . . . . . . . . . . . . . 8
Ascensio Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
- ubi in dominicam transfertur . . . . . . . . . . . . . . . . 20
Dominica Pentecostes . . . . . . . . . . . . . . . . . . . . . . . . 27
Ss.mae Trinitatis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Ss.mi Corporis et Sanguinis Christi . . . . . . . . . . . . 7
- ubi in dominicam transfertur . . . . . . . . . . . . . . . . 10
Ss.mi Cordis Iesu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
D.N.I.C. universorum Regis. . . . . . . . . . . . . . . . . . 25
nov.
dec.
ian.
ian.
ian.
ian.
febr.
apr.
maii
maii
maii
iunii
iunii
iunii
iunii
nov.
Iuxta traditum morem, hae celebrationes mobiles
fidelibus annuntiari possunt in sollemnitate Epiphaniae,
intra Missarum sollemnia, post Evangelium.
De lectionario adhibendo
Lectionarium dominicale-festivum: cyclus B.
Lectionarium feriale «per annum»: prima lectio sumi-
tur e serie II.
VI
VII
DE CALENDARIO 2011 – 2012 DE CALENDARIO 2011 – 2012
Tempus «per annum» Anno 2012 tempus «per annum» complectitur 34 heb- Curent igitur illi, ad quos spectat liturgiam conven-
domadas, quarum 7 celebrantur ante Quadragesimam, a tualem ordinare, ut celebratio horum festorum huic
die 9 vel 10 ianuarii, feria II vel III post festum Baptismatis Ordini inseratur. Omnes autem meminerint in Missae
Domini, usque ad diem 21 februarii, feriam III ante Cineres. celebratione:
Post Pentecosten tempus «per annum» resumitur ab a) in sollemnitatibus semper Gloria et Credo dicenda esse;
hebdomada VIII, die 28 maii, feria II post dominicam b) in festis Gloria tantum dicendum esse;
Pentecostes. c) in memoriis Gloria et Credo non esse dicenda. Atta-
men Gloria et Credo dici possunt si Missa cum peculiari
sollemnitate celebretur.
De diebus festis huic Calendario adiciendis Quibus Calendarium Ordinis adhibendum sit
Secundum Instructionem «De Calendariis particula- Instructio de qua supra diximus praecepti ut Calenda-
ribus atque Officiorum et Missarum Propriis recogno- rium religiosum adhibeant:
scendis» a S. Congregatione pro Cultu Divino die 24 a) fratres Ordinis;
iunii 1970 evulgatam, sodales familiarum religiosarum b) moniales et sorores eiusdem Ordinis;
cum Ecclesia locali iunguntur in celebrandis: c) sodales OSSM aggregati in communi viventes et vota sim-
a) sollemnitate Patroni principalis oppidi vel civitatis; plica emittentes.
b) festo Patroni principalis dioecesis, regionis aut provin-
ciae, nationis vel amplioris territorii;
c) festo anniversarii Dedicationis ecclesiae cathedralis.
Praeterea in omnibus ecclesiis et oratoriis celebran-
dae sunt:
a) sollemnitas anniversarii Dedicationis (si templum con-
secratum sit);
b) sollemnitas Tituli;
c) memoria Sancti vel Beati (in Martyrologio vel eius
Appendice inscripti) cuius corpus in ecclesia vel oratorio
asservatur.
Quibus omnibus vehementer suadetur ut hanc nor-
mam studiose observent, quippe eam quae unitatem
totius Servorum familiae valde foveat et dum sensu art.
309 novarum Constitutionum O. N. mire consentiat.
TABULA DIERUM LITURGICORUM
TABULA DIERUM LITURGICORUM
secundum ordinem praecedentiae disposita
(AC, 59)
I
1. Triduum paschale Passionis et Resurrectionis Domini.
2. Nativitas Domini, Epiphania, Ascensio et Pente-
costes.
Dominicae Adventus, Quadragesimae et Paschae.
Feria IV Cinerum.
Feriae Hebdomadae sanctae, a feria II ad feriam V
inclusive.
Dies infra octavam Paschae.
3. Sollemnitates Domini, Beatae Mariae Virginis et
Sanctorum in Calendario generali inscriptae. Com-
memoratio omnium fidelium defunctorum.
4. Sollemnitates propriae, nempe:
a) Sollemnitas patroni principalis loci seu oppidi
aut civitatis.(a)
b) Sollemnitas Dedicationis et anniversarii Dedica-
tionis ecclesiae propriae.
c) Sollemnitas Tituli ecclesiae propriae.
d) Sollemnitas aut Tituli, aut Fundatoris, aut Patroni
principalis Ordinis seu Congregationis.
(a) Celebratio peragenda etiam a Religiosis.
IX
II
5. Festa Domini in Calendario generali inscripta.
6. Dominicae temporis Nativitatis et dominicae «per
annum».
7. Festa Beatae Mariae Virginis et Sanctorum Calendarii
generalis.
8. Festa propria, nempe:
a) Festum Patroni principalis dioecesis.1(a)
b) Festum anniversarii Dedicationis ecclesiae cathe-
dralis.(a)
c) Festum Patroni principalis regionis aut provinciae,
nationis, amplioris territorii.(a)
d) Festum Tituli, Fundatoris, Patroni principalis
Ordinis seu Congregationis et provinciae religiosae,
salvis praescriptis sub n. 4 d.
e) Alia festa alicui ecclesiae propria.
f ) Alia festa inscripta in Calendario cuiusque dioe-
cesis vel Ordinis seu Congregationis.
9. Feriae Adventus a die 17 ad 24 decembris inclusive.
Dies infra octavam Nativitatis.
Feriae Quadragesimae.
1 Rationibus pastoralibus suadentibus, fieri potest sollemnitas (CP, 8, 9).
(a) Celebratio peragenda etiam a Religiosis.
X
TABULA DIERUM LITURGICORUM
III
10. Memoriae obligatoriae Calendarii generalis.
11. Memoriae obligatoriae propriae, nempe:
a) Memoriae Patroni secundarii loci, dioecesis,
regionis aut provinciae, nationis, amplioris territorii,
Ordinis seu Congregationis et provinciae religiosae.
b) Aliae memoriae obligatoriae alicui ecclesiae
propriae.
c) Aliae memoriae obligatoriae inscriptae in Ca-
lendario cuiusque dioecesis, vel Ordinis seu Congre-
gationis.(b)
12. Memoriae ad libitum, 2 quae tamen, modo quidem
peculiari in Institutionibus de Missa et de Officio
descripto, fieri possunt etiam diebus de quibus sub
n. 9. Hac eadem ratione, ut memoriae ad libitum
celebrari possunt memoriae obligatoriae, quae acci-
dentaliter occurrunt in feriis Quadragesimae.
13. Feriae Adventus usque ad diem 16 decembris
inclusive.
Feriae temporis Nativitatis a die 2 ianuarii ad sab-
batum post Epiphaniam.
Feriae temporis paschalis a feria II post octavam
Paschae ad sabbatum ante Pentecosten inclusive.
Feriae per annum.
(b) In qualibet ecclesia vel oratorio, celebranda est memoria Sancti vel Beati (in
Martyrologio vel eius appendice inscripti) cuius corpus ibidem asservatur (CP, 11).
2 Memoria propria praeferenda est memoriae generali non obligatoriae (CP, 23 c).
DE ANNO LITURGICO
ET DE CALENDARIO
Occurrentia celebrationum liturgicarum
Si eodem die plures celebrationes occurrunt, fit de
ea quae in tabula dierum liturgicorum, supra relata,
superiorem obtinet locum (AC, 60).
Si quodam anno sollemnitas impediatur, ad proxi-
miorem diem transferatur qui liber sit a diebus sub nn.
1-8 in tabula praecedentiae recensitis (AC, 60).
Attamen si sollemnitas a dominica Adventus vel
Quadragesimae vel Paschae impediatur, sabbato praece-
denti anticipatur (AC, 5). Si sabbato impediatur, tran-
sferatur ad proximiorem diem liberum, secundum nor-
mam generalem. Si vero agatur de occurrentia in domi-
nica in Palmis aut in dominica Risurrectionis, transfer-
tur ad primum diem liberum, post dominicam in octa-
va Paschae (Congr. pro Cultu Divino, 22 apr. 1990, in
Notitiae 26 [1990] 160).
Reliquae celebrationes impeditae eo anno omit-
tuntur (AC, 60).
Si vero eodem die celebrandae sint Vesperae Officii
occurrentis et I Vesperae diei sequentis, praevalent
Vesperae celebrationis quae in tabula dierum liturgico-
rum superiorem obtinet locum; in casu autem paritatis,
Vesperae diei currentis (AC, 61).
«Celebratio externa»
Ad bonum pastorale fidelium procurandum, in
dominicis “per annum”, licet eas celebrationes agere,
quae infra hebdomadam occurrunt, quaeque ipsorum
XII
XIII
DE CELEBRATIONE EUCHARISTICA DE CELEBRATIONE EUCHARISTICA
fidelium pietati sint acceptae, dummodo hae in tabu- cum plena participatione omnium sodalium com-
la praecedentiae ipsi dominicae praeponantur. De his munitatis sive religiosorum sive canonicorum. In iis
celebrationibus dici possunt omnes Missae, quae con- proinde munus suum exerceant singuli iuxta ordinem
currente populo celebrantur (AC, 58). vel ministerium receptum.
Expedit ideo ut omnes sacerdotes qui pro utilita-
te pastorali fidelium singulariter celebrare non tenen-
tur, in iis, quantum fieri potest, concelebrent. Omnes
insuper ad eam communitatem pertinentes sacerdo-
tes, qui officio in bonum pastorale fidelium singulari-
ter celebrandi tenentur, Missam quoque conventua-
lem aut “Communitatis” eadem die concelebrare pos-
sunt (IM, 114).
DE CELEBRATIONE EUCHARISTICA
De diversis formis Missam celebrandi
De Missa cui praeest Episcopus
In Ecclesia particulari primus locus tribuatur Missae
cui praeest Episcopus a suo presbyterio et ministris
circumdatus et in qua plebs sancta Dei plene et actuo-
se participat. Ibi enim habetur praecipua manifestatio
Ecclesiae (Missale Romanum, Institutio generalis [seq.
IM], 112).
De Missa paroeciali
Magni etiam habeatur Missa quae cum aliqua com-
munitate, praesertim vero paroeciali, celebratur, utpote
quae Ecclesiam universalem repraesentet tempore et loco
statutis, praecipue in celebratione dominicali (IM, 113).
De Missa conventuali vel communitatis
Inter Missas quae ab aliquibus communitatibus
celebrantur, peculiarem locum obtinet Missa conven-
tualis, quae pars est Officii cotidiani, aut Missa, quae
“Communitatis” dicitur. Et quamvis hae Missae nul-
lam specialem formam celebrationis prae se ferant,
maxime tamen decet eas cum cantu fieri, praecipue
De Missis concelebratis
Per Eucharistiae concelebrationem unitas sacrificii
et sacerdotii opportune manifestatur, atque quoties
fideles actuose participant, unitas populi Dei singula-
ri modo apparet, praesertim si praeest Episcopus.
Concelebratio insuper fraterna presbyterorum vin-
cula significat et firmat, quia vi communis sacrae ordi-
nationis et missionis presbyteri omnes inter se intima
fraternitate nectuntur.
Quare, nisi utilitas fidelium (quae sedula pastorali
sollicitudine semper consideranda est) hoc impediat, et
integra manente cuique sacerdoti facultate Missam sin-
gularem celebrandi, praestat sacerdotes illo praeclaro
modo Eucharistiam celebrare tum in communitatibus
sacerdotum tum in coetibus qui statutis temporibus
congregantur aliisque similibus adiunctis. Qui in com-
muni vivunt vel eidem ecclesiae deserviunt, peregrinos
sacerdotes ad concelebrationem suam libenti animo
XIV
XV
DE CELEBRATIONE EUCHARISTICA TABULA PRO MISSIS RITUALIBUS
invitent. Hinc superiores faciliorem reddant, immo Ad formularium autem Missae eligendum, princi-
foveant concelebrationem, quoties necessitas pastoralis pium generale servetur, iuxta quod «praecedentia sem-
vel alia rationabilis causa aliud non exigit (Instr. Eucha- per danda est celebrationi quae est de praecepto servan-
risticum mysterium, 47). da, independenter a gradu liturgico duarum celebratio-
num occurrentium» (Congr. pro Cultu Divino, Notitiae
20 [1984] 603).
Eadem ratione, in celebrandis Vesperis cum populo,
derogari potest normae generali, ita ut Vesperae concor-
dent cum Missa vespertina quae celebratur (Ibidem).
De Missa pro populo
Parochus, post captam paroeciae possessionem,
obligatione tenetur singulis diebus dominicis atque
festis in sua dioecesi de praecepto Missam pro populo
sibi commisso applicandi; qui vero ab hac celebratione
legitime impediatur, iisdem diebus per alium aut aliis
diebus per se ipse applicet.
Parochus, qui plurium paroeciarum curam habet,
diebus de quibus supra, unam tantum Missam pro uni-
verso sibi commisso populo applicare tenetur (CIC,
can. 534).
N.B. Haec obligatio in hoc Ordine per crucem ©
in margine appositam indicatur.
De Missa festiva
vespere diei praecedentis celebranda
Praecepto Missae festivae participandae satisfieri
potest, iuxta praescriptum CIC, can. 1284 § 1, Mis-
sam participando «vel ipso die festo vel vespere diei
praecedentis».
Proinde Missa vespertina diei qui diem festum de
praecepto praecedit ordinanda erit cum omnibus ele-
mentis quae in Missa diei festi praecipiuntur (homilia,
oratio fidelium) aut commendantur (amplior populi
participatio per cantum, etc.: IM, 115-116).
TABULA PRO MISSIS RITUALIBUS,
PRO VARIIS NECESSITATIBUS,
VOTIVIS ET DEFUNCTORUM
Sigla
V1 = Missae rituales (IM, 330).
Missae pro variis necessitatibus et votivae, de mandato
vel licentia Ordinarii loci, occurrente graviore necessi-
tate vel utilitate pastorali (IM, 332).
V2 = Missae pro variis necessitatibus et votivae de iudicio
rectoris ecclesiae vel ipsius celebrantis, si vera necessitas
vel utilitas pastoralis id postulet (IM, 333).
V3 = Missae pro variis necessitatibus et votivae pro pietate fide-
lium eligendae a sacerdote celebrante (IM, 329 b et c).
D1 = Missa exsequialis (IM, 336).
D2 = Missae post acceptum mortis nuntium, in ultima
sepultura defuncti et in primo anniversario (IM, 381).
D3 = Missa «cotidiana» (IM, 337). Quando prohibentur D1
et D2, etiam D3 evidenter prohibetur.
+ = permittuntur
– = prohibentur
XVI
TABULA PRO MISSIS RITUALIBUS
1. Sollemnitates de praecepto
2. Dominicae Adventus, Quadra-
gesimae et Paschae
Triduum paschale et Feria V
Hebd. S.
Sollemnitates non de praecepto
Comm. omnium fidelium
defunctorum
Feria IV Cinerum, Feriae II, III,
IV Hebd. S
Dies infra octavam Paschae
3.
4.
5.
6.
7.
8.
Dominicae temporis Nativitatis
et «per annum»
Festa
9.
Feriae Adventus a 17 ad
24 decembris
10. Dies infra octavam Nativitatis
11. Feriae Quadragesimae
12. Memoriae obligatoriae
13. Feriae Adventus usque ad
16 decembris
14. Feriae temporis Nativitatis a
2 ianuarii
15. Feriae temporis paschalis
16. Feriae «per annum»
V1–
D1–
V1–
D1–
V1–
D1–
V1–
D1+
V1 –
D1+
V1–
D1+
V1+ / V2–
D1+ / D2–
V1+ / V2–
D1+ / D2–
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+ / V3+
D1+ / D2+ / D3+
DE CELEBRATIONE EUCHARISTICA
XVII
De Missa eligenda
(IM, 352-355. 363)
1. In sollemnitatibus: iuxta calendarium ecclesiae in
qua celebratur.
2. In dominicis, in feriis Adventus, Nativitatis, Quadra-
gesimae et Paschae, in festis et memoriis obligatoriis:
a) si Missa celebratur cum populo, sacerdos sequa-
tur calendarium ecclesiae in qua celebrat;
b) si Missa celebratur sine populo, sacerdos sequi
potest aut calendarium ecclesiae aut calendarium
proprium.
3. In memoriis obligatoriis de S. Maria in sabbato: dici
potest, pro qualitate temporis liturgici, vel una ex sex
Missis, quae in Communi B.M.V. Missalis romani
proponuntur (1-3, Tempore per annum; 4, Tempo-
re Adventus; 5, Tempore Nativitatis; 6, Tempore
paschali), vel una ex decem Missis, quae in Proprio
Missarum O.S.M. inveniuntur (1, Tempore Adven-
tus; 2, Tempore Nativitatis; 3, Tempore Quadrage-
simae; 4, Tempore paschali; 5-10, Tempore per
annum), vel una ex 46 Missis, quae in Collectione
Missarum B. Mariae Virginis proponuntur.
4. In memoriis ad libitum:
a) In feriis Adventus a die 17 ad 24 decembris, infra
octavam Nativitatis et in feriis Quadragesimae,
exceptis feriis IV Cinerum et Hebdomadae Sanctae,
XVIII
DE CELEBRATIONE EUCHARISTICA
sacerdos dicit Missam de die liturgico occurrente;
de memoria autem in calendario generali eo die
forte inscripta sumere potest collectam, dummodo
non occurrat feria IV Cinerum aut feria Hebdo-
madae Sanctae.
b) In feriis Adventus ante diem 17 decembris, in
feriis temporis Nativitatis et Paschae, sacerdos eli-
gere potest aut Missam de feria, aut Missam de
Sancto, vel de uno e Sanctis quorum fiat memoria,
aut Missam de aliquo Sancto eo die in Martyro-
logio inscripto.
5. In feriis «per annum», seligi potest:
a) aut una ex 34 Missis dominicarum «per annum»;
in ea tamen orationes (vel collecta tantum) sumi
possunt ex alia dominica «per annum» vel ex ora-
tionibus ad diversa;
b) aut Missa de aliquo Sancto eo die in Martyrolo-
gio inscripto;
c) aut Missa ad diversa vel votiva;
d) aut quaevis Missa defunctorum; Missa tamen
cotidiana tunc solummodo dici potest si pro defun-
ctis applicanda est.
Notanda:
Si celebrat cum populo, sacerdos imprimis bono spi-
rituali fidelium studebit, et cavebit ne iis suam pro-
pensionem imponat. Curabit praecipue ne frequen-
tius et sine sufficienti causa lectiones omittatsingulis
DE CELEBRATIONE EUCHARISTICA
XIX
diebus assignatas in lectionario feriali: Ecclesia enim
cupit ut ditior mensa verbi Dei paretur fidelibus.
Ob eandem causam moderate sumet Missas defunc-
torum: quaelibet enim Missa tam pro vivis quam pro
defunctis offertur, et in omni Prece eucharistica memo-
ria defunctorum habetur. Ubi autem fidelibus cordi
sunt memoriae ad libitum Beatae Mariae Virginis vel
Sanctorum, una saltem Missa de his celebretur, ut sati-
sfiat legitimae eorum pietati.
DE LITURGIA HORARUM
DE LITURGIA HORARUM
De Liturgiae Horarum obligatione
Episcopi et presbyteri, aliique ministri sacri, qui
mandatum ab Ecclesia acceperunt Liturgiam Horarum
celebrandi, integrum eius cursum cotidie persolvant,
Horarum veritate, quantum fieri potest, servata.
Debitum in primis momentum tribuant Horis,
quae huiusmodi Liturgiae sunt veluti cardo, id est
Laudibus matutinis et Vesperis, caveantque ne has
Horas omittant, nisi gravi de causa.
Officium quoque lectionis, quod est potissimum
celebratio liturgica verbi Dei, fideliter peragant; ita,
munus peculiari ratione sibi proprium, verbum Dei in
seipsos recipiendi, cotidie adimplent, quo perfectiores
fiant Domini discipuli et profundius sapiant investiga-
biles divitias Christi.
Quo melius totum diem sanctificent, cordi insuper
ipsis erit recitatio Horae mediae et Completorii, quo
ante cubitum integrum Opus Dei perficiant seseque
Deo commendent (IH, 29).
Communitates religiosae Liturgiae Horarum non
adscrictae, earumque singuli sodales, Horas celebrent
ad normam iuris sui particularis, salvo praescripto
circa eos qui Ordinem sacrum acceperunt.
Communitates vero choro adstrictae integrum cur-
sum Horarum cotidie in choro persolvant; extra cho-
rum autem sodales Horas recitent ad normam iuris sui
particularis, salvis semper iis quae respiciunt eos qui
Ordinem sacrum acceperunt (IH, 31 b).
XXI
De celebratione communi Liturgiae Horarum
in Ordine nostro
Omnibus fratribus communitatum Servorum
Beatae Mariae Virginis Liturgia Horarum, secundum
Constitutiones, forma typica orandi exsistit: «Ogni
giorno ci riuniamo tutti per la Lode del Signore con
la celebrazione della Liturgia delle Ore, secondo il
modo e l’orario stabiliti comunitariamente» (art. 49).
Cum novae Constitutiones vigere coeperint (6 apri-
lis 1969), ex consulto S. Congregationis pro Religiosis
et Institutis saecularibus (31 maii 1969) quae Ordini-
bus qui Mendicantes nuncupantur facultatem concedit
Divinum Officium «in communi» recitandi, si hoc a
Capitulo Generali uniuscuiusque Ordinis statuatur (cf.
Acta O.S.M., 29, 1969, p. 25-26), in nostris communi-
tatibus Officium non amplius celebratur «in choro»,
sed «in communi». Praeterea, ad mentem Constitutio-
num, si fieri potest, Officium una cum populo est cele-
brandum (cf. art. 24).
De memoriis quae celebratione plena privantur
(IH, 237-239; IM, 355 a)
Memoriae quae diebus a 17 ad 31 decembris et
feriis Quadragesimae occurrunt (exclusis feria IV
Cinerum et Hebdomada Sancta), hoc modo celebrari
possunt:
XXII
DE LITURGIA HORARUM
1. In OFFICIO LECTIONIS, post lectionem e Patribus
in Proprio de Tempore cum eius responsorio, addi
potest lectio hagiografica propria cum eius respon-
sorio et oratione de Sancto.
2. Ad LAUDES MATUTINAS et VESPERAS, post oratio-
nem, omissa conclusione, addi possunt antiphona
et oratio de Sancto.
3. Ad MISSAM dici potest collecta de Sancto.
TEMPUS ADVENTUS
Tempus Adventus duplicem habet indolem: est enim tem-
pus praeparationis ad sollemnia Nativitatis, in quibus
primus Dei Filii adventus ad homines recolitur, ac simul
tempus quo per hanc recordationem mentes diriguntur ad
exspectationem secundi Christi adventus in fine tempo-
rum. His duabus rationibus, tempus Adventus se praebet
ut tempus devotae ac iucundae exspectationis (AC, 39).
In Officio Divino, incipitur vol. I Liturgiae Horarum
In Missa, incipitur Lectionarium festivum, cyclo B.
Quaedam animadvertenda pro Tempore Adventus:
1. Organum aliaque musica instrumenta adhibeantur, et altare
floribus ornetur ea moderatione, quae indoli huius temporis
conveniat, quin tamen plenam laetitiam Nativitatis Domini prae-
veniat (Caeremoniale Episcoporum, 236). Eadem moderatio serve-
tur in celebratione Matrimonii (Ordo Matrimonii, 30).
2. In celebratione Matrimonii, sive intra Missam sive extra Missam,
benedictio nuptialis semper impertienda est. Moneantur tamen
sponsi ut rationem habeant peculiaris naturae huius temporis
liturgici (Ordo Matrimonii, 32).
Pro Officio et Missa usque ad diem 16 decembris:
1. Non permittuntur Missae ad diversa vel votivae aut cotidianae
defunctorum, nisi utilitas pastoralis id requirat (IM, 376, 381).
Permittuntur tamen Missae de memoriis his diebus occurrentibus,
aut de Sanctis his diebus in Martyrologio inscriptis (IM, 355 a-b).
2. In Off.:
a) ad Invit. ant. Regem;
b) ad Off. lect. Ld. Vp. hymni pr., qui un I parte Ord. huius tem-
poris exstant;
c) ad H. m. et Cp. hymni in eodem Ord. positi.
NOVEMBER 2011
NOVEMBER 2011
26. Viol. Sabb.
I VESPERAE dom. I Adventus – Cp. post I Vp. dom.
Incipitur vol. I Liturgiae Horarum.
27. Viol. DOM. I ADVENTUS (hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. I Adv.
E LECTIONARIO FESTIVO, hoc anno legitur cyclus B.
L 1 Is 63, 16b-17. 19b; 64, 2b-7;
Ps 79, 2ac et 3b. 15-16. 18-19.
L 2 1 Cor 1, 3-9.
Ev Mc 13, 33-37.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE dom. I Adventus – Cp. post II Vp. dom.
ANNIVERSARIA
2005. Innsbruck. Fr. Lukas M. Huber, presb., a. 63, r. 43.
28. Viol. Feria II hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 2, 1-5; Ps 121, 1-2. 3-4a. (4b-5. 6-7.) 8-9.
Ev Mt 8, 5-11.
ANNIVERSARIA
1974. Montevideo. Fr. Giovanni M. Gonzo, presb., a. 60, r. 41.
3
29. Viol. Feria III hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 11, 1-10; Ps 71, 2. 7-8. 12-13. 17.
Ev Lc 10, 21-24.
ANNIVERSARIA
1985. Poschiavo. Fr. Giuseppe M. Ferin, presb., a. 77, r. 59.
30. Rub. Feria IV. S. ANDREAE AP., festum. – Ad H. m.
ant. de temp. et pss. feriæ IV, hebd. I.
De ea.
© MISSA pr., Gloria, lect. pr., pf. App.
L 1 Rom 10, 9-18; Ps 18, 2-3. 4-5.
Ev Mt 4, 18-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
Langegg. Fr. Ignaz M. Millik, presb., a. 91, r. 72.
Saviano. Fr. Girolamo M. Russo, presb., a. 85, r. 67.
Montréal. Fr. Armand M. Gaudreau, presb., a. 65, r. 43.
Gelsenkirchen-Buer. Fr. Gabriel M. Kurzenhäuser, presb.,
a. 62, r. 38.
2010. Viareggio. Fr. Luigi M. De Vittorio, presb., a. 80, r. 63.
1968.
1970.
1992.
2001.
DECEMBER 2011
DECEMBER 2011
1. Viol. Feria V hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 26, 1-6; Ps 117, 1 et 8-9. 19-21. 25-27a.
Ev Mt 7, 21. 24-27.
ANNIVERSARIA
1976. El Paso. Fr. Tarcisio M. Bressan, a. 62, r. 43.
2001. México. Fr. Giovannangelo M. Gasperini Tomasel, presb.,
a. 85, r. 64.
2. Viol. Feria VI hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 29, 17-24; Ps 26, 1. 4. 13-14.
Ev Mt 9, 27-31.
1962.
1973.
1983.
2000.
ANNIVERSARIA
Kötschach. Fr. Alfons M. Veith, presb., a. 81, r. 62.
Denia. Fr. Antonio M. Caballero, presb., a. 54, r. 16.
Ironton. Fr. Hugh M. Bryers, presb., a. 84, r. 63.
Ronzano. Fr. Graziano M. Bartolini, presb., a. 63, r. 45.
3. Alb. Sabb. hebd. I Adv. (I Psalt.).
S. Francisci Xavier P., memoria.
MISSA memoriae, pf. I Adv. vel de sancto.
L 1 Is 30, 19-21. 23-26; Ps 146, 1-2. 3-4. 5-6.
Ev Mt 9, 35 – 10, 1. 6-8.
5
I VESPERAE dom. II Adventus – Cp. post I Vp. dom.
1979.
1982.
2004.
2008.
ANNIVERSARIA
Vicenza. Fr. Pietro M. Baroni, a. 64, r. 31.
Pietralba. Fr. Isidoro M. Todero, a. 81, r. 51.
Fullerton. Fr. Peregrine M. Graffius, presb., a. 73, r. 51.
Innsbruck. Fr. Franz M. Brunner, presb., a. 77, r. 48.
4. Viol. DOM. II ADVENTUS (hebd. II Psalt.).
De ea.
© MISSA pr., Credo, pf. I Adv.
L 1 Is 40, 1-5. 9-11; Ps 84, 9ab-10. 11-12. 13-14.
L 2 2 Petr 3, 8-14.
Ev Mc 1, 1-8.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Ioannis Damasceni P.D. memoria omittitur.
II VESPERAE dom. II Adventus – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Poschiavo. Fr. Anselmo M. Zordan, presb., a. 77, r. 58.
1986. Chicago. Fr. Joakim M. Martorano, presb., a. 49, r. 29.
5. Viol. Feria II hebd. II Adv. (II Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 35, 1-10; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 5, 17-26.
ANNIVERSARIA
1978. Isola Vicentina. Fr. Costantino M. Meneghello, presb., a. 85,
r. 64.
6
7
TEMPUS ADVENTUS DECEMBER 2011
1985. Castellerio. Fr. Lorenzo M. Plotzer, presb., a. 83, r. 36. 8. Alb. Feria V. IN CONCEPTIONE IMMACULATA
1986. Bolzano. Fr. Alberto M. Dalla Valle, presb., a. 75, r. 57. B. MARIAE V., sollemnitas.
2007. Reggio Emilia. Fr. Giuseppe M. Benassi, presb., a. 76, r. 60. Ad H. m. ant. pr. cum psalmodia complementari.
6. Viol. Feria III hebd. II Adv. (II Psalt.).
De ea. Vel:
Alb. S. Nicolai E.
MISSA feriae vel memoriae, pf. I Adv. vel de sancto.
L 1 Is 40, 1-11; Ps 95, 1-2. 3 et 10ac. 11-12. 13.
Ev Mt 18, 12-14.
ANNIVERSARIA
1972. Pistoia. Fr. Giustino M. Vitali, presb., a. 86, r. 69.
1999. Avellaneda. Fr. Adolfo Norberto M. Carrizo, presb., a. 41,
r. 13.
7. Alb. Feria IV hebd. II Adv. (II Psalt.).
S. Ambrosii E. D., memoria.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Gen 3, 9-15. 20; Ps 97, 1. 2-3ab. 3bc-4.
L 2 Eph 1, 3-6. 11-12.
Ev Lc 1, 26-38.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
In Statibus Foederatis Americae (U.S.A.) et in Insulis
Philippinis:
Sollemnitas IMMACULATAE CONCEPTIONIS B.
MARIAE V. celebratur quoque ut Patronae principalis
totius Nationis.
MISSA memoriae, pf. I Adv. vel de sancto.
L 1 Is 40, 25-31; Ps 102, 1-2. 3-4. 8 et 10.
Ev Mt 11, 28-30.
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1973. Viareggio. Fr. Innocenzo M. Rovetti, presb., a. 80, r. 62.
1983. Fullerton. Fr. Bonfilius M. Paré, presb., a. 81, r. 62.
1986. Verona. Fr. Luigi M. Trolio, presb., a. 66, r. 48.
ANNIVERSARIA
1999. Roma. Fr. Raffaele M. Preite, presb., a. 76, r. 59.
2006. Prestwich. Fr. Michael M. Rogers, presb., a. 80, r. 63.
9. Viol. Feria VI hebd. II Adv. (II Psalt.).
De ea. Vel:
Alb. S. Ioannis Didaci Cuauhtlatoatzin.
MISSA feriae vel memoriae, pf. I Adv. vel de sancto.
L 1 Is 48, 17-19; Ps 1, 1-2. 3. 4 et 6.
Ev Mt 11, 16-19.
8
TEMPUS ADVENTUS
ANNIVERSARIA
1985. Budapest. Fr. Manettus M. Sehr, a. 75, r. 50.
1989. Vicenza. Fr. Innocenzo M. Bernardi, presb., a. 75, r. 56.
10. Alb. Sabb. hebd. II Adv. (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae, Temp. Adv., pf. B. Mariae V. vel II
Adv.
L 1 Sir 48, 1-4. 9-11; Ps 79, 2ac et 3b. 15-16. 18-19.
Ev Mt 17, 10-13.
Vel:
Una e missis CMBMV Temp. Adv., praesertim form.
n. 1: Beata Maria Virgo excelsa Filia Israel.
B. Hieronymi de Sancto Angelo in Vado presb. O.N.
memoria omittitur.
I VESPERAE dom. III Adventus – Cp. post I Vp. dom.
Hodie ad Vp. et cras (dom. Gaudete), organa aliaque ins-
trumenta pulsari possunt.
ANNIVERSARIA
2006. Vicenza. Fr. Luciano M. Castellan, presb., a. 78, r. 61.
DECEMBER 2011
9
Prohibentur aliae celebrationes, excepta exsequiali.
S. Damasi I Pp. memoria omittitur.
II VESPERAE dom. III Adventus – Cp. post II Vp. dom.
1963.
1988.
2006.
2008.
ANNIVERSARIA
Vicenza. Fr. Giacinto M. Striolo, presb., a. 65, r. 47.
Montréal. Fr. Gérard M. Léveillé, presb., a. 74, r. 53.
Francavilla al Mare. Fr. Alessio M. Rotili, presb., a. 94, r. 78.
Senigallia. Fr. Luigi M. Poli, presb., a. 82, r. 62.
12. Viol. Feria II hebd. III Adv. (III Psalt.).
De ea. Vel:
Alb. B. Mariae Virg. de Guadalupe.
MISSA feriae vel memoriae, pf. I Adv. vel de B. Maria
Virg.
L 1 Num 24, 2-7. 15-17a; Ps 24, 4bc-5ab. 6-7bc. 8-9.
Ev Mt 21, 23-27.
Vel (in Missa B. Mariae Virg. de Guadalupe)
E Lectionario Sanctorum:
L 1 Is 7, 10-14; 8, 10c; Ps 66, 2-3. 5. 7-8.
Ev Lc 1, 39-48.
11. Viol. vel Ros. DOM. III ADVENTUS (hebd. III Psalt.). In Mexico:
De ea.
© MISSA pr., Credo, pf. I Adv. 12. Alb. Feria II. B. MARIAE VIRGINIS DE GUADALUPE,
REIPUBLICAE MEXICANAE PATRONAE PRINCI-
PALIS, sollemnitas.
Ad. H. m. ant. pr. cum psalmodia complementari.
L 1 Is 61, 1-2a. 10-11; Ps Lc 1, 46-48. 49-50. 53-54.
L 2 1 Thes 5, 16-24.
Ev Io 1, 6-8. 19-28.
11. I VESPERAE seq. – Cp. post I Vp. dom.
10
TEMPUS ADVENTUS
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 7, 10-14; 8, 10c vel Sir 24, 23-31; Ps 66, 2-3. 5.
7-8.
L 2 Gal 4, 4-7.
Ev Lc 1, 39-48.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, neque Missa exsequialis.
II VESPERAE soll. – Cp. post. II Vp. dom.
In aliis Americae Nationibus:
12. Alb. Feria II. B. MARIAE VIRGINIS DE GUADALUPE,
TOTIUS AMERICAE PATRONAE ATQUE REGINAE,
festum.
Ad H. m. ant. et pss. feria II hebd. III.
MISSA pr., Gloria, pf. pr.
L 1 Is 7, 10-14; 8, 10c; Ps 66, 2-3. 5. 7-8.
Ev Lc 1, 39-48.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
1975.
1980.
2000.
2004.
ANNIVERSARIA
Ancona. Fr. Mariano M. Santinelli, a. 88, r. 61.
Vicenza. Fr. Antonino M. Balasso, a. 71, r. 24.
Chicago. Fr. Jerome M. Hurley, presb., a. 86, r. 68.
São Paulo. Fr. Francesco M. Carnimeo, presb., a. 71, r. 54.
13. Rub. Feria III hebd. III Adv. (III Psalt.).
S. Luciae V. M., memoria.
DECEMBER 2011
11
MISSA memoriae, pf. I Adv. vel de sancta.
L 1 Soph 3, 1-2. 9-13; Ps 33, 2-3. 6-7. 17-18. 19 et 23.
Ev Mt 21, 28-32.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore Compassio-
niste Serve di Maria, hanc diem, qua anno 1921 Beata
Maria Magdalena Starace (1845-1921), Congegra-
tionis Fundatrix, in pace obdormivit, tamquam Diem
Congregationis celebrat. Anno 1893 die 1 novembris
Congregatio Ordini nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
beatae Virgini reddant et pro bono atque incremento
Instituti ferventes adhibeant preces.
ANNIVERSARIA
1967. Breganze. Fr. Manetto M. Salbego, presb., a. 73, r. 53.
1969. Avellaneda. Fr. Celso M. Milanesio, presb., a. 77, r. 60.
1970. Firenze. Fr. Saverio M. Pucci, presb., a. 57, r. 37.
14. Alb. Feria IV hebd. III Adv. (III Psalt.).
S. Ioannis a Cruce P. D., memoria.
Missa memoriae, pf. I Adv. vel de sancto.
L 1 Is 45, 6b-8. 18. 21b-25; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 7, 19-23.
15. Viol. Feria V hebd. III Adv. (III Psalt.).
De ea. Vel:
Alb. B. Bonaventurae de Pistorio, presbyteri O.N.
12
TEMPUS ADVENTUS
MISSA feriae vel memoriae, pf. I Adv. vel de beato.
L 1 Is 54, 1-10; Ps 29, 2 et 4. 5-6. 11-12a et 13b.
Ev Lc 7, 24-30.
ANNIVERSARIA
1980. Roma. Fr. Corrado M. Berti, presb., a. 69, r. 52.
1985. Detroit. Fr. Joseph M. Srill, presb., a. 85, r. 65.
1988. Avellaneda. Fr. Reginaldo M. Chies, presb., a. 66, r. 46.
16. Viol. Feria VI hebd. III Adv. (III Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 56, 1-3a. 6-8; Ps 66, 2-3. 5. 7-8.
Ev Io 5, 33-36.
A die 17 ad diem 24 decembris:
1. Admittuntur solummodo memoriae Sanctorum in calen-
dario generali inscriptae, celebrandae modo peculiari pp.
XXI-XXII indicato.
2. Missae ad diversa et votivae permittuntur solummodo
ob graviorem aliquam necessitatem vel pastoralem utilita-
tem (IM, 332). Missae cotidianae defunctorum non admit-
tuntur (IM, 337).
3. Pro Liturgia Horarum:
a) partes habentur propriae in altera sectione Ordinarii
temporis Adventus;
b) antiphonae propriae proponuntur pro psalmis ferialibus
Laudum et Vesperarum;
c) partes exstant in Proprio quae dici debent diebus men-
sis ipsis assignatis, omissis iis quae feriis hebdomadae III
Adventus tribuuntur.
DECEMBER 2011
13
ANNIVERSARIA
1990. Roma. Fr. Tarcisio M. Giallatini, presb., a. 79, r. 62.
2000. Todi. Fr. Riccardo M. Rossi, a. 90, r. 71.
17. Viol. Sabb. hebd. III Adv. (III Psalt.).
De eo.
MISSA pr., pf. II Adv.
Omissis lectionibus feriis hebd. III Adv. assignatis, sumun-
tur lectiones diebus mensis tributis.
L 1 Gen 49, 2. 8-10; Ps 71, 2. 3-4ab. 7-8. 17.
Ev Mt 1, 1-17.
I VESPERAE dom. IV Adventus – Cp. post I Vp. dom.
ANNIVERSARIA
1975. Todi. Fr. Agostino M. Fagiolo, presb., a. 84, r. 66.
18. Viol. DOM. IV ADVENTUS (hebd. IV Psalt.).
De ea.
© MISSA pr., Credo, pf. II Adv.
L 1 2 Sam 7, 1-5. 8b-12. 14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
L 2 Rom 16, 25-27.
Ev Lc 1, 26-38.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. IV Adventus – Cp. post II Vp. dom.
19. Viol. Feria II hebd. IV Adv. (IV Psalt.).
De ea.
14
TEMPUS ADVENTUS
MISSA pr., pf. II Adv.
L 1 Iudic 13, 2-7. 24-25a; Ps 70, 3-4a. 5-6ab. 16-17.
Ev Lc 1, 5-25.
ANNIVERSARIA
1961. Belen. Fr. Jack M. McLennan, presb., a. 68, r. 41.
2001. Empageni. Fr. Robert M. Kucera, presb., a. 73, r. 54.
20. Viol. Feria III hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Is 7, 10-14; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 1, 26-38.
ANNIVERSARIA
1973. Lienz. Fr. Agnell M. Neurauter, presb., a. 73, r. 53.
1977. Verona. Fr. Ferdinando M. Maroso, presb., a. 82, r. 63.
1989. Pesaro. Fr. Luca M. Simbeni, presb., a. 76, r. 57.
21. Viol. Feria IV hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Cant 2, 8-14 vel Soph 3, 14-18a;
Ps 32, 2-3. 11-12. 20-21.
Ev Lc 1, 39-45.
Fieri potest memoria S. Petri Canisii P. D., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
1968. Marina di Massa. Fr. Gioacchino M. Calabresi, presb.,
a. 69, r. 42.
DECEMBER 2011
15
1979. Malo. Fr. Ignazio M. Faggin, presb., a. 56, r. 37.
1984. Roma. Fr. Luigi M. Benedetti, a. 87, r. 57.
22. Viol. Feria V hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 1 Sam 1, 24-28; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Lc 1, 46-56.
ANNIVERSARIA
1963. Roma. Fr. Lorenzo M. Ferri, presb., a. 75, r. 59.
1990. Chicago. Fr. John M. Mullane, presb., a. 78, r. 60.
2000. Firenze. Fr. Siro M. Edoni, presb., a. 81, r. 60.
23. Viol. Feria VI hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Mal 3, 1-4. 23-24; Ps 24, 4bc-5ab. 8-9. 10 et 14.
Ev Lc 1, 57-66.
Fieri potest memoria S. Ioannis de Kety P., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
1986. Firenze. Fr. Luigi M. Mazzei, a. 76, r. 57.
1994. Roma. Fr. Giuseppe M. Besutti, presb., a. 75, r. 57.
2005. Conegliano. Fr. Romano M. Primon, presb., a. 90, r. 72.
24. Viol. Sabb. hebd. IV Adv. (IV Psalt.).
De eo.
16
TEMPUS ADVENTUS
MISSA MATUTINA feriae, pf. II Adv.
L 1 2 Sam 7, 1-5. 8b-12. 14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
Ev Lc 1, 67-79.
Prohibentur aliae celebrationes necnon Missa exsequialis.
Post Nonam explicit tempus Adventus.
ANNIVERSARIA
1989. Vicenza. Fr. Nazareno M. Griffante, presb., a. 66, r. 49.
2004. Bologna. Fr. Pacifico M. Branchesi, presb., a. 68, r. 51.
2005. Vicenza. Fr. Carlo M. Berti, presb., a. 86, r. 66.
TEMPUS NATIVITATIS
Post annuam mysterii paschalis celebrationem, nihil
antiquius habet Ecclesia quam memoriam Nativitatis
Domini et primarum eius manifestationum recolere:
quod fit tempore Nativitatis (AC, 32).
DECEMBER 2011
IN NATIVITATE DOMINI, sollemnitas cum oct.
24. Alb. Sabbato, vespere. – MISSA VIGILIAE pr., Gloria,
Credo, pf. (et Comm.) pr. (noctem sacratissimam).
L 1 Is 62, 1-5; Ps 88, 4-5. 16-17. 27 et 29.
L 2 Act 13, 16-17. 22-25.
Ev Mt 1, 1-25 vel 1, 18-25.
In Missis vigiliae et diei, ad verba symboli Et incarnatus est,
etc. genua flectunt (IM, 137).
In eiusdem Missis adhibeatur PE cum praefatione variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
In nocte Nat. Domini, ante Missam convenit ut sollemnis
vigilia celebretur per Off. lect. (IH, 215, 98, 73).
Cp. ab iis qui huic vigiliae intersunt non dicitur (IH, 215).
25. Alb. Dominica. Officium proprium.
© MISSA pr. Gloria, Credo, pf. (et Comm.) pr.
18
TEMPUS NATIVITATIS
In nocte:
L 1 Is 9, 1-6; Ps 95, 1-2a. 2b-3. 11-12. 13.
L 2 Tit 2, 11-14.
Ev Lc 2, 1-14.
In aurora:
L 1 Is 62, 11-12; Ps 96, 1 et 6. 11-12.
L 2 Tit 3, 4-7.
Ev Lc 2, 15-20.
In die:
L 1 Is 52, 7-10; Ps 97, 1. 2-3ab. 3cd-4. 5-6.
L 2 Hebr 1, 1-6.
Ev Io 1, 1-18 vel 1, 1-5. 9-14.
Hodie: 1. Omnes sacerdotes tres Missas celebrare vel conce-
lebrare possunt, dummodo hae suo tempore celebrentur.
Qui unam tantum Missam celebrat, eam sumat que respon-
det horae diei. Sacerdos hodie ter celebrans potest tres elee-
mosynas percipere (CIC, 951 § 1).
2. Prohibentur omnes aliae celebrationes necnon Missae
defunctorum, etiam exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1976. Vicenza. Fr. Giuseppe M. De Tomasi, a. 63, r. 44.
1978. Reggio Emilia. Fr. Luigi M. Dondini, presb., a. 68, r. 50.
2001. Chicago. Fr. Nicholas M. Norusis, presb., a. 86, r. 65.
26. Rub. Feria II. S. STEPHANI, PROTOMART., fes-
tum. – Ad H. m. ant. pr. et pss. feriae II hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
DECEMBER 2011
19
L 1 Act 6, 8-10; 7, 54-59; Ps 30, 3cd-4. 6 et 8ab. 16bc
et 17.
Ev Mt 10, 17-22.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 26 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1989. Montréal. Fr. Luc M. Lapalme, presb., a. 52, r. 33.
2004. Viareggio. Fr. Camillo M. Menchini, presb., a. 88, r. 71.
2005. Fullerton. Fr. Philip M. Eikmeyer, a. 84, r. 58.
27. Alb. Feria III. S. IOANNIS AP. ET EVANG., festum.
– Ad H. m. ant. pr. et pss. feriae III hebd. I.
MISSA pr., Gloria, lect. pr., pf. (et Comm.) Nat.
L 1 1 Io 1, 1-4; Ps 96, 1-2. 5-6. 11-12.
Ev Io 20, 2-8.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 27 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1965. Dundee. Fr. Peregrine M. Baldwin, presb., a. 61, r. 43.
1966. Plasencia. Fr. Férenc M. Németh, a. 42, r. 3.
2008. Kersal. Fr. John M. Knowles, a. 91, r. 66.
28. Rub. Feria IV. SS. INNOCENTIUM MART., festum.
– Ad H. m. ant. de temp. et pss. feriae IV hebd. I.
20
TEMPUS NATIVITATIS
MISSA pr., Gloria, lect. pr., pf. (et Comm.) Nat.
L 1 1 Io 1, 5 – 2, 2; Ps 123, 2-3. 4-5. 7b-8.
Ev Mt 2, 13-18.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 28 dec. – Cp. dom. (post I
vel II Vp.)
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore dell’Addo-
lorata Serve di Maria di Pisa, hanc diem, qua anno
1895 septem primae sorores in unum convenientes
fundamenta Instituti iecerunt, tamquam Diem
Congregationis celebrat. Anno 1916 die 1 novembris
Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae cum in liturgi-
cis tum in privatis orationibus dignas Deo et glorio-
sae Virgini grates referant et pro bono atque incre-
mento Congregationis fraternas effundant preces.
1981.
2001.
2001.
2010.
ANNIVERSARIA
Quilmes. Fr. Alessandro M. Belló, presb., a. 66, r. 47.
Acton Vale. Fr. Robert M. Desloges, presb., a. 77, r. 55.
Montréal. Fr. André M. Carrier, presb., a. 61, r. 40.
Reggio Emilia. Fr. Emidio M. Iotti, presb., a. 78, r. 61.
29. Alb. Feria V. De V DIE INFRA OCT. NAT. – Off.
ut diebus 25 et 29 dec. – Ad H. m. ant. de temp. et
pss. feriae V hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
L 1 1 Io 2, 3-11; Ps 95, 1-2a. 2b-3. 5b-6.
Ev Lc 2, 22-35.
DECEMBER 2011
21
Prohibentur Missae defunctorum, excepta exsequiali aut
in primo anniversario (IM, 381).
Fieri potest memoria S. Thomae Becket E.M., ut supra
pp. XXI-XXII notatur.
Vp. Nat., ut diebus 25 et 29 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1965. Withier. Fr. Policarpo M. Campo, presb., a. 48, r. 30.
1967. Santiago del Chile. Fr. Sergio M. Furegon, presb., a. 32,
r. 12.
1983. Napoli. Fr. Cirillo M. Perucatti, presb., a. 66, r. 42.
1984. Medellín. Fr. Angelo M. Mancini, presb., a. 68, r. 52.
1996. Montréal. Fr. Luc M. Lévesque, presb., a. 65, r. 46.
2003. Vicenza. Fr. Mariano M. Martinello, presb., a. 59, r. 41.
2004. Montréal. Fr. Bertrand M. Saint-Laurent, presb., a. 83,
r. 63.
30. Alb. Feria VI. S. FAMILIAE IESU, MARIAE ET
IOSEPH, festum. – Ad H. m. ant. pr. et pss. feriae
VI hebd. I.
MISSA pr., Gloria, Credo, pf. (et Comm.) Nat.
L 1 Sir 3, 3-7. 14-17a (gr. 2-6. 12-14);
Ps 127, 1-2. 3. 4-5.
L 2 Col 3, 12-21.
Ev Lc 2, 22-40 vel 2, 22. 39-40.
Vel:
L 1 Gen 15, 1-6; 21, 1-3; Ps 104, 1b-2. 3-4. 5-6. 8-9.
L 2 Hebr 11, 8. 11-12. 17-19.
Ev Lc 2, 22-40 vel 2, 22. 39-40.
Prohibentur Missae defunctorum, excepta exsequiali.
22
TEMPUS NATIVITATIS
ANNIVERSARIA
1968. Hillside. Fr. Philip M. Philbin, presb., a. 60, r. 39.
2001. Piedimonte Matese. Fr. Luigi M. Mercolino, presb., a. 79,
r. 60.
31. Alb. Sabbato. De VII DIE INFRA OCT. NAT. –
Off. ut diebus 25 et 31 dec. – Ad H. m. ant. de
temp. et pss. sabbati hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
L 1 1 Io 2, 18-21; Ps 95, 1-2. 11-12. 13.
Ev Io 1, 1-18.
Prohibentur Missae defunctorum, excepta exsequiali aut
in primo anniversario (IM, 381).
Fieri potest memoria S. Silvestri I Pp., ut supra pp. XXI-
XXII notatur (non autem ad Vp.).
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1989. Calumet Park. Fr. Lawrence M. Biskner, presb., a. 61, r. 38.
2001. México. Fr. Faustino M. Faustini, presb., a. 72, r. 55.
2004. Montefiascone (Viterbo). Fr. Salvatore M. Preite, presb.,
a. 84, r. 67.
Valde commendatur ut in omnibus ecclesiis
Servorum Familiae hac nocte qua fit transitus ad
annum 2012 SOLLEMNIS VIGILIA celebretur.
ANNO DOMINI 2012
Lectionarium festivum B
Lectionarium feriale II
IANUARIUS 2012
1. Alb. Dominica. In octava Nativitatis Domini.
SOLLEMNITAS SANCTAE DEI GENETRICIS
MARIAE. – Ad H. m. ant. pr. cum psalmodia com-
plementari.
© MISSA pr., Gloria, Credo, pf. I B. Mariae V. Et te in
Maternitate. In canone rom. Comm. Nat.
L 1 Num 6, 22-27; Ps 66, 2-3. 5. 6 et 8.
L 2 Gal 4, 4-7.
Ev Lc 2, 16-21.
Adhibeatur PE cum praefatione variabili.
DIES PRO PACE
Ubi peculiares fiunt celebrationes pro die paci foven-
dae dicato, dici potest, de iudicio Ordinarii loci, Missa
pro pace, secundum schema a Sancta Sede singulis
annis propositum et themati celebrationis respondens.
Non permittuntur aliae celebrationes neque Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
24
TEMPUS NATIVITATIS
In feriis temporis natalicii usque ad diem 7 ianuarii:
a) In Officio: Ant. ad invitatorium, hymni, antiphona ad
Horam mediam sumuntur e Proprio de Tempore, respec-
tive ante vel post Epiphaniam.
b) Quoad Missam: Non permittuntur Missae ad diversa,
votivae aut cotidianae defunctorum (IM, 381), nisi necessi-
tas vel utilitas pastoralis id requirat (IM, 376). Permittuntur
tamen Missae de memoriis forte occurrentibus, aut de
Sanctis his diebus in Martyrologio inscriptis (IM, 355b).
ANNIVERSARIA
1962. Buer. Fr. Augustine M. Daly, presb., a. 40, r. 11.
1978. Budrio. Fr. Prospero M. Tubertini, presb., a. 78, r. 56.
2. Alb. Feria II temp. Nat. (hebd. II Psalt.).
Ss. Basilii Magni et Gregorii Nazianzeni, Epp. D.,
memoria.
MISSA memoriae, pf. Nat.
L 1 1 Io 2, 22-28; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 1, 19-28.
ANNIVERSARIA
1966. San Pierre. Fr. Sostene M. Doherty, presb., a. 66, r. 45.
2009. Roma. Fr. Paolo M. Erthler, presb., a. 67, r. 50.
IANUARIUS 2012
De Ss. Nomine:
L 1 Phil 2, 1-11; Ps 8, 4-5. 6-7. 8-9.
Ev Lc 2, 21-24.
4. Alb. Feria IV temp. Nat. (hebd. II Psalt.)
De ea.
MISSA pr., pf. Nat.
L 1 1 Io 3, 7-10; Ps 97, 1. 7-8. 9.
Ev Io 1, 35-42.
ANNIVERSARIA
1962. Perugia. Fr. Sostegno M. Dal Magro, a. 57, r. 32.
1982. Heidelberg. Fr. Francesco M. Trevisol, presb., a. 72, r. 52.
2004. Torino. Fr. Giovenale M. Zorniotti, presb., a. 75, r. 56.
COMMODITATIS CAUSA DUPLEX INTEGRA
SERIES DIERUM 5-9 IANUARII PROPONITUR
PROUT SOLLEMNITAS EPIPHANIAE DIE 6
IANUARII AUT PRIMA DOMINICA POST OCTA-
VAM NATIVITATIS CELEBRATUR.
Ubi sollemnitas Epiphaniae die dominica celebratur:
3. Alb. Feria III temp. Nat. (hebd. II Psalt.)
De ea. Vel:
Alb. Ss.mi Nominis Iesu.
MISSA pr., pf. Nat.
L 1 1 Io 2, 29 – 3, 6; Ps 97, 1. 3cd-4. 5-6.
Ev Io 1, 29-34.
25
5. Alb. Feria V temp. Nat. (hebd. II Psalt.).
De ea.
MISSA feriae, pf. Nat.
L 1 1 Io 3, 11-21; Ps 99, 2. 3. 4. 5.
Ev Io 1, 43-51.
26
TEMPUS NATIVITATIS
ANNIVERSARIA
1975. Alessandria. Fr. Anselmo M. Péaquin, presb., a. 71, r. 46.
1980. Maria Waldrast. Fr. Adolfo M. Pojer, presb., a. 69, r. 51.
1983. Verona. Fr. Celio M. Marchesan, presb., a. 57, r. 38.
6. Alb. Feria VI temp. Nat. (hebd. II Psalt.).
De ea.
MISSA feriae, pf. Nat.
L 1 1 Io 5, 5-13; Ps 147, 12-13. 14-15. 19-20.
Ev Mc 1, 7-11 vel Lc 3, 23-38 vel 3, 23. 31-34. 36. 38.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus African Servite
Sisters (Swaziland), hanc diem, qua anno 1935 sep-
tem primae sorores religionis vota nuncuparunt,
tamquam Diem Congregationis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperum necnon Sacrificii eucharisti-
ci Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
ANNIVERSARIA
1963. Udine. Fr. Giovannangelo M. Duso, a. 75, r. 51.
7. Alb. Sabb. temp. Nat. (hebd. II Psalt.).
De eo. Vel:
Alb. S. Raimundi de Penyafort P. Vel:
Alb. De S. Maria in sabb.
MISSA feriae vel memoriae, pf. Nat. vel de sancto, vel MISSA
B. Mariae V., temp. Nat., pf. Nat.
IANUARIUS 2012
27
L 1 1 Io 5, 14-21; Ps 149, 1-2. 3-4. 5 et 6a et 9b.
Ev Io 2, 1-11.
Vel:
Una e missis CMBMV Temp. Nat. praesertim form. n. 6:
Beata Maria Virgo, in Epiphania Domini.
I VESPERAE seq. soll. – Cp. post. I Vp. dom.
ANNIVERSARIA
1993. Genova. Fr. Gabriele M. Marchesini, presb., a. 58, r. 38.
2003. Maddaloni (Caserta). Fr. Bonfiglio M. Mautone, presb.,
a. 81, r. 63.
8. Alb. Dominica II post Nativitatem.
IN EPIPHANIA DOMINI, sollemnitas.
Omnia ut infra, die 6 januarii, pp. 29-30.
II VESPERAE soll. – Cp. post II Vp. dom.
1992.
2000.
2008.
2009.
ANNIVERSARIA
Arco. Fr. Mauro M. Todde, presb., a. 57, r. 37.
Chicago. Fr. Francis M. Martin, presb., a. 82, r. 59.
Negrar. Fr. Mario M. Masini, presb., a. 80, r. 63.
Vicenza. Fr. Raffaele M. Borotto, presb., a. 82, r. 63.
TRIDUUM
S. ANTONII MARIÆ PUCCI
Diebus 9-10-11 ianuarii… (cfr. p. 32)
28
29
TEMPUS NATIVITATIS IANUARIUS 2012
9. Alb. Feria II. IN BAPTISMATE DOMINI, festum. – Ad ANNIVERSARIA
H. m. ant. pr. et pss. feriae II hebd. III Psalt. 1975. Alessandria. Fr. Anselmo M. Péaquin, presb., a. 71, r. 46.
1980. Maria Waldrast. Fr. Adolfo M. Pojer, presb., a. 69, r. 51.
1983. Verona. Fr. Celio M. Marchesan, presb., a. 57, r. 38.
MISSA pr., Gloria, pf. pr.
L 1 Is 42, 1-4. 6-7 vel Act 10, 34-38;
Ps 28, 1a et 2. 3ac-4. 3b et 9b-10.
Ev Mc 1, 7-11.
Vel:
L 1 Is 55, 1-11 vel. 1 Io 5, 1-9; Ps Is 12, 2-3. 4bcd. 5-6.
Ev Mc 1, 7-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE festi. – Cp. post II Vp. dom.
Post Completorium explicit Tempus Nativitatis.
1979.
1984.
1989.
1996.
ANNIVERSARIA
Detroit. Fr. Paul M. Onderbeke, presb., a. 58, r. 37.
Ciudad Juárez. Fr. Lorenzo M. Maggion, presb., a. 65,
r. 44.
Vicenza. Fr. Mario M. Dal Vecchio, presb., a. 66, r. 47.
Negrar. Fr. Patrizio M. Antonutti, presb., a. 83, r. 61.
Ubi sollemnitas Epiphaniae die 6 ianuarii celebratur:
5. Alb. Feria V temp. Nat. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Nat.
L 1 1 Io 3, 11-21; Ps 99, 2. 3. 4. 5.
Ev Io 1, 43-51.
IN EPIPHANIA DOMINI, sollemnitas.
5. Alb. Feria V temp. Nat., vespere –
© MISSA vespertina soll., Gloria, Credo, pf. (et Comm.) pr.
Lectiones sumuntur e Missa in die sollemnitatis.
I VESPERAE Epiphaniae – Cp. post I Vp. dom.
6. Alb. Feria VI. IN
prium.
DIE SOLLEMNITATIS.
– Off. pro-
© MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Is 60, 1-6; Ps 71, 2. 7-8. 10-11. 12-13.
L 2 Eph 3, 2-3a. 5-6.
Ev Mt 2, 1-12.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequialis.
In Missa huius diei, post evangelium, annuntiantur festa
mobilia iuxta formulam Pontificalis Romani: cf. p. III
huius calendarii.
Feriis temporis natalicii post Epiphaniam in Liturgia
Horarum habentur hymni proprii; item in Missa habetur
collecta propria.
II VESPERAE Epiphaniae – Cp. post II Vp. dom.
30
TEMPUS NATIVITATIS
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus African Servite
Sisters (Swaziland), hanc diem, qua anno 1935 sep-
tem primae sorores religionis vota nuncuparunt,
tamquam Diem Congregationis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperum necnon Sacrificii eucharisti-
ci Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
ANNIVERSARIA
1963. Udine. Fr. Giovannangelo M. Duso, a. 75, r. 51.
7. Alb. Sabb. post Epiphaniam (hebd. II Psalt.).
De eo. Vel:
Alb. S. Raymundi de Penyafort P. Vel:
Alb. De S. Maria in sabb.
MISSA feriae vel memoriae, pf. Epiph. vel Nat. vel de
sancto, vel MISSA B. Mariae V., Temp. Nat., pf. Epiph.
vel Nat.
L 1 1 Io 3, 22 – 4, 6; Ps 2, 7-8. 10-11.
Ev Mt 4, 12-17. 23-25.
Vel:
Una e missis CMBMV Temp. Nat., praesertim form.
n. 6: Beata Maria Virgo, in Epiphania Domini.
I VESPERAE seq. – Cp. post. 1 Vp. dom.
IANUARIUS 2012
31
ANNIVERSARIA
1993. Genova. Fr. Gabriele M. Marchesini, presb., a. 58, r. 38.
2003. Maddaloni (Caserta). Fr. Bonfiglio M. Mautone, presb.,
a. 81, r. 63.
8. Alb. Dom. III post Nat. IN BAPTISMATE DOMINI,
festum. – Ad H. m. ant. pr. et pss. dom. hebd. III Psalt.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 42, 1-4. 6-7; Ps 28, 1a et 2. 3ac-4. 3b et 9b-10.
L 2 Act 10, 34-38.
Ev Mc 1, 7-11.
Vel:
L 1 Is 55, 1-11; Ps Is 12, 2-3. 4bcd. 5-6.
L 2 1 Io 5, 1-9.
Ev Mc 1, 7-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE festi. – Cp. post II Vp. dom.
Post Completorium explicit Tempus Nativitatis.
1992.
2000.
2008.
2009.
ANNIVERSARIA
Arco. Fr. Mauro M. Todde, presb., a. 57, r. 37.
Chicago. Fr. Francis M. Martin, presb., a. 82, r. 59.
Negrar. Fr. Mario M. Masini, presb., a. 80, r. 63.
Vicenza. Fr. Raffaele M. Borotto, presb., a. 82, r. 63.
32
TEMPUS NATIVITATIS
TRIDUUM
S. ANTONII MARIÆ PUCCI
Diebus 9-10-11 ianuarii in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut
fratres omnesque sodales ad festum S. Antonii
Mariæ Pucci celebrandum apte disponantur. Ad
hoc opportune adhibebitur subsidium cui est
titulus In lode di sant’Antonio Maria Pucci vel In praise of saint
Anthony Pucci vel À la louange de saint Antoine-Marie Pucci vel
En honor de san Antonio María Pucci.
TEMPUS PER ANNUM
ante Quadragesimam
Tempore per annum non celebratur peculiaris my-
sterii Christi aspectus: sed potius ipsum mysterium
Christi in sua plenitudine recolitur, praesertim
diebus dominicis (AC, 43).
Pro Officio divino sumitur vol. III Liturgiae Horarum.
In Missa, Lectionarium feriale, Anno II.
IANUARIUS 2012
9. Vir. Feria II hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 1, 1-8; Ps 115, 12-13. 14-17. 18-19.
Ev Mc 1, 14-20.
In Missis votivis et in Missis B. Mariae V. in sabbato, adhiberi
potest color sive proprius Missae, sive diei, sive temporis.
1979.
1984.
1989.
1996.
ANNIVERSARIA
Detroit. Fr. Paul M. Onderbeke, presb., a. 58, r. 37.
Ciudad Juárez. Fr. Lorenzo M. Maggion, presb., a. 65,
r. 44.
Vicenza. Fr. Mario M. Dal Vecchio, presb., a. 66, r. 47.
Negrar. Fr. Patrizio M. Antonutti, presb., a. 83, r. 61.
34
TEMPUS PER ANNUM
10. Vir. Feria III hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 1, 9-20; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Mc 1, 21b-28.
ANNIVERSARIA
1983. Tirano. Fr. Mansueto M. Malva, presb., a. 63, r. 44.
1998. Cochabamba. Fr. Sergio M. Mesaglio Venuti, presb., a. 76,
r. 58.
11. Vir. Feria IV hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 3, 1-10. 19-20; Ps 39, 2 et 5. 7-8a. 8b-9. 10.
Ev Mc 1, 29-39.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Addolorata (Nocera), hanc diem, qua anno 1900
Maria Consilia a Spiritu Sancto (1845-1900),
Congregationis Fundatrix, in Domino quievit, tam-
quam Diem Congregationis festive commemorat.
Anno 1880 die 15 octobris Congregatio Ordini
nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo
reddant et pro bono atque incremento Instituti fer-
ventes adhibeant preces.
IANUARIUS 2012
1980.
1980.
1985.
1997.
1999.
35
ANNIVERSARIA
Arco. Fr. Giorgio M. Posenato, presb., a. 61, r. 42.
Montréal. Fr. Amédée M. Lavigueur, presb., a. 83, r. 48.
Mezökövesd. Fr. Cyprian M. Kovács, presb., a. 69, r. 49.
Siracusa. Fr. Eugenio M. Pantano, presb., a. 72, r. 53.
Wheeling. Fr. Frank M. Calkins, presb., a. 92, r. 73.
12. Alb. Feria V. S. ANTONII MARIAE PUCCI, PRES-
BYTERI O. N., festum. – Ad H. m. ant. et pss. feriae
V, hebd. I.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 Ez 34, 11-16. 31; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Io 10, 11-16.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1963. Dublin. Fr. Conleth M. Doherty, presb., a. 35, r. 10.
2000. Dundee. Fr. Anselm M. Richardson, presb., a. 78, r. 57.
13. Vir. Feria VI hebd. I per annum (I Psalt.).
De ea. Vel:
Alb. S. Hilarii E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 8, 4-7. 10-22a; Ps 88, 16-17, 18-19.
Ev Mc 2, 1-12.
ANNIVERSARIA
1976. Todi. Fr. Adriano M. Lucchetti, a. 83, r. 48.
2009. Guadalajara. Fr. Valerio M. Maccagnan, presb., a. 81, r. 63.
36
TEMPUS PER ANNUM
14. Alb. Sabb. hebd. I per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae, quae vel e Missali Romano vel e
Proprio Missarum O. N. vel e CMBMV Temp. per
annum sumi potest.
L 1 1 Sam 9, 1-4. 17-19; 10, 1a; Ps 20, 2-3. 4-5. 6-7.
Ev Mc 2, 13-17.
Vel:
Una e missis CMBMV Temp. Quadr., praesertim
form. n. 10: Sancta Maria, discipula Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
1978.
1981.
1992.
2009.
ANNIVERSARIA
Bruxelles. Fr. Alexis M. Vanderstraeten, presb., a. 82, r. 55.
Follina. Fr. Pietro M. Belia, presb., a. 65, r. 46.
Massa. Fr. Antonio M. Montà, presb., a. 73, r. 52.
Saviano. Fr. Fedele M. Ciarcià, presb., a. 96, r. 80.
15. Vir. DOM. II PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Sam 3, 3b-10. 19; Ps 39, 2 et 4ab. 7-8a. 8b-9. 10.
L 2 1 Cor 6, 13c-15a. 17-20.
Ev Io 1, 35-42.
Prohibentur Missae defunctorum, excepta exsequiali.
B. Iacobi de Villa, Eleemosynarii nuncupati, memoria
omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
IANUARIUS 2012
37
ANNIVERSARIA
1973. Reggio Emilia. Fr. Paolo M. Bagnacani, presb., a. 47, r. 30.
1979. Vicenza. Fr. Mariano M. Tognetti, presb., a. 57, r. 39.
16. Vir. Feria II hebd. II per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 15, 16-23; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mc 2, 18-22.
ANNIVERSARIA
1964. Ronzano. Fr. Anacleto M. Brasa, presb., a. 74, r. 57.
1990. Napoli. Fr. Angelo M. Di Giuseppe, presb., a. 66, r. 49.
1995. Anaheim. Fr. Gregory M. O’Brien, presb., a. 79, r. 60.
17. Alb. Feria III hebd. II per annum (II Psalt.).
S. Antonii A., memoria.
MISSA memoriae.
L 1 1 Sam 16, 1-13; Ps 88, 20. 21-22. 27-28.
Ev Mc 2, 23-28.
PRO UNITATE CHRISTIANORUM
A die 18 ad diem 25 ianuarii fit octiduum supplica-
tionum pro unitate christianorum.
ANNIVERSARIA
1964. Vicenza. Fr. Gabriele M. Giacomozzi, presb., a. 54, r. 37.
1975. Hillside. Fr. Luigi M. Giambastiani, presb., a. 89, r. 73.
2003. Civita Castellana (Viterbo). Fr. Pietro M. Tollo, presb.,
a. 83, r. 66.
38
TEMPUS PER ANNUM
18. Vir. Feria IV hebd. II per annum (II Psalt.).
De ea.
IANUARIUS 2012
L 1 1 Sam 24, 3-21; Ps 56, 2. 3-4. 6 et 11.
Ev Mc 3, 13-19.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 17, 32-33. 37. 40-51; Ps 143, 1. 2. 9-10.
Ev Mc 3, 1-6.
1991.
1992.
1996.
2002.
ANNIVERSARIA
Irún. Fr. Raffaele M. Trotti, presb., a. 71, r. 52.
Vicenza. Fr. Graziano M. Bandiera, a. 53, r. 36.
Plasencia. Fr. Julio M. Muñoz Prieto, a. 76, r. 38.
Nyíregyháza. Fr. Elek M. Póka, presb., a. 87, r. 69.
19. Vir. Feria V hebd. II per annum (II Psalt.).
De ea.
39
1979.
1989.
1999.
2005.
2010.
ANNIVERSARIA
Montecchio Precalcino. Fr. Pietro M. Berton, a. 79, r. 57.
Begbroke. Fr. Vincent M. Naughton, presb., a. 80, r. 59.
Quilmes. Fr. Buenaventura M. Signori, a. 81, r. 62.
Reggio Emilia. Fr. Francesco M. Moioli, presb., a. 63, r. 42.
Cochabamba. Fr. Lorenzo M. Santinon Bianco, diac.,
a. 85, r. 51.
21. Rub. Sabb. hebd. II per annum (II Psalt.).
S. Agnetis V. M., memoria.
Ad Laudes ant. propriae cum psalmis dom. hebd. I.
MISSA ad libitum (cf. p. XVIII). MISSA memoriae.
L 1 1 Sam 18, 6-9; 19, 1-7; Ps 55, 2-3. 9-10ab. 10c-11. L 1 2 Sam 1, 1-4. 11-12. 19. 23-27; Ps 79, 2-3. 5-7.
12-13. Ev Mc 3, 20-21.
Ev Mc 3, 7-12.
ANNIVERSARIA
1995. Livorno. Fr. Giacomo Filippo M. Tognocchi, presb., a. 93,
r. 74.
2000. Hall. Fr. Narzissus M. Obermeier, presb., a. 89, r. 67.
20. Vir. Feria VI hebd. II per annum (II Psalt.).
De ea. Vel:
Rub. S. Fabiani Pp. M. Vel:
Rub. S. Sebastiani M.
MISSA ad libitum (cf. p. XVIII).
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1975. Udine. Fr. Martino M. Dario, a. 65, r. 34.
1984. Ciudad de México. Fr. Silvestro M. Caron, presb., a. 68,
r. 49.
1987. Regensburg. Fr. Wolfgang M. Riser, presb., a. 50, r. 30.
22. Vir. DOM III PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ion 3, 1-5. 10; Ps 24, 4bc-5ab. 6-7bc. 8-9.
40
TEMPUS PER ANNUM
L 2 1 Cor 7, 29-31.
Ev Mc 1, 14-20.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Vincentii Diac. M. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1994. Napoli. Fr. Pio M. D’Alessandro, presb., a. 80, r. 63
2007. Plasencia. Fr. Joaquín M. Cruz Hierro, presb., a. 68, r. 50.
23. Vir. Feria II hebd. III per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 5, 1-7. 10; Ps 88, 20. 21-22. 25-26.
Ev Mc 3, 22-30.
ANNIVERSARIA
1979. Vicenza. Fr. Luigi M. Alba, presb., a. 85, r. 69.
24. Alb. Feria III hebd. III per annum (III Psalt.).
S. Francisci de Sales E. D., memoria.
MISSA memoriae.
L 1 2 Sam 6, 12b-15. 17-19; Ps 23, 7. 8. 9. 10.
Ev Mc 3, 31-35.
ANNIVERSARIA
1965. Chicago. Fr. Martin M. White, presb., a. 61, r. 40.
1972. Vicenza. Fr. Antonino M. Basso, presb., a. 77, r. 57.
1985. Denia. Fr. Giacinto M. Triulzi, presb., a. 71, r. 55.
IANUARIUS 2012
41
25. Alb. Feria IV. IN CONVERSIONE S. PAULI AP.,
festum. – Ad H. m. ant. pr. et pss. feriae IV hebd. III.
MISSA pr., Gloria, lect. pr., PE cum pf. App.
L 1 Act 22, 3-16 vel Act 9, 1-22; Ps 116, 1. 2.
Ev Mc 16, 15-18.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
2008. Vicenza. Fr. Angelico M. Sgarbossa, presb., a. 85, r. 66.
26. Alb. Feria V hebd. III per annum (III Psalt.).
Ss. Timothei et Titi E., memoria.
MISSA memoriae, lect. pr.
L 1 2 Tim 1, 1-8 vel Tit 1, 1-5; Ps 95, 1-2a. 2b-3. 7-8a. 10.
Ev Lc 10, 1-9.
ANNIVERSARIA
1965. Viareggio. Fr. Vittorino M. Benvenuti, a. 66, r. 42.
1970. Caxambu. Fr. Giacomo Filippo M. Mattioli, presb., a. 82,
r. 66.
27. Vir. Feria VI hebd. III per annum (III Psalt.).
De ea. Vel:
Alb. S. Angelae Merici V.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 11, 1-4a. 5-10a. 13-17;
Ps 50, 3-4. 5-6a. 6bc-7. 10-11.
Ev Mc 4, 26-34.
42
TEMPUS PER ANNUM
1965.
1977.
1978.
1982.
1989.
ANNIVERSARIA
Vicenza. Fr. Biagio M. Frattin, a. 80, r. 53.
Saint-Ortaire. Fr. Vincent M. Bansard, presb., a. 72, r. 48.
Roma. Fr. Daniele M. Santoro, a. 26, r. 4 mensium.
Verona. Fr. Adriano M. Agosteo, presb., a. 65, r. 46.
Calumet Park. Fr. Norberto M. Balasso, presb., a. 66, r. 46.
28. Alb. Sabb. hebd. III per annum (III Psalt.).
S. Thomae de Aquino P. D., memoria.
IANUARIUS 2012
43
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1986. Mouila (Gabon). Fr. Robert M. Berthelet, presb., a. 56,
r. 35.
2002. Vicenza. Fr. Igino M. Urbani, presb., a. 82, r. 65.
30. Vir. Feria II hebd. IV per annum (IV Psalt.).
De ea.
MISSA memoriae. MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 12, 1-7a. 10-17; Ps 50, 12-13. 14-15. 16-17. L 1 2 Sam 15, 13-14. 30; 16, 5-13a; Ps 3, 2-3. 4-5. 6-7.
Ev Mc 4, 35-41. Ev Mc 5, 1-20.
I VESPERAE dom. – Cp. post I Vp. dom.
1975.
1978.
1980.
1990.
1996.
2001.
ANNIVERSARIA
Garbagnate. Fr. Gabriele M. Crespi, presb., a. 55, r. 21.
Hochzirl. Fr. Stanislaus M. Faschinger, a. 74, r. 40.
Bologna. Fr. Domenico M. Nascetti, presb., a. 73, r. 55.
Bologna. Fr. Amadio M. Brighetti, presb., a. 82, r. 65.
Mestre. Fr. Eugenio M. Zucco, a. 67, r. 47.
Vicenza. Fr. Giocondo M. Todescato, presb., a. 87, r. 68.
29. Vir. DOM. IV PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Deut 18, 15-20; Ps 94, 1-2. 6-7. 8-9.
L 2 1 Cor 7, 32-35.
Ev Mc 1, 21-28.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1974. Follina. Fr. Felice M. Brazzale, presb., a. 46, r. 28.
1995. Firenze. Fr. Angiolo M. Attanasio, a. 70, r. 23.
2011. Firenze. Fr. Terenzio M. Biondi, presb., a. 89, r. 71.
31. Alb. Feria III hebd. IV per annum (IV Psalt.).
S. Ioannis Bosco P., memoria.
MISSA memoriae.
L 1 2 Sam 18, 9-10. 14b. 24-25a. 30-19,3; Ps 85, 1-2.
3-4. 5-6.
Ev Mc 5, 21-43.
ANNIVERSARIA
1965. La Plata. Fr. Giuseppe M. Giuriato, presb., a. 47, r. 29.
2007. Trieste. Fr. Giorgio M. Trivellin, presb., a. 75, r. 58.
2010. Sondrio. Fr. Camillo M. De Piaz, presb., a. 91, r. 74.
FEBRUARIUS 2012
FEBRUARIUS 2012
1. Vir. Feria IV hebd. IV per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 24, 2. 9-17; Ps 31, 1-2. 5. 6. 7.
Ev Mc 6, 1-6.
45
VESPERAE de festo.
Cras: Fieri poterit benedictio gutturis, cum candelis
eadem die (3 febr.) benedictis (exstinctis), secundum for-
mulam Rit. Rom. et adhibitis verbis: «Per intercessionem
sancti Blasii, Episcopi et Martyris, liberet te Deus a malo gut-
turis et a quolibet alio malo. In nomine Patris, et Filii, et
Spiritus Sancti. Amen».
Cras: 1) Candelae benedici possunt cum processione vel
introitu sollemni, ut in Missali. Ecclesiam vel presbyte-
rium ingrediendo canitur ant. ad introitum, quam statim
sequitur Gloria, collecta, etc.
2) Initio fideles in manibus tenent candelas, quae acce-
duntur dum canitur ant. Ecce Dominus.
3) In processione sacerdos casulam vel pluviale induit.
DIES INSTITUTI
Institutum saeculare cui est titulus Regnum Mariae,
hodie Diem Instituti festive celebrat. Anno 1976 die
23 novembris Institutum Ordini nostro aggregatum est.
Fratres et sorores totius Ordinis pro bono atque incre-
mento Instituti Dominum et beatam Virginem enixe
exorent.
ANNIVERSARIA 1968.
1968. Reggio Emilia. Fr. Benedetto M. Marconi, presb., a. 80, 1978.
r. 64. 1984.
1994. Negrar. Fr. Amadio M. Gasperini, a. 85, r. 61. 1987.
2001. Napoli. Fr. Andrea M. D’Andrea, presb., a. 79, r. 59.
2007. Firenze. Fr. Nicolò M. Manzi, presb., a. 86, r. 58.
2. Alb. Feria V. IN PRAESENTATIONE DOMINI, 3. Alb. Feria VI hebd. IV per annum (IV Psalt.).
festum. – Ad H. m. ant. et pss. feriae V hebd. IV. B. Ioachimi Senensis religiosi O.N., memoria
ANNIVERSARIA
Roma. Fr. Lorenzo M. Lucatelli, presb., a. 69, r. 46.
Budapest. Fr. Gellért M. Lepkó, presb., a. 65, r. 42.
Carrara. Fr. Giulio M. Moretti, a. 69, r. 52.
Bognor Regis. Fr. Bernard M. O’Hanlon, presb., a. 75, r. 57.
MISSA pr., Gloria, lect. pr., pf. pr. MISSA memoriae.
L 1 Mal 3, 1-4 vel Hebr 2, 14-18; Ps 23, 7. 8. 9. 10. L 1 Sir 47, 2-13 (gr. 2-11); Ps 17, 31. 47 et 50. 51.
Ev Lc 2, 22-40 vel 2, 22-32. Ev Mc 6, 14-29.
Adhibeatur PE cum praefatione variabili. Ss. Blasii E. M. et Ansgarii E. memoria omittitur.
Prohibentur Missae defunctorum, excepta exsequiali.
46
47
TEMPUS PER ANNUM FEBRUARIUS 2012
ANNIVERSARIA ANNIVERSARIA
1995. Ottawa. Fr. Grégoire M. Saint-Germain, presb., a. 74, 1992. Firenze. Fr. Dionisio M. Gaspari, a. 75, r. 53.
r. 55. 1997. Reggio Emilia. Fr. Bernardo M. Tomassetti, a. 63, r. 42.
2011. Cochabamba. Fr. Giuseppe M. Sartori, presb., a. 65, r. 48.
4. Alb. Sabb. hebd. IV per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 1 Reg 3, 4-13; Ps 118, 9. 10. 11. 12. 13. 14.
Ev Mc 6, 30-34.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 7: Sancta Maria in Praesentatione Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
2003. Montréal. Fr. Antoine M. Dupuis, presb., a. 73, r. 55.
2007. Chicago. Fr. James M. Dore, presb., a. 74, r. 54.
5. Vir. DOM. V PER ANNUM (Hebd. I Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Iob 7, 1-4. 6-7; Ps 146, 1-2. 3-4. 5-6.
L 2 1 Cor 9, 16-19. 22-23.
Ev Mc 1, 29-39.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Agathae V. M. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
6. Rub. Feria II hebd. V per annum (I Psalt).
Ss. Pauli Miki et soc. Mm., memoria.
MISSA memoriae.
L 1 1 Reg 8, 1-7. 9-13; Ps 131, 6-7. 8-10.
Ev Mc 6, 53-56.
1975.
1982.
1983.
1984.
1992.
2004.
2005.
ANNIVERSARIA
Siena. Fr. Giovanni M. Rossi, a. 69, r. 27.
Firenze. Fr. Raffaele M. Paoletti, a. 66, r. 43.
Albuquerque. Fr. Paul M. Theado, presb., a. 70, r. 46.
Albuquerque. Fr. Edward M. Calkins, presb., a. 88, r. 66.
Milano. Fr. David M. Turoldo, presb., a. 75, r. 56.
Negrar. Fr. Stefano M. Praticelli, presb., a. 78, r. 59.
Roma. Fr. Ignacio M. Calabuig Adán, presb., a. 73, r. 53.
7. Vir. Feria III hebd. V per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 8, 22-23. 27-30; Ps 83, 3. 4. 5 et 10. 11.
Ev Mc 7, 1-13.
ANNIVERSARIA
1961. Kainbach. Fr. Ildephons M. Panzner, presb., a. 81, r. 60.
1978. Vicenza. Fr. Angelico M. Nicolodi, presb., a. 71, r. 48.
48
TEMPUS PER ANNUM
8. Vir. Feria IV hebd. V per annum (I Psalt.).
De ea. Vel:
Alb. S. Hieronymi Emiliani Rel. Vel:
Alb. S. Iosephinae Bakhita V.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 10, 1-10; Ps 36, 5-6. 30-31. 39-40.
Ev Mc 7, 14-23.
ANNIVERSARIA
1982. Brockville. Fr. Léo M. Joanisse, presb., a. 71, r. 50.
1999. Pesaro. Fr. Antonio M. Musatti, diac., a. 78, r. 60.
9. Vir. Feria V hebd. V per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 11, 4-13; Ps 105, 3-4. 35-36. 37 et 40.
Ev Mc 7, 24-30.
ANNIVERSARIA
1979. Firenze. Fr. Carlo M. Dal Prá, presb., a. 63, r. 44.
1995. Johannesburg. Fr. Benedict M. Carden, presb., a. 35, r. 8.
2011. Vicenza. Fr. Giovanni M. Travaglia, presb., a. 56, r. 36.
10. Alb. Feria VI hebd. V per annum (I Psalt.).
S. Scholasticae V., memoria.
MISSA memoriae.
L 1 1 Reg 11, 29-32; 12, 19; Ps 80, 10-11ab. 12-13. 14-15.
Ev Mc 7, 31-37.
FEBRUARIUS 2012
49
ANNIVERSARIA
1978. Montréal. Fr. Alessandro M. Carmignani, presb., a. 56,
r. 37.
1979. Siteki. Fr. Laszló M. Orbán a. 75, r. 48.
2001. Richard’s Bay. Fr. Sibusiso Paulus M. Mngomezulu, presb.,
a. 43, r. 20.
11. Alb. Sabb. hebd. V per annum (I Psalt.).
De S. Maria in sabb., memoria. Vel:
Alb. B. Mariae Virginis de Lourdes.
MISSA alterius utrius memoriae.
L 1 1 Reg 12, 26-32; 13, 33-34; Ps 105, 6-7a. 19-20.
21-22.
Ev Mc 8, 1-10.
Vel, in Missa de B. Mariae Virgine de Lourdes,
E Lectionario Sanctorum:
L 1 Is 66, 10-14c; Ps Iudt 13, 18bcde. 19.
Ev Io 2, 1-11.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 44: Beata Maria Virgo, salus infirmorum.
I VESPERAE dom. – Cp. post I Vp. dom.
1964.
1968.
1984.
1989.
1998.
ANNIVERSARIA
Portland. Fr. Alfonse M. Cortney, presb., a. 79, r. 58.
Firenze. Fr. Giovanni M. Fecondi, presb., a. 61, r. 42.
Madrid. Fr. Felice M. Maletto, presb., a. 89, r. 68.
Rio de Janeiro. Fr. Egidio M. Bernardi, presb., a. 62, r. 43.
Firenze. Fr. Paolo M. Michelucci, diac., a. 80, r. 27.
50
TEMPUS PER ANNUM
12. Vir. DOM. VI PER ANNUM (Hebd. II Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Lev 13, 1-2. 44-46; Ps 31, 1-2. 5. 11.
L 2 1 Cor 10, 31 – 11, 1.
Ev Mc 1, 40-45.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1987. Roma. Fr. Emerico M. Gagliarducci, presb., a. 71, r. 55.
1988. Nigel. Fr. Urbano M. Cavedon, presb., a. 55, r. 36.
13. Vir. Feria II hebd. VI per annum (II Psalt.).
De ea.
FEBRUARIUS 2012
51
TRIDUUM
SEPTEM SANCTORUM PATRUM FUNDATORUM O. N.
Diebus 14-15-16 februarii in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut fra-
tres omnesque sodales ad sollemnitatem Sancto-
rum Septem Patrum Fundatorum O. N. cele-
brandam apte disponantur. Ad hoc opportune
adhibebitur subsidium cui est titulus In lode dei nostri sette Primi
Padri vel In praise of our seven First Fathers vel À la louange de nos
sept Premiers Pères vel En honor de los siete primeros Padres.
14. Alb. Feria III hebd. VI per annum (II Psalt.).
Ss. Cyrilli, monachi, et Methodii E., memoria.
MISSA memoriae.
L 1 Iac 1, 12-18; Ps 93, 12-13a. 14-15. 18-19.
Ev Mc 8, 14-21.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 1, 1-11; Ps 118, 67. 68. 71. 72. 75. 76.
Ev Mc 8, 11-13.
1993.
1995.
1998.
1999.
ANNIVERSARIA
Milano. Fr. Domenico M. Polo, presb., a. 81, r. 64.
Scottsdale. Fr. Anthony M. Petraglia, presb., a. 58, r. 37.
Johannesburg. Fr. Patrick M. Nolan, presb., a. 95, r. 71.
Dublin. Fr. Francis M. Mallon, a. 66, r. 34.
In Europa:
14. Alb. Feria III. SS. CYRILLI M. ET METHODII E.,
Europae Patron., festum. – Ad H. m. ant. et pss. feriae III
hebd. II.
MISSA festi, Gloria, pf. Ss. Pastorum.
L 1 Act 13, 46-49; Ps 116, 1. 2.
Ev Lc 1O, 1-9.
Adhibeatur PE cum praefatione variabili.
Hodie prohibentur Missae defunctorum, excepta exsequiali.
52
TEMPUS PER ANNUM
ANNIVERSARIA
1985. Saviano. Fr. Giuseppe M. Portesine, presb., a. 81, r. 49.
1986. Marina di Carrara. Fr. Carlo M. Pianini, presb., a. 72,
r. 54.
1987. Budapest. Fr. Jeromos M. Sebestién, presb., a. 74, r. 54.
CCC
ANNUS AB OBITU SORORIS ANGELAE CAVALLETTI
PROFESSAE TERTII ORDINIS SERVORUM MARIAE
15. Vir. Feria IV hebd. VI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 1, 19-27; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Mc 8, 22-26.
ANNIVERSARIA
1972. Innsbruck. Fr. Richard M. Riccabona, presb., a. 61, r. 40.
1973. Ancona. Fr. Luigi M. Bulgarelli, a. 55, r. 35.
16. Vir. Feria V hebd. VI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 2, 1-9; Ps 33, 2-3. 4-5. 6-7.
Ev Mc 8, 27-33.
I VESPERAE seq. soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1970. Siracusa. Fr. Gioacchino M. Romano, a. 60, r. 30.
1978. Piedimonte Matese. Fr. Felice M. Cavallaro, presb., a. 64,
r. 46.
Anno 1712, die 16 februarii, in urbe Ferraria (Italia), obiit soror
Angela Cavalletti, tertii Ordinis Servorum Mariae professa, insi-
gnis pietate et vitae integritate. Cum gravibus morbis esset affec-
ta, multos per annos forti animo acerbissimos toleravit dolores,
donec placido ac sereno vultu in Domino requievit.
Il 16 febbraio 1712, morì a Ferrara suor Angela Cavalletti, Serva
di Maria, insigne per pietà e integrità di vita. Colpita da gravi
malattie, sopportò con animo forte acerbi dolori per molti anni,
fino a quando si addormentò serenamente nel Signore.
On 16 February 1712, Sister Angela Cavalletti, Servant of Mary,
known for her piety and integrity of life, died at Ferrara (Italy).
Struck by serious illness, she bore bitter pain with a strong spirit
for many years, until dying serenely in the Lord.
54
TEMPUS PER ANNUM
17. Alb. Feria VI. SS. SEPTEM PATRUM FUNDATO-
RUM O.N., sollemnitas. – Ad H. m. ant. pr. cum
psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Sir 44, 1-2. 10-15; Ps 36, 3-4. 11 et 18. 39-40.
L 2 Eph 4, 1-6. 15-16.
Ev Io 17, 20-24.
Vel:
L 1 Is 2, 2-5; Ps 23, 1-2. 3-4. 5-6.
L 2 Act 2, 42. 44-48.
Ev Mt 20, 25-28.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
DIES MISSIONIS
Missio in regione Aysén (Chilia) in Praefecturam apo-
stolicam anno 1940, die 17 februarii, erecta hanc
diem tanquam Diem Missionis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Liturgiae Horarum necnon Sacrificii eucharistici
Dominum enixe exorent pro bono atque incremento
Missionis.
ANNIVERSARIA
2001. Manila. Fr. Tarcisio M. Roffi, presb., a. 65, r. 47.
2011. Negrar. Fr. Aurelio M. Chini, presb., a. 86, r. 67.
FEBRUARIUS 2012
55
18. Alb. Sabb. hebd. VI per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iac 3, 1-10; Ps 11, 2-3. 4-5. 7-8.
Ev Mc 9, 2-13.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 24: Beata Virgo Maria, sedes Sapientiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Manzini. Fr. Gerardo M. Galandi, presb., a. 64, r. 47.
1976. Lucca. Fr. Sostegno M. Kieffer, presb., a. 71, r. 49.
1999. Montréal. Fr. Alexis M. Brault, presb., a. 80, r. 63.
Ubi celebratio externa sollemnitatis Ss. Septem Patrum
Fundatorum O.N. (17 febr.), ob rationes pastorales, trans-
fertur in hanc dominicam, omnes Missae, quae concurrente
populo celebrantur, dici possunt de Ss. Septem Patribus.
19. Vir. DOM. VII PER ANNUM (Hebd. III Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 43, 18-19. 21-22. 24b-25; Ps 40, 2-3. 4-5. 13-14.
L 2 2 Cor 1, 18-22.
Ev Mc 2, 1-12.
56
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
B. Elisabeti Picenardi V. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
20. Vir. Feria II hebd. VII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 3, 13-18; Ps 18, 8. 9. 10. 15.
Ev Mc 9, 14-29.
21. Vir. Feria III hebd. VII per annum (III Psalt.).
De ea. Vel:
Alb. S. Petri Damiani E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 4, 1-10; Ps 54, 7-8. 9-10a. 10b-11a. 23.
Ev Mc 9, 30-37.
ANNIVERSARIA
1984. Pietralba. Fr. Bonfilius M. Spitaler, presb., a. 78, r. 49.
2003. Torino. Fr. Vincenzo M. Capella, presb., a. 77, r. 61.
2005. Genova. Fr. Giulio M. De Martini, a. 80, r. 51.
TEMPUS QUADRAGESIMAE
Tempus Quadragesimae ordinatur ad praeparationem
celebrationis Paschae: liturgia enim quadragesimalis
tam catechumenos, per diversos initiationis christia-
nae gradus, quam fideles memoriam Baptismi recolen-
tes et paenitentiam agentes, componit ad celebrandum
paschale mysterium (AC, 27).
Intermittitur tempus per annum; reposito vol. III, assumi-
tur vol. II Liturgiae Horarum.
Tempore Quadragesimae:
1. In omnibus Officiis, tam de Tempore quam de Sanctis, in
principio Horarum, omittitur Alleluia.
2. In omnibus Missis et Officiis, si reperiatur, Alleluia omittitur.
3. In sollemnitatibus et festis, necnon in peculiaribus celebra-
tionibus, dicitur Te Deum et Gloria in excelsis.
4. Altare floribus ornari prohibetur; sonus autem organi alio-
rumque instrumentorum permittitur tantum ad cantum sus-
tentandum. Excipiuntur tamen dominica Laetare (IV Quadr.)
atque sollemnitates et festa (Caer. Ep. n. 252).
5. In celebratione Matrimonii, sive intra Missam sive extra
Missam, benedictio nuptialis semper impertienda est. Monean-
tur tamen sponsi ut rationem habeant peculiaris naturae huius
temporis liturgici (Ordo Matrimonii, 32).
Feria IV Cinerum:
1. Ieiunium cum abstinentia.
58
TEMPUS QUADRAGESIMAE
2. Ad Missam, post evangelium et homiliam, benedicuntur et
imponuntur cineres, facti de ramis olivarum vel aliarum arbo-
rum anno praecedente benedictis. Actus paenitentialis omittitur.
3. Benedictio et impositio cinerum fieri potest etiam sine
Missa quo in casu opportune praemittitur liturgia verbi, adhi-
bendo cantum ad introitum, collectam et lectiones cum suis
cantibus ut in Missa; post homiliam cineres benedicuntur et
imponuntur et celebratio oratione universali clauditur.
FEBRUARIUS 2012
22. Viol. Feria IV. CINERUM (hebd. IV Psalt.).
De ea.
– Ad Ld. dici possunt pss. et canticum feriae VI
hebd. III (ob indolem paenitentialem).
MISSA pr., pf. Quadr.
L 1 Ioel 2, 12-18; Ps 50, 3-4. 5-6a. 12-13. 14 et 17.
L 2 2 Cor 5, 20 – 6, 2.
Ev Mt 6, 1-6. 16-18.
Dies ieiunii et abstinentiae.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
Cathedrae S. Petri Ap. festum omittitur.
ANNIVERSARIA
1980. Innsbruck. Fr. Rudolf M. Hofer, a. 74, r. 48.
1984. Portland. Fr. Leonard M. Mazurk, presb., a. 64, r. 44.
2000. Udine. Fr. Federico M. Caldognetto, presb., a. 65, r. 48.
23. Viol. Feria V post Cineres (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Deut 30, 15-20; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 9, 22-25.
Fieri potest memoria S. Polycarpi E.M., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
2002. Gratzen – Nové Hrady. Fr. Vittorio M. Antollovich, presb.,
a. 76, r. 55.
60
TEMPUS QUADRAGESIMAE
FEBRUARIUS 2012
61
MISSA pr., pf. Quadr. L 2 1 Petr 3, 18-22.
Ev Mc 1, 12-15.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes neque Missa exsequialis.
L 1 Is 58, 1-9a; Ps 50, 3-4. 5-6a. 18-19. II VESPERAE dom. I Quadr. – Cp. post II Vp. dom.
Ev Mt 9, 14-15.
24. Viol. Feria VI post Cineres (hebd. IV Psalt.).
De ea.
1961.
1970.
1993.
1995.
ANNIVERSARIA
Chicago. Fr. Bonaventure M. Maguire, presb., a. 83, r. 66.
Langegg. Fr. Bonaventura M. Grogger, a. 81, r. 49.
Salford. Fr. Bernard M. Deegan, presb., a. 65, r. 43.
Monte Senario. Fr. Celestino M. Marsili, a. 91, r. 25.
25. Viol. Sabb. post Cineres (hebd. IV Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Is 58, 9b-14; Ps 85, 1-2. 3-4. 5-6.
Ev Lc 5, 27-32.
I VESPERAE dom. I Quadr. – Cp. post I Vp. dom.
ANNIVERSARIA
1970. Saluzzo. Fr. Bonaventura M. Piras, presb., a. 91, r. 74.
1998. Matola. Fr. David M. Vaquer Cirujeda, presb., a. 51, r. 33.
2001. Negrar. Fr. Giuseppe M. Trentin, presb., a. 74, r. 57.
26. Viol. DOM. I IN QUADRAGESIMA (Hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Gen 9, 8-15; Ps 24, 4bc-5ab. 6-7bc. 8-9.
ANNIVERSARIA
2008. Firenze. Fr. Carlo M. Rocchi, presb., a. 91, r. 74.
27. Viol. Feria II post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Lev 19, 1-2. 11-18; Ps 18, 8. 9. 10. 15.
Ev Mt 25, 31-46.
ANNIVERSARIA
1976. Dunaszeg. Fr. Pius M. Thun, presb., a. 61, r. 45.
1997. Plasencia. Fr. Luis M. González Arellano, a. 57, r. 36.
2011. Ancona. Fr. Giancarlo M. Gregori, presb., a. 81, r. 59.
28. Viol. Feria III post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Is 55, 10-11; Ps 33, 4-5. 6-7. 16-17. 18-19.
Ev Mt 6, 7-15.
ANNIVERSARIA
1966. Torino. Fr. Bartolomeo M. Botta, presb., a. 57, r. 38.
1984. Ciudad Juárez. Fr. Bernardo M. Cabral Lamas, a. 72,
r. 25.
62
TEMPUS QUADRAGESIMAE
1999. Vicenza. Fr. Giacinto M. Evarelli, presb., a. 86, r. 69.
2004. Gelsenkirchen-Buer. Fr. Amideus M. Wickers, presb., a. 87,
r. 60.
2008. Siteki. Fr. Aaron M. Ginindza, presb., a. 54, r. 31.
29. Viol. Feria IV post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ion 3, 1-10; Ps 50, 3-4. 12-13. 18-19.
Ev Lc 11, 29-32.
MARTIUS 2012
1. Viol. Feria V post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Est 4, 17 n. p-r. aa-bb. gg-hh; (Vulg. 14, 1. 3-5. 12-14);
Ps 137, 1-2a. 2bc-3. 7c-8.
Ev Mt 7, 7-12.
ANNIVERSARIA
1976. Roma. Fr. Mario M. Pomponi, a. 41, r. 23.
2004. Lemont. Fr. Mark M. Dennehy, a. 85, r. 66.
2. Viol. Feria VI post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ez 18, 21-28; Ps 129, 1-2. 3-4ab. 4c-6. 7-8.
Ev Mt 5, 20-26.
1964.
1981.
1983.
1986.
2006.
2009.
ANNIVERSARIA
Volders. Fr. Romedius M. Hackl, presb., a. 64, r. 46.
Milano. Fr. Giacinto M. Castello, presb., a. 56, r. 38.
Oak Park. Fr. John M. Boland, presb., a. 69, r. 50.
Rivoli. Fr. Anselmo M. Arneodo, presb., a. 58, r. 36.
Chicago. Fr. John M. Dowd, presb., a. 63, r. 43.
Mylapore. Fr. John Kennedy M. Anthonysamy, a. 22, nov.
9 mensis.
3. Viol. Sabb. post dom. I Quadr. (hebd. I Psalt.).
De eo.
64
TEMPUS QUADRAGESIMAE
MISSA pr., pf. Quadr.
L 1 Deut 26, 16-19; Ps 118, 1-2. 4-5. 7-8.
Ev Mt 5, 43-48.
I VESPERAE dom. II Quadr. – Cp. post I Vp. dom.
1968.
1973.
1980.
1992.
1999.
2007.
ANNIVERSARIA
Udine. Fr. Virginio M. Sabbadin, presb., a. 52, r. 33.
Roma. Fr. Paolo M. Poscolieri, presb., a. 59, r. 42.
Berwyn. Fr. Paul M. Sullivan, a. 78, r. 39.
Milano. Fr. Bernardino M. De Tomasi, presb., a. 82, r. 64.
Budapest. Fr. Bonajunkta M. Váry, presb., a. 86, r. 65.
Bologna. Fr. Attilio M. Repele, presb., a. 67, r. 49.
4. Viol. DOM. II IN QUADRAGESIMA (Hebd. II
Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Gen 22, 1-2. 9a. 10-13. 15-18; Ps 115, 10 et 15.
16-17. 18-19.
L 2 Rom 8, 31b-34.
Ev Mc 9, 2-10.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequialis.
S. Casimiri memoria omittitur.
II VESPERAE dom. II Quadr. – Cp. post II Vp. dom.
ANNIVERSARIA
1977. Pesaro. Fr. Edoardo M. Goffo, presb., a. 48, r. 30.
1982. Figline Valdarno. Fr. Giuseppe M. Venturi, a. 84, r. 53.
MARTIUS 2012
65
1992. Chicago. Fr. Daniel M. O’Malley, presb., a. 70, r. 50.
1994. Sondrio. Fr. Eugenio M. Mottes, a. 73, r. 54.
1996. Negrar. Fr. Pellegrino M. Schirato, presb., a. 82, r. 66.
5. Viol. Feria II post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Dan 9, 4b-10; Ps 78, 8. 9. 11 et 13.
Ev Lc 6, 36-38.
ANNIVERSARIA
1976. Foligno. Fr. Paolino M. Righi, a. 90, r. 62.
1987. Winnipeg. Fr. Ignatius M. O’Sullivan, presb., a. 97, r. 80.
6. Viol. Feria III post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Is 1, 10. 16-20; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mt 23, 1-12.
ANNIVERSARIA
2007. Fullerton. Fr. Jude M. Herlihy, presb., a. 76, r. 56.
2008. Todi. Fr. Emilio M. Bianchi, presb., a. 90, r. 74.
7. Viol. Feria IV post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 18, 18-20; Ps 30, 5-6. 14. 15-16.
Ev Mt 20, 17-28.
66
TEMPUS QUADRAGESIMAE
Fieri potest memoria Ss. Perpetuae et Felicitatis Mm., ut
pp. XXI-XXII notatur.
ANNIVERSARIA
1981. Firenze. Fr. Bonaventura M. Quieti, a. 84, r. 59.
1993. Negrar. Fr. Filippo M. De Pretto, a. 76, r. 56.
8. Viol. Feria V post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 17, 5-10; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 16, 19-31.
Fieri potest memoria S. Ioannis a Deo Rel., ut pp. XXI-XXII
notatur.
1972.
1986.
2001.
2008.
ANNIVERSARIA
Wien. Fr. Basil M. Wartbichler, presb., a. 87, r. 68.
Torino. Fr. Alessandro M. Baglione, presb., a. 76, r. 56.
Chicago. Fr. Walter M. Brennan, presb., a. 65, r. 45.
Celaya. Fr. José Francisco M. Pérez Macías, a. 65, r. 5.
9. Viol. Feria VI post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Gen 37, 3-4. 12-13a. 17b-28; Ps 104, 16-17. 18-19.
20-21.
Ev Mt 21, 33-43. 45-46.
Fieri potest memoria S. Franciscae Romanae Rel., ut pp.
XXI-XXII notatur.
MARTIUS 2012
1976.
1981.
1988.
1990.
67
ANNIVERSARIA
Melk. Fr. Cherubin M. Haas, presb., a. 75, r. 58.
Verona. Fr. Alberto M. Toniolo, presb., a. 78, r. 59.
Chicago. Fr. Raymond M. Coughlin, presb., a. 81, r. 62.
Santiago de Chile. Fr. Roberto M. Zanoni, a. 77, r. 53.
10. Viol. Sabb. post dom. II Quadr. (hebd. II Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Mic 7, 14-15. 18-20; Ps 102, 1-2. 3-4. 9-10. 11-12.
Ev Lc 15, 1-3. 11-32.
I VESPERAE dom. III Quadr. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Albuquerque. Fr. Luigi M. Flores, presb., a. 52, r. 26.
1991. Roma. Fr. Marco M. Aldrovandi, presb., a. 64, r. 44.
11. Viol. DOM. III IN QUADRAGESIMA (Hebd. III
Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Ex 20, 1-17 vel 20, 1-3. 7-8. 12-17; Ps 18, 8. 9. 10. 11.
L 2 1 Cor 1, 22-25.
Ev Io 2, 13-25.
Adhibeatur PE cum praefatione variabili.
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
68
TEMPUS QUADRAGESIMAE
L 1 Ex 17, 1-7; Ps 94, 1-2. 6-7. 8-9.
L 2 Rom 5, 1-2. 5-8.
Ev Io 4, 5-42.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. III Quadr. – Cp. post II Vp. dom.
ANNIVERSARIA
1970. Vicenza. Fr. Gabriele M. Cola, presb., a. 55, r. 37.
2008. Firenze. Fr. Tarcisio M. Caterini, presb., a. 84, r. 67.
12. Viol. Feria II post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 2 Reg 5, 1-15a; Ps 41, 2. 3; 42, 3. 4.
Ev Lc 4, 24-30.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium Samaritana,
hac ratione:
L 1 Ex 17, 1-7; Ps 94, 1-2. 6-7. 8-9.
Ev Io 4, 5-42.
Et dicitur praef. dom. Evangelio respondens.
1975.
1984.
2001.
2004.
ANNIVERSARIA
Vicenza. Fr. Stefano M. Soliman, a. 65, r. 43.
San Diego. Fr. Alexis M. Gauthier, presb., a. 58, r. 37.
Nola. Fr. Pio M. Casciello, presb., a. 66, r. 45.
Taurano (Avellino). Fr. Giovanni M. Colello, presb., a. 74,
r. 51.
13. Viol. Feria III post dom. III Quadr. (hebd. III Psalt.).
De ea.
MARTIUS 2012
69
MISSA pr., pf. Quadr.
L 1 Dan 3, 25. 34-43; Ps 24, 4bc-5ab. 6-7bc. 8-9.
Ev Mt 18, 21-35.
ANNIVERSARIA
1972. Stegi. Fr. Luigi M. Ruggeri, presb., a. 64, r. 47.
1995. Chicago. Fr. Bonaventure M. Verwiel, presb., a. 84, r. 64.
14. Viol. Feria IV post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Deut 4, 1. 5-9; Ps 147, 12-13. 15-16. 19-20.
Ev Mt 5, 17-19.
1974.
1994.
2000.
2005.
ANNIVERSARIA
Roma. Fr. György M. Szücs, a. 65, r. 43.
Anaheim. Fr. Alexis M. Olguín, a. 81, r. 60.
Anaheim. Fr. Mel M. Corcoran, presb., a. 82, r. 63.
Turvo. Fr. Giovanni M. Palmieri, presb., a. 86, r. 67.
15. Viol. Feria V post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 7, 23-28; Ps 94, 1-2. 6-7. 8-9.
Ev Lc 11, 14-23.
1979.
1983.
1994.
2003.
2007.
ANNIVERSARIA
Venezia. Fr. Bonfiglio M. Rizzardini, a. 69, r. 50.
Firenze. Fr. Basilio M. Meoni, presb., a. 68, r. 51.
Torino. Fr. Carlo M. Zanetta, presb., a. 75, r. 59.
Magog. Fr. Raphaël M. De Luca, a. 88, r. 65.
Peralta. Fr. Albert M. Gallegos, presb., a. 70, r. 49.
70
TEMPUS QUADRAGESIMAE
16. Viol. Feria VI post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Os 14, 2-10; Ps 80, 6c-8a. 8bc-9. 10-11ab. 14 et 17.
Ev Mc 12, 28b-34.
DIES ORDINIS SAECULARIS SERVORUM SANCTAE MARIAE
(OSSM)
Die 16 martii 1424, Summus Pontifex Martinus V,
bulla Sedis apostolicae, Regulam Tertii Ordinis Servo-
rum Mariae omnibus servandam sodalibus Consortii
seu Societatis, tum appellabatur coetus laicorum qui
propositum profitebantur Servorum spiritualitatem
servandi in statu laicali. Nostris temporibus sodalium
laicorum coetui datus est titulus Ordo Saecularis Servo-
rum sanctae Mariae.
Omnes Servi et Servae sanctae Mariae Dominum bea-
tamque Virginem exorent pro perseverantia et spirita-
li profectu Ordinis Saecularis.
ANNIVERSARIA
1993. Chicago. Fr. Anselm M. Dennehy, presb., a. 73, r. 52.
17. Viol. Sabb. post dom. III Quadr. (hebd. III Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Os 6, 1-6; Ps 50, 3-4. 18-19. 20-21ab.
Ev Lc 18, 9-14.
Fieri potest memoria S. Patricii E., ut pp. XXI-XXII notatur.
MARTIUS 2012
71
I VESPERAE dom. IV Quadr. – Cp. post I Vp. dom.
Hodie ad Vp. et crastino die (dom. Laetare) organa aliaque
instrumenta pulsari possunt.
In Hibernia:
16. I VESPERAE seq. – Cp. post I Vp. dom.
17. Alb. Sabb. S. PATRICII E., HIBERNIAE PATRONI
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, Credo, lect. pr., pf. pr.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1985. Portland. Fr. Augustine M. Holloway, presb., a. 75, r. 51.
2001. Ottawa. Fr. Daniel M. Cruickshank, presb., a. 52, r. 32.
18. Viol. vel Ros. DOM. IV IN QUADRAGESIMA
(Hebd. IV Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 2 Chron 36, 14-16. 19-23; Ps 136, 1-2. 3. 4-5. 6.
L 2 Eph 2, 4-10.
Ev Io 3, 14-21.
Adhibeatur PE cum praefatione variabili.
72
TEMPUS QUADRAGESIMAE
MARTIUS 2012
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
L 1 1Sam 16, 1b. 6-7. 10-13a; Ps 22, 1-3a. 3b-4. 5. 6.
L 2 Eph 5, 8-14.
Ev Io 9, 1-41 vel brevior 1. 6-9. 13-17. 34-38.
Prohibentur aliae celebrationes necnon Missa exsequialis.
S. Cyrilii Hierosolymitani E.D. memoria omittitur.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Addolorata (Chioggia), hanc diem qua anno 1873, p.
Aemilius Venturini (1842-1905), e Congregatione
Oratorii, una cum matre Elisa Sambo (1816-1897),
Instituti iecit fundamenta, tamquam Diem Congrega-
tionis celebrat. Anno 1918 die 12 februarii Congre-
gatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deo gratias agant et pro bono atque incremen-
to Instituti fraternas effundant preces.
II VESPERAE dom. IV Quadr. – Cp. post II Vp. dom.
19. Alb. Feria II. S. IOSEPH, SPONSI B. MARIAE V.
ET COMPATRONI O. N., sollemnitas. – Ad H. m.
ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, Credo, pf. pr. Et te in sollemnitate.
L 1 2 Sam 7, 4-5a. 12-14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
L 2 Rom 4, 13. 16-18. 22.
Ev Mt 1, 16. 18-21. 24a vel Lc 2, 41-51a.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, item prohibentur
Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
73
1962.
1969.
1975.
1977.
1987.
1988.
ANNIVERSARIA
Alessandria. Fr. Giuseppe M. Olivero, presb., a. 75, r. 59.
London. Fr. Joseph M. Tucker, presb., a. 70, r. 52.
Vicenza. Fr. Pellegrino M. Contessa, presb., a. 88, r. 68.
Torino. Fr. Alessio M. Cattilino, presb., a. 60, r. 29.
Valencia. Fr. Miguel M. Martínez Escribano, a. 66, r. 31.
Puerto Aysén. Fr. Marcello M. Frasson, presb., a. 61, r. 43.
20. Viol. Feria III post dom. IV Quadr. (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
In Belgio, in Canada et in Provincia Tirolensi:
Sollemnitas S. JOSEPH celebratur quoque ut Patroni prin-
cipalis totius Nationis.
L 1 Ez 47, 1-9. 12; Ps 45, 2-3. 5-6. 8-9.
Ev Io 5, 1-16.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium caeco nato,
hac ratione:
74
TEMPUS QUADRAGESIMAE
L 1 Mic 7, 7-9; Ps 26, 1. 7-8a. 8b-9abc. 13-14.
Ev Io 9, 1-41.
Et dicitur praef. dom. Evangelio respondens.
MARTIUS 2012
75
1973. Rochester. Fr. Jérôme M. De Pencier, presb., a. 86, r. 69.
1992. La Ferté Macé. Fr. Joseph M. Lefebvre, presb., a. 86, r. 45.
ANNIVERSARIA 23. Viol. Feria VI post dom. IV Quadr. (hebd. IV Psalt.).
Denver. Fr. Stanislao M. Giambastiani, presb., a. 78, De ea.
r. 62.
Milano. Fr. Giuliano M. Cossettini, presb., a. 60, r. 37.
Siteki. Fr. Bonifaz M. Schneider, a. 84, r. 60.
Vicenza. Fr. Pietro M. Sella, presb., a. 83, r. 63.
Negrar. Fr. Ildebrando M. Pellanda, a. 86, r. 68.
21. Viol. Feria IV post dom. IV Quadr. (hebd. IV Psalt.). ANNIVERSARIA
De ea. 1981. Bognor Regis. Fr. Anselm M. Hislop, presb., a. 88, r. 67.
1998. Dinazzano. Fr. Alberto M. Morini, presb., a. 75, r. 57.
1966.
1975.
1984.
1984.
2005.
MISSA pr., pf. Quadr.
L 1 Is 49, 8-15; Ps 144, 8-9. 13cd-14. 17-18.
Ev Io 5, 17-30.
ANNIVERSARIA
1986. São José dos Campos. Fr. Dionisio M. Testi, presb., a. 70,
r. 54.
2009. Firenze. Fr. Giuliano M. Geppetti, presb., a. 83, r. 66.
22. Viol. Feria V post dom. IV Quadr. (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ex 32, 7-14; Ps 105, 19-20. 21-22. 23.
Ev Io 5, 31-47.
ANNIVERSARIA
1961. Ladysmith. Fr. Philip M. Lewis, presb., a. 72, r. 52.
MISSA pr., pf. Quadr.
L 1 Sap 2, 1a. 12-22; Ps 33, 17-18. 19-20. 21 et 23.
Ev Io 7, 1-2. 10. 25-30.
Fieri potest memoria S. Turibii de Mogrovejo E., ut pp.
XXI-XXII notatur.
24. Viol. Sabb. post dom. IV Quadr. (hebd. IV Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Ier 11, 18-20; Ps 7, 2-3. 9bc-10. 11-12.
Ev Io 7, 40-53.
I VESPERAE dom. V Quadr. – Cp. post I Vp. dom.
Usus cooperiendi cruces et imagines per ecclesiam servari
potest, de iudicio Conferentiae Episcoporum. Cruces vela-
tae manent usque ad expletam celebrationem Passionis
Domini, feria VI Hebdomadae Sanctae, imagines vero
usque ad initium Vigiliae paschalis.
ANNIVERSARIA
1974. Ladysmith. Fr. Charles M. Feeney, presb., a. 84, r. 65.
76
TEMPUS QUADRAGESIMAE
25. Viol. DOM. V IN QUADRAGESIMA (Hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. I Pass.
L 1 Ier 31, 31-34; Ps 50, 3-4. 12-13. 14-15.
L 2 Hebr 5, 7-9.
Ev Io 12, 20-33.
MARTIUS 2012
1966.
1968.
1975.
1982.
1993.
2003.
77
ANNIVERSARIA
Innsbruck. Fr. Pius M. Kreuzer, presb., a. 53, r. 35.
Arezzo. Fr. Manetto M. Caiani, presb., a. 62, r. 43.
San Francisco. Fr. Andrew M. Colletti, presb., a. 50, r. 30.
Vicenza. Fr. Ignazio M. Faccin, presb., a. 83, r. 65.
Dublin. Fr. Joseph M. Madden, presb., a. 63, r. 42.
Ubombo. Fr. Thomas M. Carroll, presb., a. 78, r. 52.
Adhibeatur PE cum praefatione variabili.
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
L 1 Ez 37, 12-14; Ps 129, 1-2. 3-4ab. 4c-6. 7-8.
L 2 Rom 8, 8-11.
Ev Io 11, 1-45 vel brevior 3-7. 17. 20-27. 33b-45.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. V Quadr. – Cp. post II Vp. dom.
DIES INSTITUTI
Institutum saeculare cui est titulus Servite Secular
Institute, a fratre Gerard M. Corr (†2000) et Joan
Bartlett (†2002), pia iuvene, fundatum et die 25 mar-
tii 1979 ab Apostolica Sede probatum, hodiernam
diem, qua anno 1964 die 28 maii Ordini nostro est
aggregatum, tamquam Diem Instituti festive celebrat.
Omnes fratres et sorores Servorum Ordinis cum in
matutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini gratias
referant et pro bono et incremento Instituti enixe
supplicent.
26. Alb. Feria II. IN ANNUNCIATIONE DOMINI,
sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 7, 10-14; 8, 10; Ps 39, 7-8a. 8b-9. 10. 11.
L 2 Hebr 10, 4-10.
Ev Lc 1, 26-38.
Ad verba symboli Et incarnatus … factus est genuflecten-
dum est, uno genu si recitentur, utroque si canantur (IM,
137).
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
1975.
1979.
1980.
2001.
2003.
2005.
ANNIVERSARIA
London. Fr. Alexis M. Halle, a. 91, r. 65.
Montréal. Fr. Ignazio M. Patriarchi, presb., a. 86, r. 70.
Albuquerque. Fr. Gabriel M. Reisdorff, presb., a. 69, r. 44.
Verona. Fr. Flaviano M. Tabbia, presb., a. 77, r. 60.
Hochrum. Fr. Othmar M. Reitz, presb., a. 86, r. 48.
Monte Senario. Fr. Antonio M. Monaco, a. 79, r. 53.
78
TEMPUS QUADRAGESIMAE
27. Viol. Feria III post dom. V Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. I Pass.
L 1 Num 21, 4-9; Ps 101, 2-3. 16-18. 19-21.
Ev Io 8, 21-30.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium de Lazaro,
hac ratione:
L 1 2 Reg 4, 18b-21. 32-37; Ps 16, 1. 6-7. 8b et 15.
Ev Io 11, 1-45.
Et dicitur praef. dom. Evangelio respondens.
ANNIVERSARIA
1996. Saint-Jean sur Richelieu. Fr. Laurent M. Lussier, presb.,
a. 78, r. 58.
28. Viol. Feria IV post dom. V Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. I Pass.
L 1 Dan 3, 14-20. 91-92. 95; Ps Dan 3, 52. 53. 54. 55. 56.
Ev Io 8, 31-42.
ANNIVERSARIA
1987. Milano. Fr. Basilio M. Cecchin, presb., a. 75, r. 57.
1993. Negrar. Fr. Amadio M. Serafini, a. 75, r. 55.
29. Viol. Feria V post dom. V Quadr. (hebd. I Psalt.).
De ea.
MARTIUS 2012
79
MISSA pr., pf. I Pass.
L 1 Gen 17, 3-9; Ps 104, 4-5. 6-7. 8-9.
Ev Io 8, 51-59.
ANNIVERSARIA
1983. Udine. Fr. Giustino M. Gugole, presb., a. 86, r. 67.
1985. Santiago de Chile. Fr. Eduardo M. Ulriksen Mendía,
a. 33, r. 7.
C C
ANNUS A SUSCEPTO OPERE REPARATIONIS MARIANAE ANNUS AB ADVENTU IN REGIONEM CANADENSEM
IN CONGREGATIONE SERVARUM MARIAE «RIPARATRICI» SERVORUM SANCTAE MARIAE
Hodie (die 29 martii) recolitur centesimus dies anniversarius suscepti ope- Anno 1912, die 29 martii, pervenerunt in urbem Montréal (Canada)
ris reparationis marianae a Congregatione Servarum Mariae a Vidor primi fratres Servi Mariae a Provincia Tusciae: fr. Ildephonsus M.
(Tarvisium). Opus reparationis institutum est anno 1895 a M. Dolores Francesconi (+1952), fr. Angelicus M. Barsi (+1949), fr. Aurelius M.
Inglese (+1928), pia iuvene quae anno 1912 in Congregationem ingressa est. Prosperi (+1971), quibus commissa est cura parroeciae vulgo nuncu-
Opus a Romanis Pontificibus Leone III (+1903), Pio X (+1914), Benedicto patae «Notre-Dame de la Défense» (Madonna della Difesa). Fratres
XV (+1922) approvatum, in conpluribus regionibus est diffusum. Servi Mariae manserunt in illa parroecia usque ad annum 2002.
Oggi (29 marzo) riccorre il primo centenario dell’assunzione dell’opera di Il 29 marzo 1912, provenienti dalla Provincia toscana, giunsero a
riparazione mariana da parte della Congregazione delle Serve di Maria di Montréal (Canada) i primi fratri Servi di Maria, provenienti dalla pro-
Vidor (Treviso). L’opera di riparazione era stata istituita nel 1895 da M. vincia Toscana: fra Ildefonso M. Francesconi (+1952), fra Angelico
Dolores Inglese (+1928); essa entrò a far parte della Congregazione delle M. Barsi (+1949) e fra Aurelio M. Prosperi (+1971). Ad essi fu affi-
Serve di Maria «Riparatrici» nel 1912. L’opera fu approvata dai Sommi data la parrocchia della Madonna della Difesa, nella quale i Servi di
Pontefici Leone XIII (+1903), Pio X (+1914) e Benedetto XV (+1922), e Maria rimasero fino all’anno 2002.
si diffuse in molti paesi.
Today (29 March) is the first centenary of the Congregation of the Sister On 29 March, 1912, the first friar Servants of Mary, coming from the
Servants of Mary of Vidor (Treviso) taking up the work of Marian repara- Tuscan Province, arrived in Montréal (Canada): fra Ildefonso M.
tion. The work of reparation was begun in 1895 by M. Dolores Inglese Francesconi (+1952), fra Angelico M. Barsi (+1949) and fra Aurelio
(+1928) who entered the Congregation of the Sister Servants of Mary M. Prosperi (+1971). The parish of «Notre-Dame de la Défense»
«Riparatrici» in 1912. The work was approved by Popes Leo XIII (+1903), (Madonna della Difesa) was entrusted to them and the Servants of
Pius X (+1914) and Benedict XV (+1922), and spread to many countries. Mary remained there until 2002.
82
TEMPUS QUADRAGESIMAE
30. Rub. vel Alb. Feria VI post dom. V Quadr. B. MARIAE
VIRGINIS IUXTA CRUCEM, festum. – Ad H. m.
ant. et pss. feriae VI hebd. I.
MISSA pr., Gloria, sequentia ad libitum, lect. pr., pf. pr.
L 1 Rom 8, 31b-39 vel Gen 22, 1-2. 6. 9-13. 15-18;
Ps 17, 2-3. 5-7. 19-20.
Ev Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1989. Chicago. Fr. James M. Doyle, presb., a. 78, r. 58.
31. Viol. Sabb. post dom. V Quadr. (hebd. I Psalt.).
De eo.
MISSA pr., pf. I Pass.
L 1 Ez 37, 21-28; Ps Ier 31, 10. 11-12ab. 13.
Ev Io 11, 45-56.
ANNIVERSARIA
1970. London. Fr. Cyril M. Tucker, presb., a. 67, r. 48.
1977. Düsseldorf. Fr. Martin M. Rose, presb., a. 67, r. 42.
HEBDOMADA SANCTA
Notanda pro Hebdomada sancta
Ritus Hebdomadae sanctae, idest benedictio et processio palma-
rum, repositio Ss.mi Sacramenti post Missam in Cena Domini,
Actio liturgica feriae VI in Passione Domini et Vigilia paschalis,
celebrari possunt in omnibus ecclesiis et oratoriis publicis et
semipublicis. Expedit tamen ut in ecclesiis quae non sunt paroe-
ciales et in oratoriis celebrentur tantummodo si digne peragi
possunt, idest cum congruo numero ministrorum, cum facul-
tate exsequendi saltem aliquas partes cum cantu, et cum suffi-
cienti frequentia fidelium. Secus, expedit ut huiusmodi celebra-
tiones in ecclesiis tantum paroecialibus aliisque ecclesiis maiori-
bus persolvantur. Expedit quoque ut de hac re normae pecu-
liares a competenti auctoritate ecclesiastica tradantur.
Notanda pro dominica in palmis de Passione Domini
1. In Officio divino, ad benedictionem et processionem pal-
marum, et in omnibus Missis huius dominicae adhibentur
sacrae vestes coloris rubri.
2. In omnibus Missis huius dominicae fit memoria ingressus
Domini in Ierusalem, et quidem per processionem vel introi-
tum sollemnem ante Missam principalem, per introitum sim-
plicem ante alias Missas. Introitus tamen sollemnis, non vero
processio, iterari potest ante unam alteramve Missam, quae
cum magno populi concursu celebrari solet.
3. Expedit processionem haberi ab ecclesia minore, vel alio
loco apto, ad ecclesiam in qua Missa celebrabitur. In proces-
sione sacerdos induit casulam vel pluviale.
84
TEMPUS QUADRAGESIMAE
4. Post processionem vel introitum sollemnem, omittuntur
signum crucis et actus paenitentialis vel aspersio aquae bene-
dictae initio Missae, et dicitur statim collecta. Missa deinde
prosequitur more solito.
5. Solam autem benedictionem palmarum, absque subse-
quenti processione et Missa celebrare non licet.
6. Historia Passionis Domini legitur absque luminaribus et
absque incenso sine salutatione et signatione libri. Legitur
autem a diacono vel, ipso deficiente, a sacerdote. Legi potest
etiam a laicis lectoribus, parte Christi, si fieri potest, sacerdoti
reservata. Diaconi, non autem alii, ante lectionem Passionis,
dicunt Munda cor meum, petunt benedictionem sacerdotis, ut
alias ante Evangelium. In fine dicitur: Verbum Domini, sed
osculum libri omittitur.
MARTIUS 2012
31. Rub. Sabb.
I VESPERAE dom. in palmis. – Cp. post I Vp. dom.
APRILIS 2012
APRILIS 2012
1. Rub. DOMINICA IN PALMIS DE PASSIONE
DOMINI (Hebd. II Psalt.).
De ea.
Ante processionem:
Ev Mc 11, 1-10.
© MISSA pr., Credo, pf. pr.
L 1 Is 50, 4-7; Ps 21, 8-9. 17-18a. 19-20. 23-24.
L 2 Phil 2, 6-11.
Ev Mc 14, 1 – 15, 47 vel 15, 1-39.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
87
Prohibentur aliae celebrationes, excepta Missa exsequialis.
S. Francisci de Paola Er. memoria omittitur.
1986.
1993.
1997.
2005.
ANNIVERSARIA
Nagyszakácsi. Fr. Alois M. Németh, presb., a. 73, r. 52.
Siracusa. Fr. Angelo M. Pantano, presb., a. 72, r. 53.
Bologna. Fr. Aldo M. Sartoni, a. 84, r. 47.
Città del Vaticano. Pp. Ioannes Paulus II, a. 84, p. 26.
3. Viol. FERIA III HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 49, 1-6; Ps 70, 1-2. 3-4a. 5-6ab. 15 et 17.
Ev Io 13, 21-33. 36-38.
II VESPERAE dom. in palmis. – Cp. post II Vp. dom. Prohibentur aliae celebrationes, excepta Missa exsequialis.
Crastina die anniversarium recurret piae mortis Ioannis ANNIVERSARIA
Pauli Pp. II (2005). 1967. Bologna. Fr. Pellegrino M. Quarenghi, presb., a. 57, r. 39.
ANNIVERSARIA
1967. Napoli. Fr. Tommaso M. Bartolomei, presb., a. 77, r. 61.
2005. Chicago. Fr. Bernard M. Barnes, presb., a. 84, r. 63.
2. Viol. FERIA II HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 42, 1-7; Ps 26, 1. 2. 3. 13-14.
Ev Io 12, 1-11.
4. Viol. FERIA IV HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 50, 4-9a; Ps 68, 8-10. 21bcd-22. 31 et 33-34.
Ev Mt 26, 14-25.
Prohibentur aliae celebrationes, excepta Missa exsequialis.
S. Isidori E.D. memoria omittitur.
88
TEMPUS QUADRAGESIMAE
5. Viol. FERIA V HEBDOMADAE SANCTAE
(II Psalt.).
De ea. – Ad. Off. lect. dici potest ps. 68 Salvum me
fac, Deus (e feria VI hebd. III) cum suis ant., cum de
Passione Domini loquatur.
Advertenda.
1. Hodie permittuntur tantum Missa chrismatis et Missa
in Cena Domini, secundum ea quae infra dicentur. Prohi-
bentur Missae exsequiales.
2. Missa chrismatis, quam episcopus cum suo presbyterio
concelebrat, et in qua olea sacra benedicuntur, est velut
manifestatio communionis presbyterorum cum proprio
episcopo.
Ad hanc vero Missam congregantur et in ea concelebrant
presbyteri, quippe in conficiendo chrismate testes et coope-
ratores sui Episcopi, cuius sacri muneris in populo Dei exs-
truendo, sanctificando et regendo sunt participes, sicque
nitide manifestatur unitas sacerdotii et sacrificii Christi in
Ecclesia perseverantis.
Quo melius autem significetur unitas presbyteri, adsint e
diversis regionibus dioecesis presbyteri concelebrantes.
Qui vero forte non concelebrant, in hac Missa chrismatis
sub utraque specie communicare possunt.
3. Missa chrismatis celebratur cum vestibus coloris albi
atque in ea dic. Gloria et pf. pr.
L 1 Is 61, 1-3a. 6a. 8b-9; Ps 88, 21-22. 25 et 27.
L 2 Apoc 1, 5-8.
Ev Lc 4, 16-21.
APRILIS 2012
89
4. Sumantur et ad ecclesias dioecesis deferantur nova olea
benedicta; vetera comburantur vel in lampadem SS.
Sacramenti iniciantur.
5. Infirmis hodie Communio quamvis diei hora deferri
potest. Ceteri fideles communicare possunt tantum ad
Missam chrismatis et ad Missam in Cena Domini. Qui
mane communicaverunt, iterum SS. Eucharistiam ad
Missam vespertinam sumere possunt.
6. In triduo paschali prohibentur omnes aliae celebra-
tiones necnon Missae defunctorum, etiam exsequiales.
APRILIS 2012
TRIDUUM PASCHALE
Cum humanae redemptionis et perfectae Dei glorifica-
tionis opus adimpleverit Christus praecipue per suum
paschale mysterium, quo mortem nostram moriendo
destruxit et vitam resurgendo reparavit, sacrum
paschale triduum Passionis et Resurrectionis Domini
uti totius anni liturgici culmen effulget (AC, 18).
APRILIS 2012
5. Alb. FERIA V HEBDOMADAE SANCTAE. –
Vespere MISSA (Alb.) vespertina IN CENA DOMINI pr.,
Gloria, pf. Euch., in Canone romano Comm., Hanc
igitur et Qui pridie pr.
L 1 Ex 12, 1-8. 11-14; Ps 115, 12-13. 15-16bc. 17-18.
L 2 1 Cor 11, 23-26.
Ev Io 13, 1-15.
Adhibeatur PE cum praefatione variabili.
91
horis matutinis, sed tantummodo pro fidelibus qui nullo
modo Missam vespertinam participare valent. Caveatur
tamen ne huiusmodi celebrationes in bonum privatorum
fiant et ne praeiudicio sint Missae vespertinae principali.
3. Sacerdotes qui in Missa chrismatis aut ad utilitatem
fidelium iam celebraverint, denuo concelebrare valent in
Missa vespertina.
Item fideles qui in Missa chrismatis iam communicave-
rint, iterum communicare possunt in Missa in Cena
Domini.
4. Tabernaculum vacuum sit; pro communione cleri et
populi hodie et crastina die particulae consecrentur in hac
Missa.
5. Dum cantatur Gloria pulsantur campanae, eoque
expleto, silent usque ad Vigiliam paschalem, nisi Confe-
rentia Episcoporum vel Episcopus dioecesis, pro opportu-
nitate, aliud statuerit.
Animadvertenda. 6. Expleta celebratione huius diei, altare privatim denuda-
tur et auferuntur, si fieri potest, cruces ab ecclesia. Expedit
ut cruces, quae forte in ecclesia remanent, velentur, nisi
iam velatae sint ex praescripto Conferentiae Episcoporum.
1. Missa in Cena Domini celebranda est vespere, hora 7. Moneantur fideles, ut per congruum noctis tempus,
magis opportuna, cum plena participatione totius com- secundum locorum et rerum adiuncta, adorationem pera-
munitatis localis, sacerdotibus et ministris officium suum gant coram Ss.mo Sacramento asservato, ita tamen ut post
implentibus. mediam noctem haec adoratio absque sollemnitate fiat.
2. Ubi ratio pastoralis id postulet, loci Ordinarius alteram 8. Ubi, post Missa in Cena Domini, facta est repositio
Missam in ecclesiis et oratoriis permittere poterit, horis ves- Ss.mi Sacramenti, celebranda est quoque Actio liturgica
pertinis celebrandam, et, in casu verae necessitatis, etiam propria feriae VI in Passione Domini.
92
TRIDUUM PASCHALE
VESPERAE omittuntur ab iis, qui Missae vespertinae
intersunt.
Cp. post II Vp. dom.
Cras: Ieiunium et abstinentia.
S. Vicentii Ferrer P. memoria omittitur.
ANNIVERSARIA
1985. Perugia. Fr. Silverio M. Ercoli, presb., a. 63, r. 45.
1998. Ancona. Fr. Alfonso M. Baccarani, presb., a. 75, r. 57.
6. Rub. FERIA VI IN PASSIONE DOMINI.
De ea. Officium divinum cum peculiaritatibus in
Proprio indicatis.
Valde convenit ut hodie et cras Off. lect. et Ld. sol-
lemniter cum populo celebrentur (IH, 210).
CELEBRATIO PASSIONIS DOMINI, ut in Missali.
L 1 Is 52, 13 – 53, 12;
Ps 30, 2 et 6. 12-13. 15-16. 17 et 25.
L 2 Hebr 4, 14-16; 5, 7-9.
Ev Io 18, 1 – 19, 42.
In ecclesiis Ordinis nostri, expleta Crucis adora-
tione, convenienter fit Celebratio memoriae
Compassionis beatae Mariae Virginis, secun-
dum ritum in novissima editione Proprii
Missarum O.S.M. (anno 1998) describitur.
APRILIS 2012
93
Advertenda.
1. Celebratio Passionis Domini agenda est horis postmeri-
dianis, et quidem circam horam nonam; si vero ratio pas-
toralis id suadeat, tardiore hora inchoari potest.
2. Sacerdos et diaconus vestes coloris rubri, sicut ad Missae
celebrationem, induunt, iam ab initio actionis liturgicae.
3. Altare omnino nudum sit: sine cruce, sine candelabris,
sine tobaleis; nullum tapetum et ornamentum adsit.
4. Iuxta antiquissimam traditionem, Ecclesia hac die
Eucharistiam non celebrat.
Sacra Communio fidelibus distribuitur unice inter cele-
brationem Passionis Domini; infirmis autem, qui hanc
celebrationem participare nequeunt, quacumque diei hora
deferri potest.
5. Hodie post crucis detectionem et cras usque ad Vigiliam
paschalem exclusive, cruci genuflectitur.
6. Pro lectione Passionis Domini, cf. ea quae in dominica
palmarum dicta sunt (p. 84, n. 6).
7. Crux quae populo ostenditur et adoranda praebetur sat
magna sit et eleganti manu sculpta. Formula autem ad
crucem ostendendam et responsio populi cantu profera-
tur. Unica tantum crux, ratione veritatis signi, adorationi
praebeatur; provideatur tamen ut singuli fideles crucem
adorare possint: quod magni momenti est in celebratione
huius diei. Ritus proinde in quo crux ab omnibus una
simul silentio adoratur, adhibeatur tantummodo si fideles
vere numerosiores celebrationem participant.
94
TRIDUUM PASCHALE
8. Post celebrationem Passionis Domini Ss.ma Eucharistia
reportatur, forma simplici, ad locum asservationis, et ibi-
dem custoditur, lampade de more accensa. Et privatim
denudatur altare, relictis tamen cruce et candelabris.
Praestat locum aptum parari (v. gr. sacellum in quo respo-
sitio et adoratio Sacramenti die praecedenti facta est) et
orationi et meditationi congruum, in quo crux deponatur
a fidelibus adoranda.
9. Magni fiant etiam pia populi pietatis exercitia, quae
momentum pastorale prae se ferunt, v. gr. Via crucis, pro-
cessiones de passione Domini, memoria dolorum B.
Mariae V.
Eorum textus et cantus cum liturgia congruant, immo ad
ipsam participandam fideles inducant.
VESPERAE ab iis, qui celebrationi Passionis Domini
interfuerunt, non dicuntur.
Cp. post II Vp. dom.
ANNIVERSARIA
2002. Montréal. Fr. Francesco M. Maddalena, a. 86, r. 57.
7. Viol. SABBATUM SANCTUM.
De eo. Officium proprium.
Hodie, ante Vigiliam pasch., sacra Communio deferri
potest tantum ut Viaticum.
Cp. dic. tantum ab iis qui Vig. pasch. non intersunt: Cp.
post II Vp. dom.; loco R. br. dicitur ant. Christus.
APRILIS 2012
95
Animadvertenda.
1. Sabbato Sancto Ecclesia ad sepulcrum Domini immo-
ratur, passionem eius et mortem necnon descensum ad
inferos meditando, eius resurrectionem ieiunio et oratione
expectando.
2. Valde commendatur celebratio Officii lectionis et Lau-
dum cum populi participatione. Quod si fieri non potest,
sacra habeatur verbi Dei celebratio aut aliud pium exerci-
tium mysterio huius diei respondens, praesertim in hono-
rem B. Mariae V. Filii sui passioni sociatae.
3. Fidelium venerationi in ecclesia proponi potest imago
Christi crucifixi aut in sepulcro depositi, aut imago eius
descensus ad inferos, quae mysterium Sabbati sancti illus-
tret, aut demum imago B. Virginis perdolentis.
4. Hac die Ecclesia ab Eucharistiae celebratione omnino
abstinet. Sacra Communio solummodo ad modum Viatici
dari potest. Matrimonii aliorumque sacramentorum, prae-
ter quam Paenitentiae et Unctionis infirmorum, celebratio
ne habeatur.
5. Fideles de peculiari natura huius diei erudiantur.
Celebritates vero festivae, quae cum Paschae celebratione
sabbato sancto olim anticipatae conectebantur, nocti et
diei Paschalis reserventur.
S. Ioannis Baptistae de la Salle P. memoria omittitur.
ANNIVERSARIA
1992. Ciriè. Fr. Alessandro M. Ongaro, presb., a. 68, r. 51.
1997. Denver. Fr. Benedetto M. Rori, presb., a. 82, r. 66.
2001. Curitiba. Fr. Agostino M. Poli, presb., a. 91, r. 73.
APRILIS 2012
TEMPUS PASCHALE
Quinquaginta die a dominica Resurrectionis ad
dominicam Pentecostes in laetitia et exsultatione
celebrantur sicut unus dies festus, immo «magna
dominica». Hi sunt dies in quibus praecipue can-
tatur Alleluia (AC, 22).
APRILIS 2012
Animadvertenda pro tempore paschali:
1. Cereus paschalis servatur apud altare vel apud ambo-
nem usque ad dom. Pentecostes inclusive.
2. In fine Cp. et loco Angelus Domini, dic. Regina caeli,
usque ad dom. Pentecostes inclusive.
8. Alb. DOMINICA PASCHAE IN RESURREC-
TIONE DOMINI, sollemnitas cum oct. Hodie Off.
lect. omittitur ab iis qui Vig. pasch. interfuerunt.
Animadvertenda de Vigilia paschali:
1. Ex antiquissima traditione, ista nox est observabilis
Domino, et Vigilia quae in ea celebratur, noctem sanctam
commemorando qua Dominus resurrexit, habetur ut
«mater omnium sanctarum vigiliarum». In ea enim Ecclesia
resurrectionem Domini vigilando exspectat, eamque sacra-
mentis initiationis christianae celebrat. Ipsi autem Vigiliae
indolem exspectationis adventus Domini eschatologici tra-
ditio christiana semper agnovit.
97
2. Tota celebratio Vigiliae paschalis peragitur nocte, ita ut
vel incipiatur post initium noctis, vel finiatur ante dilucu-
lum diei dominicae. Usus agendi Vigiliam paschalem
horis vespertinis in quibus Missae dominicae sabbato anti-
cipari solent, reprobandus est. Ita insuper tota celebratio
ordinanda est ut eius natura vigiliae protractae servetur.
3. Celebratio solius Missae sine ritibus Vigiliae paschalis
non permittitur.
4. Vigilia paschalis celebrari potest etiam in ecclesiis et
oratoriis ubi actiones liturgicae feriae V et feriae VI locum
non habuerunt, et omitti ubi praefatae actiones sacrae
celebratae sunt. At de praecepto est celebranda ubi fons
baptismalis adest.
5. Per totam actionem liturgicam sacri ministri induuntur,
sicut ad Missam, vestibus liturgicis albi coloris.
6. Vigilia huius noctis ita ordinatur, ut post breve lucerna-
rium (quod est prima pars huius Vigiliae) sancta Ecclesia
meditetur mirabilia, quae fecit Dominus Deus populo suo
ab initio, confisa verbo eius et promisso (pars secunda seu
liturgia verbi), usque dum, appropinquante die resurrectio-
nis, cum novis membris in baptismate renatis (pars tertia),
vocatur ad mensam, quam Dominus populo suo praepara-
vit per mortem et resurrectionem suam (quarta pars).
Tota Vigilia paschalis symbolis et ritibus perficitur, quae
amplitudine et dignitate ipsis consona peragi debent, ita ut
fideles eorum sensum attingere possint, monitionibus et
orationibus etiam insinuatum. Praestat praesertim fideles
brevi monitione introducere ad intelligendum sensum
typologicum lectionum Veteris Testamenti quae in Vigilia
proponuntur.
98
TEMPUS PASCHALE
7. Ad ignem benedicendum quantum fieri potest, loco
apto extra ecclesiam rogus paretur, cuius flamma revera
tenebras valeat dissipare et noctem illuminare.
8. Cereus paschalis, ad signi veritatem servandam, ex cera sit
confectus, integer, sat notabilis magnitudinis, singulis annis
renovandus: figuram enim Christi exprimere debet qui, vera
lux, mundum illuminat. Signis autem et verbis benedicatur
in libris liturgicis relatis, vel ab Episcoporum conferentia
statutis.
9. Praeconium pasch. annuntiari potest, ex necessitate,
etiam a cantore qui non sit diaconus; qui tamen benedic-
tionem a celebrante non accipit et omittit alteram partem
invitationis (Quapropter…) necnon salutationem Dominus
vobiscum.
Cani potest forma longiore vel forma breviore.
10. Legendae sunt saltem tres lectiones Veteris Testamenti,
et in casibus urgentioribus saltem duae; numquam omittenda
est lectio libri Exodi. En series lectionum huius Vigiliae:
L 1 Gen 1, 1 – 2, 2 vel 1, 1. 26-31a; Ps 103, 1-2a. 5-6. 10 et
12. 13-14. 24 et 35c vel Ps 32, 4-5. 6-7. 12-13. 20 et 22.
L 2 Gen 22, 1-18 vel 22, 1-2, 9a, 10-13, 15-18; Ps 15, 5
et 8. 9-10. 11.
L 3 Ex 14, 15 – 15, 1; Ps Ex 15, 1-2. 3-4. 5-6. 17-18.
L 4 Is 54, 5-14; Ps 29, 2 et 4. 5-6. 11 et 12a et 13b.
L 5 Is 55, 1-11; Ps Is 12, 2-3. 4bcd. 5-6.
L 6 Bar 3, 9-15. 32 – 4, 4; Ps 18, 8. 9. 10. 11.
L 7 Ez 36, 16-17a. 18-28; Ps 41, 3. 5bcd; 42, 3. 4 vel,
quando celebratur Baptisma, Is 12, 2-3. 4bcd. 5-6 vel
Ps 50, 12-13. 14-15. 18-19.
L 8 Rom 6, 3-11; Ps 117, 1-2. 16ab-17. 22-23.
Ev Mc 16, 1-7.
APRILIS 2012
99
11. Liturgia baptismalis Vigiliae paschalis plenitudinem
attingit cum adultorum, vel saltem parvulorum, baptis-
mus celebratur. Attamen, etsi baptismus non est celebran-
dus, in ecclesiis paroecialibus aqua baptismalis benedica-
tur; ubi vero neque fons est benedicendus, memoria bap-
tismi fiat benedictione aquae, qua post renovatas promis-
siones baptismales populus aspergitur.
12. Ad Missae evangelium proclamandum thus adhiberi
potest, sed luminaria non portantur.
13. Praestat plenitudinem signi eucharistici in Vigilia
paschali communione attingi, quae sub speciebus panis et
vini distribuatur. Ordinarii locorum opportunitatem et cir-
cumstantias huius concessionis perpendant et de iis normas
praebeant.
14. Missa Vigiliae est Missa paschalis dominicae Resurrec-
tionis. Qui celebrat vel concelebrat Missam noctis, potest
etiam Missam diei Paschalis celebrare vel concelebrare.
In ecclesiis Ordinis nostri, in fine Vigiliae paschalis,
convenienter fit Sollemnis salutatio Dominae nos-
trae, secundum ritum in novissima editione Proprii
Missarum O.S.M. (anno 1998) descriptum.
Alb. In MISSA VIGILIAE PASCHALIS, pf. I pasch. (in hac
positissimum nocte). In Can. rom. Comm. (noctem
sacratissimam) et Hanc igitur pr.
Adhibeatur PE cum praefatione variabili.
100
TEMPUS PASCHALE
© MISSA IN DIE pr., Gloria, sequentia, Credo, pf. I pasch.
(in hac potissimum die) et Hanc igitur pr.
L 1 Act 10, 34a. 37-43; Ps 117, 1-2. 16ab-17. 22-23.
L 2 Col 3, 1-4 vel 1 Cor 5, 6b-8.
Ev Io 20, 1-9 vel Mc 16, 1-7.
In Missa vespertina legi potest Lc 24, 13-35.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, et Missa exsequialis.
1. Missa diei Paschalis magna cum sollemnitate celebretur.
In ea, loco actus paenitentialis, aspersio fiat aquae (in
nocte) benedictae, ut baptismi memoria revocetur.
2. Cereus paschalis, apud ambonem vel apud altare collo-
candus, ibique toto tempore paschali servandus, in cele-
brationibus liturgici sollemnioribus huius temporis, idest
in Missa, in Laudibus et in Vesperis, accendatur, usque ad
dominicam Pentecostes.
3. Ubi viget, diligentissime servetur aut, si fieri potest,
inducatur usus celebrandi, die Paschae, Vesperas baptis-
males, in quibus, dum cantantur psalmi, fit processio ad
fontes (IH, 213).
Hodie et per totam oct. Cp. dom. (post I vel II
Vp.), ant. Haec dies, cum or. de Resurrectione, loco
Resp. br.
ANNIVERSARIA
2009. Ronzano. Fr. Ivo M. Paoloni, presb., a. 79, r. 61.
9. Alb. FERIA II INFRA OCT. PASCHAE.
APRILIS 2012
101
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 2, 14. 22-33; Ps 15, 1-2a et 5. 7-8. 9-10. 11.
Ev Mt 28, 8-15.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
ANNIVERSARIA
1965. Ferrara. Fr. Angelo M. Barsella, presb., a. 52, r. 34.
2000. Recanati. Fr. Donato M. Senigagliesi, a. 87, r. 60.
10. Alb. FERIA III INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 2, 36-41; Ps 32, 4-5. 18-19. 20 et 22.
Ev Io 20, 11-18.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
ANNIVERSARIA
1990. Nigel. Fr. Giulio M. Zini, presb., a. 86, r. 68.
2004. Negrar. Fr. Angelo M. Vedelago, presb., a. 81, r. 62.
2010. London. Fr. Patrick M. Carroll, presb., a. 57, r. 36.
11. Alb. FERIA IV INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
102
TEMPUS PASCHALE
L 1 Act 3, 1-10; Ps 104, 1-2. 3-4. 6-7. 8-9.
Ev Lc 24, 13-35.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
S. Stanislai E. M. memoria omittitur.
ANNIVERSARIA
1967. Innsbruck. Fr. Joseph M. Valentin, a. 80, r. 39.
1983. Siteki. Fr. Pietro M. Coser, a. 71, r. 41.
12. Alb. FERIA V INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 3, 11-26; Ps 8, 2a et 5. 6-7. 8-9.
Ev Lc 24, 35-48.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
13. Alb. FERIA VI INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 4, 1-12; Ps 117, 1-2 et 4. 22-24. 25-27a.
Ev Io 21, 1-14.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
S. Martini I Pp. M. memoria omittitur.
ANNIVERSARIA
1962. Rio de Janeiro. Ep. Antonio Giulio M. Mattioli, a. 59, r. 42.
1974. Pesaro. Fr. Giovanni M. Nanni, presb., a. 62, r. 45.
APRILIS 2012
103
1977. Chicago. Fr. David M. Motzny, presb., a. 51, r. 30.
1991. Bologna. Fr. Giovanni M. Ibatici, a. 68, r. 54.
1993. Vicenza. Fr. Giovannangelo M. Mazzocato, presb., a. 86,
r. 66.
2010. Montréal. Fr. Georges-Étienne M. Allard, presb., a. 85,
r. 51.
APRILIS 2012
L
ANNUS A TRANSITU FR. IULII M. MATTIOLI,
SERVI MARIAE, EPISCOPI
105
14. Alb. SABBATUM INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 4, 13-21; Ps 117, 1 et 14-15. 16ab-18. 19-21.
Ev Mc 16, 9-15.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
I VESPERAE dom. II Paschae. – Cp. post I vel II Vp.
dom.
Anno 1962, die 13 aprilis, in urbe Rio de Janeiro (Brasilia)
obiit fr. Iulius M. Mattioli, Servus Mariae, episcopus Praelatiae
«Acre e Purus» nuncupatae. Qui ab adventu in Brasiliam
(27.VI.1926) usque ad mortem illi regioni evangelizandae
impense incubuit. Eius corpus in ecclesiae cathedrali urbis Rio
Branco est conditum.
Il 13 aprile 1962, a Rio de Janeiro (Brasile) morì fra Giulio M.
Mattioli, servo di Maria, vescovo della prelazia dell’Acre e
Purús. Egli, fin dal suo arrivo (27.VI.1926), si dedicò instan-
cabilmente all’evangelizzazione di quella regione. Il suo corpo
riposa nella cattedrale di Rio Branco.
On 13 April 1962, fra Giulio M. Mattioli, Servant of Mary
and bishop of the Prelature of Acre and Purus, died in Rio de
Janerio (Brazil). Since his arrival (27.VI.1926), he dedicated
himself tirelessly to the evangelization of that region. His body
is laid to rest in the cathedral of Rio Branco.
15. Alb. In oct. Paschae. DOMINICA II PASCHAE
seu DE DIVINA MISERICORDIA.
De ea.
© MISSA pr. cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia omitti potest.
Credo.
L 1 Act 4, 32-35; Ps 117, 2-4. 16ab-18. 22-24.
L 2 1 Io 5, 1-6.
Ev Io 20, 19-31.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
II VESPERAE dom. II Paschae. – Cp. post I vel II Vp.
dom.
Per totum tempus paschale peculiaris ratio habeatur de
institutione mystagogica neophytorum (OICA, 235-239).
106
TEMPUS PASCHALE
Tempore paschali haec serventur:
1. In feriis non permittuntur Missae ad diversa, votivae aut
cotidianae defunctorum (IM, 337), nisi utilitas pastoralis id
requirat (IM, 333). Permittuntur tamen Missae de memo-
riis his diebus in Martyrologio inscriptis (IM, 316 b).
APRILIS 2012
107
17. Alb. Feria III post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 4, 32-37; Ps 92, 1ab. 1c-2. 5.
Ev Io 3, 7b-15.
2. In Missa unum Alleluia ant. ad introitum et ad commu- ANNIVERSARIA
nionem addatur, nisi iam adsit vel cum sensu verborum 1989. Nepean. Fr. Eric M. Renhas de Pouzet, presb., a. 80, r. 25.
repugnet. 2008. Chicago. Fr. Vincent M. O’Shea, presb., a. 95, r. 73.
3. In Off. Sanctorum (praesertim in Co. App. et Mm.) 18. Alb. Feria IV post dom. II Paschae (hebd. II Psalt.).
partes huic tempori propriae exstant.
4. In Off. Alleluia additur tantum ubi et quomodo indica-
tur. Partes propriae habentur in Ordinario.
ANNIVERSARIA
1984. Livorno. Fr. Giorgio M. Franci, presb., a. 71, r. 52.
16. Alb. Feria II post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 5, 17-26; Ps 33, 2-3. 4-5. 6-7. 8-9.
Ev Io 3, 16-21.
Cras recurret anniversarium electionis Benedicti Pp. XVI
(2005).
Oremus pro eo et pro universa Ecclesia.
MISSA feriae, pf. pasch.
L 1 Act 4, 23-31; Ps 2, 1-3. 4-6. 7-9.
Ev Io 3, 1-8.
1963.
1971.
1976.
2000.
2000.
ANNIVERSARIA
Turvo. Fr. Gregorio M. Dal Monte, presb., a. 72, r. 56.
Figline Valdarno. Fr. Aurelio M. Prosperi, presb., a. 85,
r. 68.
Montréal. Fr. Bruno M. Dely, presb., a. 62, r. 41.
Ancona. Fr. Enrico M. Battistella, diac., a. 85, r. 65.
Firenze. Fr. Michele M. Bari, presb., a. 86, r. 68.
ANNIVERSARIA
1962. Wien. Fr. Leopold M. Mungenast, presb., a. 75, r. 56.
1987. Albuquerque. Fr. Caspar M. Yost, presb., a. 87, r. 64.
1993. Chicago. Fr. Patrick M. Roche, presb., a. 89, r. 70.
19. Alb. Feria V post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 5, 27-33; Ps 33, 2 et 9. 17-18. 19-20.
Ev Io 3, 31-36.
108
TEMPUS PASCHALE
DIES MISSIONIS
Missio in regione Swaziland anno 1923, die 19 apri-
lis, in Praefecturam apostolicam erecta, hodie Diem
Missionis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deum enixe exorent ut in illa regione Ecclesia in
dies floreat.
APRILIS 2012
109
21. Alb. Sabb. post dom. II Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb. Vel:
Alb. S. Anselmi E. D.
MISSA sabb., pf. pasch., vel MISSA memoriae, Temp.
pasch. vel de sancto, vel MISSA B. Mariae V., Temp.
pasch.
L 1 Act 6, 1-7; Ps 32, 1-2. 4-5. 18-19.
Ev Io 6, 16-21.
ANNIVERSARIA
1965.
1999.
2002.
2006.
Wien. Fr. Anselm M. Wimmer, presb., a. 65, r. 48.
Portland. Fr. Philip M. Brennan, presb., a. 84, r. 63.
Benburb. Fr. Gabriel M. Bracken, a. 75, r. 51.
Negrar. Fr. Matteo M. Novello, presb., a. 86, r. 66.
20. Alb. Feria VI post dom. II Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 5, 34-42; Ps 26, 1. 4. 13-14.
Ev Io 6, 1-15.
ANNIVERSARIA
1963.
1963.
1963.
1964.
1999.
Reggio Emilia. Fr. Bernardo M. Savi, presb., a. 77, r. 61.
Bologna. Fr. Amadio M. Piccinelli, presb., a. 66, r. 41.
Frohnleiten. Fr. Simeon M. Oberleitner, a. 84, r. 54.
Workingham. Fr. Joachim M. McCarthy, presb., a. 81, r. 63.
Manduria. Fr. Carmelo M. Padalino, presb., a. 75, r. 56.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 15: Beata Maria Virgo in resurrectione Domini.
I VESPERAE dom. III Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Pisa. Fr. Agostino M. Del Cesta, presb., a. 82, r. 57.
22. Alb. DOMINICA III PASCHAE (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. Pasch.
L 1 Act 3, 13-15. 17-19; Ps 4, 2. 4. 7. 9.
L 2 1 Io 2, 1-5a.
Ev Lc 24, 35-48.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. III Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Siena. Fr. Bartolomeo M. Giorgi, presb., a. 82, r. 65.
1969. Tirano. Fr. Guido M. Dalle Carbonare, presb., a. 45, r. 25.
110
TEMPUS PASCHALE
APRILIS 2012
111
1973. Hillside. Fr. Hyacinth M. Breski, presb., a. 80, r. 60. ANNIVERSARIA
1978. Vicenza. Fr. Gerardo M. Borsato, a. 63, r. 42. 1998. Eger. Fr. Agostón M. Csete, presb., a. 85, r. 65.
1984. Portland. Fr. Peregrine M. Pillarella, a. 84, r. 41. 2003. KwaNgwanase. Fr. Alphonse M. Mooney, presb., a. 69, r. 50.
23. Alb. Feria II post dom. III Paschae (hebd. III Psalt.). 24. Alb. Feria III post dom. III Paschae (hebd. III Psalt.).
De ea. Vel: De ea. Vel:
Rub. S. Georgii M. Vel: Rub. S. Fidelis de Sigmaringen P. M.
Rub. S. Adalberti E. M.
MISSA feriae, pf. pasch., vel MISSA unius e memoriis,
pf. pasch. vel de sancto.
L 1 Act 6, 8-15; Ps 118, 23-24. 26-27. 29-30.
Ev Io 6, 22-29.
In Anglia:
23. Rub. Feria II. S. GEORGII M., ANGLIAE PATRONI,
festum. – Ad H. m. ant. et pss. feriae II hebd. IV.
MISSA pr., Gloria, pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
Cras recurret anniversarium sollemnis inaugurationis
Pontificatus Benedicti Pp. XVI (2005), quem Dominus
in omnibus prosperet et diu conservet.
In omnibus Missis habeatur peculiaris intentio pro Papa in
oratione universali.
MISSA feriae, pf. pasch. vel MISSA memoriae, pf. pasch.
vel de sancto.
L 1 Act 7, 51 – 8, 1a;
Ps 30, 3cd-4. 6ab et 7b et 8a. 17 et 21ab.
Ev Io 6, 30-35.
ANNIVERSARIA
1972. Firenze. Fr. Paolo M. Giannelli, presb., a. 86, r. 68.
1979. Superga. Fr. Tarcisio M. Pons, a. 79, r. 43.
1980. Vicenza. Fr. Giacomo M. Tonellotto, a. 67, r. 44.
1992. Portland. Fr. Donald M. Morgan, presb., a. 76, r. 51.
2010. Piggs Peak. Fr. Maurice M. O’Gorman, presb., a. 67, r. 47.
25. Rub. Feria IV. S. MARCI, EVANGELISTAE, festum.
– Ad H. m. ant. de temp. et pss. feriae IV hebd. III.
MISSA pr., Gloria, lect. pr., pf. App. II.
L 1 1 Petr 5, 5b-14; Ps 88, 2-3. 6-7. 16-17.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1985. Venezia. Fr. Amadio M. Righele, presb., a. 88, r. 69.
1988. Roma. Fr. Agostino M. Rossi, presb., a. 70, r. 51.
1998. Dublin. Fr. Vincent M. McGlue, a. 72, r. 42.
112
113
TEMPUS PASCHALE APRILIS 2012
26. Alb. Feria V post dom. III Paschae (hebd. III Psalt.). ANNIVERSARIA
De ea. 1987. Marina di Carrara. Fr. Lorenzo M. Giannelli, presb., a. 78,
r. 59.
1995. Manchester. Fr. James M. O’Connell, presb., a. 73, r. 53.
MISSA feriae, pf. pasch.
L 1 Act 8, 26-40; Ps 65, 8-9. 16-17. 20.
Ev Io 6, 44-51.
DIES PRO FOVENDIS VOCATIONIBUS O.S.M.
27. Alb. Feria VI post dom. III Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 9, 1-20; Ps 116, 1. 2.
Ev Io 6, 52-59.
ANNIVERSARIA
1986. Fullerton. Fr. Manettus M. Ortmann, presb., a. 75, r. 55.
1995. Saint Louis. Fr. Joseph M. Byrne, diac., a. 73, r. 43.
Sanctus Philippus Benizi, feria quinta Paschae, in mis-
sae celebratione verba audivit: Dixit Spiritus Philippo:
«Accede et adiunge te ad currum istum» (Act 8, 29) sta-
timque ad gloriosae Virginis currum in religione
Servorum eius adiungi decrevit.
Tota Servorum familia, quae hodie in liturgia euchari-
stica eadem verba ac Philippus audivit, Deo omnipo-
tenti ferventes effundat preces ad copiosas vocationes
religiosas et sacerdotales in Ordine nostro impetran-
das. Quae supplicatio in omnibus Servorum ecclesiis,
in missae celebratione, fidelibus de eius sensu hac vi
admonitis, fiat oportet, praesertim in orationis uni-
versalis precibus.
28. Alb. Sabb. post dom. III Paschae (hebd. III Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb. Vel:
Rub. S. Petri Chanel P. M. Vel:
Alb. S. Ludovici Mariae Grignion de Montfort P.
MISSA feriae, pf. pasch., vel MISSA B. Mariae V.,
Temp. Pasch., vel MISSA unius e memoriis, pf. pasch.
vel de sancto.
L 1 Act 9, 31-42; Ps 115, 12-13. 14-15. 16-17.
Ev Io 6, 60-69.
Vel:
Una e missis CMBMV Temp. Pasch., praesertim
form. n. 16: Sancta Maria Virgo, fons lucis et vitae.
I VESPERAE dom. IV Paschae. – Cp. post I Vp. dom.
114
TEMPUS PASCHALE
ANNIVERSARIA
1976. Bruxelles. Fr. Leonard M. Walters, a. 65, r. 45.
2004. Vicenza. Fr. Filippo M. Zanin, presb., a. 77, r. 55.
29. Alb. DOMINICA IV PASCHAE (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 4, 8-12; Ps 117, 1 et 8-9. 21-23. 26 et 28cd et 29.
L 2 1 Io 3, 1-2.
Ev Io 10, 11-18.
DIES PRO FOVENDIS VOCATIONIBUS
Hac dominica peculiare supplicationes fiunt pro
fovendis vocationibus sacerdotalibus et religiosis.
Haec intentio, fidelibus explicanda in homilia, preces
informet in oratione universali.
Prohibentur Missae defunctorum, excepta Missa exsequiali.
S. Catharinae Senensis V.D. memoria omittitur.
II VESPERAE dom. IV Paschae. – Cp. post II Vp.
dom.
In Italia et in Europa:
S. Catharinae Senensis V.D., Italiae et Europae patronae,
festum omittitur.
APRILIS 2012
115
ANNIVERSARIA
1996. Quilmes. Fr. Attilio M. Pizzolato, presb., a. 71, r. 51.
2002. Plasencia. Fr. Juan Ángel M. Bracesco, presb., a. 83, r. 60.
2004. Hall bei Innsbruck. Fr. Laudislaus M. Maurer, presb.,
a. 90, r. 73.
30. Alb. Feria II post dom. IV Paschae (hebd. IV Psalt.).
De ea. Vel:
Alb. S. Pii V Pp.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de sancto.
L 1 Act 11, 1-18; Ps 41, 2-3; 42, 3. 4.
Ev Io 10, 1-10.
ANNIVERSARIA
1988. Torino. Fr. Guido M. Mattioli, presb., a. 54, r. 35.
TRIDUUM
S. PEREGRINI LAZIOSI
Diebus 1-2-3 maii in omnibus ecclesiis Ser-
vorum Familiæ dicantur oportet preces ut fratres
omnesque sodales ad festum S. Peregrini Laziosi
celebrandum apte disponantur. Ad hoc oppor-
tune adhibebitur subsidium cui est titulus In
lode di san Pellegrino Laziosi vel In praise of saint Peregrine Laziosi
vel À la louange de saint Pérégrin Laziosi vel En honor de San
Peregrino Laziosi.
MAIUS 2012
MAIUS 2012
1. Alb. Feria III post dom. IV Paschae (hebd. IV Psalt.).
De ea. Vel:
Alb. S. Ioseph Opificis.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pr.
L 1 Act 11, 19-26; Ps 86, 1-3. 4-5. 6-7.
Ev Io 10, 22-30.
Vel, in Missis S. Ioseph:
L 1 Gen 1, 26 – 2, 3 vel Col 3, 14-15. 17. 23-24;
Ps 89, 2. 3-4. 12-13. 14 et 16.
Ev Mt 13, 54-58.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Minime del-
l’Addolorata, hanc diem, qua anno 1868 Sancta Clelia
Barbieri (1847-1870), Congegrationis Fundatrix, in
pace obdormivit, tamquam Diem Congregationis cele-
brat. Anno 1951 die 9 ianuarii Congregatio Ordini
nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
beatae Virgini reddant et pro bono atque incremen-
to Instituti ferventes adhibeant preces.
1977.
1982.
1989.
1994.
ANNIVERSARIA
Udine. Fr. Virginio M. Rigo, a. 68, r. 49.
Reggio Emilia. Fr. Alfonso M. Montà, presb., a. 75, r. 56.
Vicenza. Fr. Nazareno M. Milani, presb., a. 75, r. 59.
Bend (Oregon). Fr. Maurice M. Gillespie, presb., a. 76,
r. 56.
117
2. Alb. Feria IV post dom. IV Paschae (hebd. IV Psalt.).
S. Athanasii E. D., memoria.
MISSA memoriae, pf. pasch. vel de sancto.
L 1 Act 12, 24 – 13, 5a; Ps 66, 2-3. 5. 6 et 8.
Ev Io 12, 44-50.
ANNIVERSARIA
1972. Terni. Fr. Luciano M. De Luca, presb., a. 46, r. 22.
1995. Francavilla al Mare. Fr. Luigi M. Rufini, presb., a. 72,
r. 53.
1996. Montréal. Fr. Mario M. De Santis, presb., a. 78, r. 59.
3. Rub. Feria V. SS. PHILIPPI ET IACOBI APP., festum.
– Ad H. m. ant. de temp. et pss. feriae V hebd. IV.
De ea.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 1 Cor 15, 1-8; Ps 18, 2-3. 4-5.
Ev Io 14, 6-14.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1963. S. Paulo. Fr. Giovanni M. Cardinale, presb., a. 33, r. 16.
1994. Moncalieri. Fr. Romeo M. Rizzo, a. 46, r. 16.
4. Alb. Feria VI. S. PEREGRINI LAZIOSI, RELIGIOSI
O.N., festum. – Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 2 Cor 4, 10-18; Ps 87, 2-3. 4-5. 10. 14.
Ev Mt 7, 7-14.
118
TEMPUS PASCHALE
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1968. Roma. Fr. Alessio M. Rossi, presb., a. 80, r. 62.
1977. Pannonhalma. Fr. Bertalan M. Süle, a. 73, r. 36.
2011. Pietermaritzburg. Fr. Mthokozisi M. Maseko, presb., a. 54,
r. 32.
5. Alb. Sabb. post dom. IV Paschae (hebd. IV Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch., vel Missa B. Mariae V., Temp.
Pasch.
L 1 Act 13, 44-52; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 14, 7-14.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 18: Beata Maria Virgo, Regina Apostolorum.
I VESPERAE dom. V Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1981. Budapest. Fr. Benedek M. Pataki, presb., a. 63, r. 41.
6. Alb. DOMINICA V PASCHAE (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 9, 26-31; Ps 21, 26b-27. 28 et 30. 31-32.
L 2 1 Io 3, 18-24.
Ev Io 15, 1-8.
Prohibentur aliae celebrationes, excepta exsequiali.
MAIUS 2012
119
II VESPERAE dom. V Paschae. – Cp. post II Vp. dom.
1966.
1979.
1981.
1988.
1989.
1997.
ANNIVERSARIA
Firenze. Fr. Andrea M. Nesi, presb., a. 85, r. 68.
Chicago. Fr. Joseph M. Grabrian, presb., a. 74, r. 52.
Pesaro. Fr. Stefano M. Cherubini, presb., a. 56, r. 38.
Arco. Fr. Vincenzo M. Campesato, presb., a. 72, r. 52.
Gnas. Fr. Otho M. Trummer, presb., a. 68, r. 33.
Wheeling. Fr. Thomas M. Lo Cascio, presb., a. 83, r. 63.
7. Alb. Feria II post dom. V Paschae (hebd. I Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 14, 5-18; Ps 113B, 1-2. 3-4. 15-16.
Ev Io 14, 21-26.
ANNIVERSARIA
1976. Siteki. Fr. Giuseppe M. Vitelli, presb., a. 66, r. 48.
1993. Nigel. Fr. Alessio M. Treppo, a. 70, r. 46.
2007. Sainte-Foy. Fr. Gérard M. Therrien, presb., a. 57, r. 36.
8. Alb. Feria III post dom. V Paschae (hebd. I Psalt.).
De ea. Vel:
Alb. B. Mariae V. gratiarum Matris ac Mediatricis
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. B.
Mariae V.
L 1 Act 14, 19-28; Ps 144, 10-11. 12-13ab. 21.
Ev Io 14, 27-31a.
120
TEMPUS PASCHALE
MAIUS 2012
Vel, in Missa de B. Mariae V.:
L 1 Est 8, 3-8. 16-17a; Ps 66, 2-3. 4-5. 6-7.
Ev Io 2, 1-12.
121
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore di Maria
Ss. Addolorata (Napoli), hanc diem, qua anno 1840
Institutum initium cepit, tamquam Diem Congrega-
tionis celebrat. Anno 1951 die 25 octobris Congre-
gatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici, grates Deo et beatae Mariae Virgini rependen-
tes, enixas effundant preces pro Instituti bono atque
incremento.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 30: Beata Maria Virgo, mater et media-
trix gratiae.
In Argentina:
7. I VESPERAE seq. – Cp. post I Vp. dom.
ANNIVERSARIA
Tirano. Fr. Giovanni M. Todesco, presb., a. 51, r. 29.
Saluzzo. Fr. Giovanni M. Ballerini, presb., a. 66, r. 34.
Bruxelles. Fr. Pérégrin M. Desaever, a. 79, r. 62.
Torino. Fr. Adriano M. Canavoso, a. 88, r. 69.
8. Alb. Feria III. «NUESTRA SEÑORA DE LUJÁN», 1968.
PATRONAE PRINCIPALIS REI PUBLICAE 1975.
ARGENTINAE, sollemnitas. – Ad H. m. ant. pr. cum 2001.
psalmodia complementari. 2008.
© MISSA pr., Gloria, Credo, pf. pr. 9. Alb. Feria IV post dom. V Paschae (hebd. I Psalt.).
L 1 Is 35, 1-6a. 10 vel Act 1, 12-14; 2,1-4; De ea.
Ps Lc 1, 46-47. 48-49. 50-51. 52-53. 54-55.
L 2 Eph 1, 3-14
Ev Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, excepta Missa
exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
MISSA feriae, pf. pasch.
L 1 Act 15, 1-6; Ps 121, 1-2. 3-4a. 4b-5.
Ev Io 15, 1-8.
ANNIVERSARIA
1979. Gelsenkirchen-Buer. Fr. Theophil M. Wanderti, presb.,
a. 50, r. 29.
1985. Phoenix. Fr. Gilbert M. Hayden, presb., a. 70, r. 49.
10. Alb. Feria V post dom. V Paschae (hebd. I Psalt.).
De ea.
122
TEMPUS PASCHALE
MISSA feriae, pf. pasch.
L 1 Act 15, 7-21; Ps 95, 1-2a. 2b-3. 10.
Ev Io 15, 9-11.
11. Alb. Feria VI post dom. V Paschae (hebd. I Psalt.).
De ea. Vel:
Alb. B. Benincasa, religiosi O.N.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de beato.
L 1 Act 15, 22-31; Ps 56, 8-9. 10-12.
Ev Io 15, 12-17.
ANNIVERSARIA
1974. Elmhurst. Fr. Francis M. Fitzgerald, presb., a. 69, r. 30.
1978. Rosznó. Fr. Ferenc M. Repási, a. 79, r. 31.
12. Alb. Sabb. post dom. V Paschae (hebd. I Psalt.).
B. Francisci Senensis, presbyteri O.N., memoria.
MISSA memoriae, pf. pasch. vel de beato.
L 1 Act 16, 1-10; Ps 99, 2. 3. 5.
Ev Io 15, 18-21.
Ss. Nerei et Achillei Mm. et de S. Pancratii M. memoriae
omittuntur.
I VESPERAE dom. VI Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1997. Wien. Fr. Joachim M. Nagy, a. 92, r. 68.
1997. Viareggio. Fr. Alfonso M. Marinucci, a. 70, r. 47.
MAIUS 2012
123
13. Alb. DOMINICA VI PASCHAE (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 10, 25-26. 34-35. 44-48; Ps 97, 1. 2-3ab. 3cd-4.
L 2 1 Io 4, 7-10.
Ev Io 15, 9-17.
Vel ad libitum, ubi sollemnitas Ascensionis dominica
sequenti celebratur:
L 1 et Ps ut supra.
L 2 1 Io 4, 11-16.
Ev Io 17, 11b-19.
Prohibentur aliae celebrationes, excepta exsequiali.
B. Mariae Virginis de Fatima memoria omittitur.
II VESPERAE dom. VI Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. Detroit. Fr. Alexis M. Croke, presb., a. 75, r. 59.
1971. Montréal. Fr. Henri M. Paradis, presb., a. 71, r. 38.
2000. Portland. Fr. Mark M. Holmes, a. 93, r. 54.
14. Rub. Feria II. S. MATTHIAE, AP., festum. – Ad H.
m. ant. de temp. et pss. feriae II hebd. II.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Act 1, 15-17. 20-26; Ps 112, 1-2. 3-4. 5-6. 7-8.
Ev Io 15, 9-17.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
124
TEMPUS PASCHALE
ANNIVERSARIA
1964. Tiszanagyfalu. Fr. Janos-Angyal M. Kováts, presb., a. 49,
r. 32.
1967. Firenze. Fr. Anton M. Keulemans, a. 64, r. 2.
15. Alb. Feria III post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
MAIUS 2012
125
In Provincia Tirolensi:
16. Rub. Feria IV. S. IOANNIS NEPOMUCENI P. M.,
PROVINCIAE TIROLENSIS PATRONI, festum. – Ad
H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
L 1 Act 16, 22-34; Ps 137, 1-2a. 2bc-3. 7c-8.
Ev Io 16, 5-11.
ANNIVERSARIA
1983. Cittadella. Fr. Domenico M. Corna, a. 78, r. 53.
1984. Chichester. Fr. Francis M. Mildner, presb., a. 73, r. 54.
COMMODITATIS CAUSA DUPLEX INTEGRA
SERIES DIERUM 15-20 MAII PROPONITUR PROUT
SOLLEMNITAS ASCENSIONIS DIE 17 MAII AUT
DOMINICA VII POST PASCHA CELEBRATUR.
Ubi sollemnitas Ascensionis die dominica celebratur:
16. Alb. Feria IV post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 17, 15. 22 – 18, 1;
Ps 148, 1-2. 11-12ab. 12c-14a. 14bcd.
Ev Io 16, 12-15.
ANNIVERSARIA
1982. Portland. Fr. Philip M. Willy, a. 87, r. 56.
2011. Lisieux. Fr. Bruno M. Chénais, presb., a. 60, r. 30.
17. Alb. Feria V post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 18, 1-8; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 16, 16-20.
ANNIVERSARIA
1987. Midhurst. Fr. Augustine M. Cadd, presb., a. 83, r. 64.
2005. Montréal. Fr. Gaston M. Venne, presb., a. 90, r. 70.
18. Alb. Feria VI post dom. VI Paschae (hebd. II Psalt.).
De ea. Vel:
Rub. S. Ioannis I Pp. M.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de sancto.
126
TEMPUS PASCHALE
L 1 Act 18, 9-18; Ps 46, 2-3. 4-5. 6-7.
Ev Io 16, 20-23a.
ANNIVERSARIA
1998. Trento. Fr. Bruno M. Sartori, presb., a. 70, r. 52.
2000. Pietrasanta. Fr. Davide M. Montagna, presb., a. 63, r. 46.
2008. Marina di Carrara. Fr. Federico M. Aliboni, presb., a. 86,
r. 69.
19. Alb. Sabb. post dom. VI Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch., vel MISSA B. Mariae V.,
Temp. pasch.
L 1 Act 18, 23-28; Ps 46, 2-3. 8-9. 10.
Ev Io 16, 23b-28.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 17: Beata Maria Virgo a Cenaculo.
I VESPERAE soll. Ascensionis – Cp. post I Vp. dom.
20. Alb. Dom. IN ASCENSIONE DOMINI, sollemnitas.
© MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Act 1, 1-11; Ps 46, 2-3. 6-7. 8-9.
L 2 Eph 1, 17-23 vel Eph 4, 1-13 vel 4, 1-7. 11-13.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Bernardini Senensis P. memoria omittitur.
MAIUS 2012
127
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Torino. Fr. Giacomo M. Tivano, presb., a. 77, r. 59.
1967. Portland. Fr. Michael M. Miller, presb., a. 84, r. 64.
Ubi sollemnitas Ascensionis die 17 maii celebratur:
16. Alb. Feria IV post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 17, 15. 22 – 18, 1;
Ps 148, 1-2. 11-12ab. 12c-14a. 14bcd.
Ev Io 16, 12-15.
I VESPERAE soll. Ascensionis – Cp. post I Vp. dom.
In Provincia Tirolensi:
16. Rub. Feria IV. S. IOANNIS NEPOMUCENI P. M.,
PROVINCIAE TIROLENSIS PATRONI, festum. – Ad
H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1982. Portland. Fr. Philip M. Willy, a. 87, r. 56.
2011. Lisieux. Fr. Bruno M. Chénais, presb., a. 60, r. 30.
128
TEMPUS PASCHALE
17. Alb. Feria V. IN ASCENSIONE DOMINI, sollem-
nitas.
MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Act 1, 1-11; Ps 46, 2-3. 6-7. 8-9.
L 2 Eph 1, 17-23 vel Eph 4, 1-13 vel 4, 1-7. 11-13.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1987. Midhurst. Fr. Augustine M. Cadd, presb., a. 83, r. 64.
2005. Montréal. Fr. Gaston M. Venne, presb., a. 90, r. 70.
18. Alb. Feria VI post dom. VI Paschae (hebd. II Psalt.).
De ea. Vel:
Rub. S. Ioannis I Pp. M.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancto.
L 1 Act 18, 9-18; Ps 46, 2-3. 4-5. 6-7.
Ev Io 16, 20-23a.
ANNIVERSARIA
1998. Trento. Fr. Bruno M. Sartori, presb., a. 70, r. 52.
2000. Pietrasanta. Fr. Davide M. Montagna, presb., a. 63, r. 46.
2008. Marina di Carrara. Fr. Federico M. Aliboni, presb., a. 86,
r. 69.
MAIUS 2012
129
19. Alb. Sabb. post dom. VI Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch. vel Asc., vel MISSA B. Mariae
V., Temp. pasch.
L 1 Act 18, 23-28; Ps 46, 2-3. 8-9. 10.
Ev Io 16, 23b-28.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 17: Beata Maria Virgo a Cenaculo.
I VESPERAE dom. VII Paschae. – Cp. post I Vp. dom.
20. Alb. DOMINICA VII PASCHAE (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch. vel Asc.
L 1 Act 1, 15-17. 20a. 20c-26; Ps 102, 1-2. 11-12.
19-20ab.
L 2 1 Io 4, 11-16.
Ev Io 17, 11b-19.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Bernardini Senensis P. memoria omittitur.
II VESPERAE dom. VII Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Torino. Fr. Giacomo M. Tivano, presb., a. 77, r. 59.
1967. Portland. Fr. Michael M. Miller, presb., a. 84, r. 64.
130
TEMPUS PASCHALE MAIUS 2012
21. Alb. Feria II post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Rub. Ss. Christophori Magallanes P. et soc., Mm.
131
L 1 Act 20, 28-38; Ps 67, 29-30. 33-35a. 35b-36c.
Ev Io 17, 11b-19.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancto.
L 1 Act 19, 1-8; Ps 67, 2-3. 4-5ac. 6-7ab.
Ev Io 16, 29-33.
ANNIVERSARIA
1965. Manzini. Ep. Costantino M. Barneschi, a. 72, r. 56.
22. Alb. Feria III post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Alb. S. Ritae de Cascia Rel.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancta.
L 1 Act 20, 17-27; Ps 67, 10-11. 20-21.
Ev Io 17, 1-11a.
1968.
1971.
1971.
1992.
1996.
ANNIVERSARIA
Chicago. Fr. Paul M. Grace, presb., a. 57, r. 35.
Roma. Fr. Giovanni M. Pioppi, presb., a. 94, r. 78.
São Paolo. Fr. Andrew M. Van Halder, presb., a. 81, r. 63.
Negrar. Fr. Clemente M. Alba, presb., a. 92, r. 74.
Brescia. Fr. Contardo M. Dal Bianco, presb., a. 82, r. 64.
23. Alb. Feria IV post dom. VII Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch. vel Asc.
1980.
1986.
1986.
2001.
ANNIVERSARIA
Pannonhalma. Fr. Imre M. Góra, a. 80, r. 31.
Mtubataba. Fr. Giovanni M. Bardini, a. 79, r. 56.
Santiago de Chile. Fr. Tommaso M. Sgualdino, presb.,
a. 75, r. 56.
Sainte-Foy. Fr. Roland M. Corbeil, diac., a. 77, r. 31.
24. Alb. Feria V post dom. VII Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch. vel Asc.
L 1 Act 22, 30; 23, 6-11; Ps 15, 1-2a et 5. 7-8. 9-10. 11.
Ev Io 17, 20-26.
In Australia:
23. I VESPERAE seq. soll. – Cp. post II Vp. dom.
24. Alb. Feria V. B. MARIAE V. AUXILIATRICIS CHRI-
STIANORUM, AUSTRALIAE PATRONAE PRINCI-
PALIS, sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
132
TEMPUS PASCHALE
ANNIVERSARIA
1996. Firenze. Fr. Pellegrino M. Buracchi, presb., a. 87, r. 67.
2009. Benburb. Fr. Aloyisius M. Peoples, presb., a. 78, r. 56.
25. Vir. Feria VI post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Alb. S. Bedae Venerabilis P. D. Vel:
Alb. S. Gregorii VII Pp. Vel:
Alb. S. Mariae Magdalenae de’ Pazzi V.
MISSA feriae, pf. pasch. vel Asc., vel MISSA unius e
memoriis, pf. pasch. vel Asc. vel de sancto.
L 1 Act 25, 13b-21; Ps 102, 1-2. 11-12. 19-20ab.
Ev Io 21, 15-19.
MAIUS 2012
133
DOMINICA PENTECOSTES, sollemnitas
Sacrum quinquaginta dierum tempus paschale concluditur
dominica Pentecostes, qua commemorantur donum Spiritus
Sancti in Apostolos, primordia Ecclesiae atque initia eius
missionis ad omnes linguas et populos et nationes.
Praestat ampliore forma Missam in vigilia celebrare, cum
lectionibus et orationibus in libris liturgicis propositis. Haec
tamen Missa characterem baptismalem, ut in Vigilia paschali,
non habet, sed intensioris orationis exemplo Apostolorum,
qui erant, cum Maria Matre Iesu, unanimes in oratione per-
severantes, Spiritus effusionem exspectando.
26. Rub. Sabbato, vespere. – MISSA VIGILIAE pr., Gloria,
Credo, pf. (et Comm.) pr.
MISSA memoriae, pf. pasch. vel Asc. vel de sancto. L 1 Gen 11, 1-9; Ps 32, 10-11. 12-13. 14-15
vel Ex 19, 3-8a. 16-20b; Ps 102, 1-2. 3-4. 6-7. 17-18
vel Ez 37, 1-14; Ps 50, 1-2. 8-9. 12-13. 14 et 17
vel Ioel 3, 1-5; Ps 103, 1-2a. 24 et 35c. 27-28. 29bc-30.
L 2 Rom 8, 22-27.
Ev Io 7, 37-39.
Ad Missam vigiliae et diei adhibeatur PE cum praefatione
variabili.
L 1 Act 28, 16-20. 30-31; Ps 10, 4. 5 et 7. I VESPERAE soll. – Cp. post I Vp. dom.
Ev Io 21, 20-25.
ANNIVERSARIA
1968. Trieste. Fr. Agostino M. Perin, a. 66, r. 16.
26. Alb. Sabb. post dom. VII Paschae (hebd. III Psalt.).
S. Philippi Neri P., memoria.
ANNIVERSARIA
1995. Beaverton. Fr. Eugene M. Walsh, presb., a. 76, r. 56.
2003. Richard’s Bay (KwaZulu-Natal). Fr. Edwin M. Kinch,
presb., a. 84, r. 65.
2010. Vicenza. Fr. Battista M. Pivato, a. 89, r. 68.
27. Rub. Dominica. Officium proprium.
© MISSA IN DIE pr., Gloria, Sequentia, Credo, pf. (et
Comm.) pr.
L 1 Act 2, 1-11; Ps 103, 1ab et 24ac. 29bc-30. 31 et 34.
L 2 1 Cor 12, 3b-7. 12-13 vel Gal 5, 16-25.
Ev Io 20, 19-23 vel Io 15, 26-27; 16, 12-15.
134
TEMPUS PASCHALE
Prohibentur aliae celebrationes, excepta exsequiali.
S. Augustini Cantuariensis E. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
Post dominicam Pentecostes cereus paschalis honorifice in
baptisterio servetur, ut ex eius flamma, in celebratione bap-
tismi, cerei baptizatorum illuminentur. In exequiis autem
cereus paschalis apud feretrum collocetur, ad insinuandum
mortem christiano esse ipsius verum pascha.
Extra tempus paschale cereus paschalis in presbyterio nec
servetur nec accendatur.
Cras resumetur oratio Angelus Domini.
ANNIVERSARIA
1985. Arco. Fr. Ernesto M. Giovanazzi, presb., a. 69, r. 51.
2003. Fullerton. Fr. David M. Kondik, presb., a. 84, r. 62.
TEMPUS PER ANNUM
post Tempus Paschale
Tempore per annum non celebratur peculiaris my-
sterii Christi aspectus; sed potius ipsum mysterium
Christi in sua plenitudine recolitur, praesertim die-
bus dominicis (AC, 43).
Resumitur tempus per annum ab hebdomada VIII, cum
vol. III Liturgiae Horarum et, in Missa, cum Lectionario
feriali, Anno II.
MAIUS 2012
28. Vir. Feria II hebd. VIII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Petr 1, 3-9; Ps 110, 1-2. 5-6. 9 et 10c.
Ev Mc 10, 17-27.
ANNIVERSARIA
1969. Manzini. Fr. Martin M. Nagy, a. 75, r. 38.
1981. Rio de Janeiro. Fr. Tommaso M. Maronati, a. 73, r. 44.
2002. Medellín. Fr. Tarcisio M. Milani Spagnoli, presb., a. 73,
r. 55.
29. Vir. Feria III hebd. VIII per annum (IV Psalt.).
De ea.
136
TEMPUS PER ANNUM
MISSA ad libitum (cf. p. XVIII).
L 1 1 Petr 1, 10-16; Ps 97, 1. 2-3ab. 3c-4.
Ev Mc 10, 28-31.
ANNIVERSARIA
1983. San Pierre. Fr. William M. Walsh, presb., a. 70, r. 50.
1994. Orvieto. Fr. Giuseppe M. Lupardini, presb., a. 75, r. 58.
1999. Negrar. Fr. Paolo M. Ferronato, presb., a. 75, r. 55.
30. Alb. Feria IV hebd. VIII per annum (IV Psalt.).
B. Iacobi Philippi Bertoni, presbyteri O. N.,
memoria.
MISSA memoriae.
L 1 1 Petr 1, 18-25; Ps 147, 12-13. 14-15. 19-20.
Ev Mc 10, 32-45.
1978.
2006.
2006.
2007.
ANNIVERSARIA
Torino. Fr. Benizio M. Botta, presb., a. 82, r. 63.
Siracusa. Fr. Enrico M. Gibilisco, presb., a. 87, r. 70.
Empangeni. Ep. Michael M. O’Shea, a. 75, r. 55.
Dundee. Fr. Peter M. Broadhurst, a. 61, r. 34.
31. Rub. Feria V. IN VISITATIONE B. MARIAE V.,
festum. – Ad H. m. ant. de temp. et pss. feriae V hebd.
IV.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
L 1 Soph 3, 14-18 vel Rom 12, 9-16b;
Ps Is 12, 2-3. 4bcd. 5-6.
Ev Lc 1, 39-56.
MAIUS 2012
137
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1972. Tirano. Fr. Samuele M. Giuriato, presb., a. 50, r. 31.
1976. Perth Amboy. Fr. Charles M. Lyons, presb., a. 87, r. 70.
IUNIUS 2012
IUNIUS 2012
1. Rub. Feria VI hebd. VIII per annum (IV Psalt.).
S. Iustini M., memoria.
MISSA memoriae.
L 1 1 Petr 4, 7-13; Ps 95, 10. 11-12. 13.
Ev Mc 11, 11-26.
ANNIVERSARIA
1985. Dungannon. Fr. Manettus M. Brady, a. 69, r. 27.
1988. Senigallia. Fr. Filippo M. Gervasi, presb., a. 75, r. 58.
2. Alb. Sabb. hebd. VIII per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iud 17, 20b-25; Ps 62, 2. 3-4. 5-6.
Ev Mc 11, 27-33.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 42: Beata Maria Virgo, auxilium chris-
tianorum.
Ss. Marcellini et Petri M. memoria omittitur.
I VESPERAE SS. Trinitatis. – Cp. post I Vp. dom.
ANNIVERSARIA
2000. London. Fr. Gerard M. Corr, presb., a. 89, r. 70.
139
3. Alb. Dominica. SS. TRINITATIS, sollemnitas.
Missa et Off. exstant in fine Proprii de Tempore.
Ad H. m. ant. pr. cum pss. dom. hebd. I.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Deut 4, 32-34. 39-40; Ps 32, 4-5. 6 et 9. 18-19. 20
et 22.
L 2 Rom 8, 14-17.
Ev Mt 28, 16-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
Ss. Caroli Lwanga et soc. Mm. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1976. Fiesole. Fr. Alberto M. Cagnoni, presb., a. 68, r. 48.
1992. Vicenza. Fr. Adriano M. Zini, presb., a. 72, r. 54.
2010. Firenze. Fr. Pietro M. Papini, presb., a. 87, r. 68.
4. Vir. Feria II hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Petr 1, 2-7; Ps 90, 1-2. 14-15ab. 15c-16.
Ev Mc 12, 1-12.
ANNIVERSARIA
1993. Firenze. Fr. Paolo M. Cianferoni, a. 84, r. 45.
1998. Roma. Fr. Jean-M. Delepouve, presb., a. 75, r. 51.
5. Rub. Feria III hebd. IX per annum (I Psalt.).
S. Bonifatii E. M., memoria.
140
TEMPUS PER ANNUM
MISSA memoriae.
L 1 2 Petr 3, 12-15a. 17-18; Ps 89, 2. 3-4. 10. 14 et 16.
Ev Mc 12, 13-17.
1997.
2001.
2007.
2011.
ANNIVERSARIA
Portland. Fr. Kevin M. Fitzpatrick, presb., a. 69, r. 48.
Firenze. Fr. Edoardo M. Balloni, presb., a. 80, r. 60.
São Paulo. Fr. Mario M. Scuppa, presb., a. 76, r. 59.
Firenze. Fr. Eugenio M. Casalini, presb., a. 88, r. 70.
6. Alb. Feria IV hebd. IX per annum (I Psalt.).
De ea. Vel:
Alb. S. Norberti E.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 1, 1-3. 6-12; Ps 122, 1-2a. 2bcd.
Ev Mc 12, 18-27.
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1987. Bolzano. Fr. Angelo M. Pedot, presb., a. 76, r. 58.
7. Alb. Feria V. SS. CORPORIS ET SANGUINIS
CHRISTI, sollemnitas. Missa et Off. in fine Pr. de
Tempore exstant. Ad H. m. ant. pr. cum psalmodia
complementari.
© MISSA pr., Gloria, sequentia ad libitum, Credo, pf.
Euch.
L 1 Ex 24, 3-8; Ps 115, 12-13. 15 et 16bc. 17-18.
L 2 Hebr 9, 11-15.
Ev Mc 14, 12-16. 22-26.
IUNIUS 2012
141
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
Ubi sollemnitas Ss.mi Corporis et Sanguinis Christi trans-
fertur in dominicam sequentem:
6. Vir. VESPERAE de feria.
7. Vir. Feria V hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 2, 8-15; Ps 24, 4bc-5ab. 8-9. 10 et 14.
Ev Mc 12, 28b-34.
ANNIVERSARIA
1990. Roma. Fr. Salvatore M. Meo, presb., a. 62, r. 46.
8. Alb. Feria VI hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 3, 10-17; Ps 118, 157. 160. 161. 165. 166.
168.
Ev Mc 12, 35-37.
ANNIVERSARIA
1983. Torino. Fr. Alfonso M. Rossi, presb., a. 65, r. 46.
2009. Las Toscas. Fr. Roberto M. Braida, presb., a. 69, r. 42.
2009. Napoli. Fr. Agostino M. Sommese, presb., a. 95, r. 77.
142
TEMPUS PER ANNUM
9. Alb. Sabb. hebd. IX per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 2 Tim 4, 1-8; Ps 70, 8-9. 14-15ab. 16-17. 22.
Ev Mc 12, 38-44.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 23: Beata Maria Virgo, templum Domini.
IUNIUS 2012
143
10. Vir. DOM. X PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Gen 3, 9-15; Ps 129, 1-2. 3-4ab. 4c-6. .7-8.
L 2 2 Cor 4, 13 – 5, 1.
Ev Mc 3, 20-35.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
S. Ephraem Diac. D. memoria omittitur.
I VESPERAE dominicae. – Cp. post I Vp. dom.
In Provincia Insularum:
9. Alb. Sabb. S. COLUMBANI A., PROVINCIAE INSULA-
RUM PATRONI, festum. – Ad H. m. ant. et pss. sabbati
hebd. I.
MISSA pr., Gloria, lect. pr., pf. de sancto.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE seq. – Cp. post I Vp. dom.
ANNIVERSARIA
1962. Forlì. Fr. Cleto M. Zamboni, presb., a. 59, r. 34.
1964. Forchtenau. Fr. Heinrich M. Pielenhofer, presb., a. 89,
r. 54.
1968. Roma. Ep. Antonio M. Michelato, a. 59, r. 40.
1983. Genova. Fr. Amadio M. Landucci, a. 71, r. 50.
Ubi sollemnitas Ss.mi Corporis et Sanguinis Christi non
est de praecepto servanda, assignatur huic dominicae tam-
quam diei proprio:
9. Alb. I VESPERAE soll. – Cp. post I Vp. dom.
10. Alb. Dom. SS. CORPORIS ET SANGUINIS CHRISTI,
sollemnitas. Missa et Off. in fine Pr. de Tempore exstant.
Ad H. m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, sequentia ad libitum, Credo, pf. Euch.
L 1 Ex 24, 3-8; Ps 115, 12-13. 15 et 16bc. 17-18.
L 2 Hebr 9, 11-15.
Ev Mc 14, 12-16. 22-26.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
144
TEMPUS PER ANNUM
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Servants of Mary
(London) tamquam Diem Congregationis hanc diem
celebrat, qua anno 1840, in pago Cuves (Gallia),
Maria Guyot (1821-1849), pia iuvenis, cum duobus
sociis «habitum religiosum» sumendo, Congrega-
tionis fundamenta iecerunt. Anno 1864 die 18 iunii
Congregatio Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Litur-
giae Horarum necnon Sacrificii eucharistici frater-
nas Deo effundant preces pro bono et incremento
Congregationis.
1971.
1974.
1988.
2006.
ANNIVERSARIA
Monte Senario. Fr. Raffaello M. Taucci, presb., a. 88, r. 70.
Nepi. Fr. Giovanni M. Minnucci, a. 81, r. 51.
Alvignano. Fr. Salvatore M. Mazzocca, presb., a. 55, r. 37.
Monte Senario. Fr. Roberto M. Salvetti, a. 85, r. 66.
11. Rub. Feria II hebd. X per annum (II Psalt.).
S. Barnabae Ap., memoria.
MISSA memoriae, lect. pr., pf. pr.
L 1 Act 11, 21b-26; 13, 1-3; Ps 97, 1. 2-3ab. 3c-4. 5. 6.
Ev Mt 10, 7-13.
ANNIVERSARIA
1961. Cuneo. Fr. Michelangelo M. Enrici, presb., a. 75, r. 59.
1982. Vecs. Fr. Jenö M. Tóth, presb., a. 65, r. 44.
1999. Negrar. Fr. Antonio M. Rizzi, presb., a. 93, r. 72.
IUNIUS 2012
145
12. Vir. Feria III hebd. X per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 17, 7-16; Ps 4, 2-3. 4-5. 7-8.
Ev Mt 5, 13-16.
ANNIVERSARIA
1994. Negrar. Fr. Paolo M. Brunello, presb., a. 72, r. 54.
1996. Firenze. Fr. Leonardo M. Valdisserra, presb., a. 81, r. 63.
13. Alb. Feria IV hebd. X per annum (II Psalt.).
S. Antonii de Padova P. D., memoria.
MISSA memoriae.
L 1 1 Reg 18, 20-39; Ps 15, 1-2a. 4. 5 et 8. 11.
Ev Mt 5, 17-19.
ANNIVERSARIA
1961. Venezia. Fr. Luigi M. Crippa, presb., a. 73, r. 56.
1987. Chicago. Fr. Joseph M. Loftus, presb., a. 65, r. 45.
14. Vir. Feria V hebd. X per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 18, 41-46; Ps 64, 10abcd. 10e-11. 12-13.
Ev Mt 5, 20-26.
I VESPERAE soll. Ss.mi Cordis Iesu – Cp. post I Vp.
dom.
ANNIVERSARIA
1973. Monte Senario. Fr. Filippo M. Bugnini, a. 64, r. 45.
1981. Venezia. Fr. Michele M. Selmo, presb., a. 76, r. 54.
146
TEMPUS PER ANNUM
IUNIUS 2012
147
15. Alb. Feria VI. SS. CORDIS IESU, sollemnitas. MISSA matutina memoriae, lect. pr., pf. B. Mariae V.
Missa et Off. in fine Pr. de Tempore exstant. – Ad H.
m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, Credo, pf. pr. Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 28: Cor immaculatum beatae Mariae
Virginis.
L 1 Os 11, 1. 3-4. 8c-9; Ps Is 12, 2-3. 4bcd. 5-6.
L 2 Eph 3, 8-12. 14-19.
Ev Io 19, 31-37.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. Ss.mi Cordis Iesu – Cp. post II Vp.
dom.
ANNIVERSARIA
1987. Roma. Fr. Gesualdo M. D’Errico, presb., a. 64, r. 39.
2008. Morelia (Michoacán). Fr. Cristián M. Monjaraz Navarrete,
presb., a. 36, r. 16.
TRIDUUM
S. IULIANÆ FALCONIERI
Diebus 16-17-18 iunii in omnibus ecclesiis Ser-
vorum Familiæ dicantur oportet preces ut fratres
omnesque sodales disponantur ad festum S. Iulianæ
Falconieri digne celebrandum. Ad hoc opportune adhibebitur
subsidium cui est titulus In lode di santa Giuliana di Firenze
vel In praise of saint Juliana of Florence vel À la louange de sainte
Julienne de Florence vel En honor de Santa Juliana de Florencia.
16. Alb. Sabb. hebd. X per annum (II Psalt.).
Immaculati Cordis B. Mariae V., memoria.
L 1 Is 61, 9-11; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Lc 2, 41-51.
I VESPERAE dom. – Cp. post I Vp. dom.
DIES CONGREGATIONIS
Congregatio Sororum, a Servo Dei Jean-François
Régis Barthès (1790-1861) condita, cui est titulus
Soeurs de Notre-Dame de la Compassion tamquam
Diem Congregationis hanc diem celebrat qua, anno
1845, primae sorores a sancto Eugenio de Mazenod
(1782-1861), episcopo Massiliensi, habitum religio-
nis ceperunt. Anno 1992 die 7 iunii Congregatio
Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Laudum
et Vesperarum necnon Sacrificii eucharistici grates
Deo et Beatae Mariae Virgini rependant et fraternas
effundant preces pro Congregationis bono atque
incremento.
ANNIVERSARIA
1963. Aysén. Ep. Gerardo M. Vielmo, a. 49, r. 30.
17. Vir. DOM. XI PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
148
149
TEMPUS PER ANNUM IUNIUS 2012
L 1 Ez 17, 22-24; Ps 91, 2-3. 13-14. 15-16. 19. Alb. Feria III. S. M. IULIANAE FALCONIERI,
L 2 2 Cor 5, 6-10. VIRG. O. N., festum. – Ad H. m. ant. et pss. feriae
Ev Mc 4, 26-34. III hebd. III.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom. L 1 1 Cor 7, 25-28. 32-35 vel Apoc 21, 1-5a;
Ps 62, 2. 3-4. 5-6. 7-9.
Ev Mt 25, 1-13 vel Mt 13, 44-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Romualdi A. memoria omittitur.
DIES CONGREGATIONIS
Congregatio sororum cui est titulus Servas de Maria
do Brasil, hanc diem qua, anno 1917, «Madre Cecilia»
(†1945) Instituti fundamenta iecit, tamquam Diem
Congregationis celebrat. Anno 1922 die 2 maii Con-
gregatio Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Laudum
et Vesperarum necnon Sacrificii eucharistici grates
Deo et Beatae Mariae Virgini rependant et fraternas
effundant preces pro Congregationis bono atque
incremento.
ANNIVERSARIA
1982. Firenze. Fr. Ludovico M. Langianni, presb., a. 89, r. 72.
1987. Marshfield. Fr. Matthew M. Shekleton, presb., a. 71, r. 52.
18. Vir. Feria II hebd. XI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 21, 1-16; Ps 5, 2-3. 5-6. 7.
Ev Mt 5, 38-42.
ANNIVERSARIA
1964. Chicago. Fr. Bonifaz M. Efferenn, presb., a. 85, r. 65.
1984. Firenze. Fr. Giovanni M. Vannucci, presb., a. 70, r. 53.
MISSA pr., Gloria, pf. pr.
Pro Monialibus et Sororibus O.N.:
18. I VESPERAE soll. – Cp. post I Vp. dom.
19. Alb. Feria III. S. M. IULIANAE FALCONIERI VIRG.
O.N., sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Cant 3, 1-4a; 8, 6-7; Ps 62, 2. 3-4. 5-6. 7-9.
L 2 1 Cor 7, 25-28. 32-35 vel Apoc 21, 1-5a.
Ev Mt 25, 1-13 vel Mt 13, 44-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Nové Hrady. Fr. Raymund M. Chalupa, presb., a. 66, r. 48.
1986. Kötschach. Fr. Erhard M. Hohenwarter, presb., a. 75, r. 57.
150
TEMPUS PER ANNUM
1987. Ottawa. Fr. Paul M. Desrochers, presb., a. 61, r. 40.
1997. Dorsten. Fr. Bernhard M. Alpers, presb., a. 60, r. 33.
2004. Chicago. Fr. Andrew M. Motsko, a. 80, r. 51.
20. Vir. Feria IV hebd. XI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 2, 1. 6-14; Ps 30, 20. 21. 24.
Ev Mt 6, 1-6. 16-18.
1977.
1984.
1986.
1987.
ANNIVERSARIA
Innsbruck. Fr. Ubald M. Ihrenberger, a. 96, r. 71.
Vicenza. Fr. Venanzio M. Milani, presb., a. 62, r. 42.
Montréal. Fr. Gabriel M. Lussier, presb., a. 79, r. 61.
Fullerton. Fr. Bonfilius M. Zens, a. 74, r. 44.
21. Alb. Feria V hebd. XI per annum (III Psalt.).
S. Aloisii Gonzaga Rel., memoria.
MISSA memoriae.
L 1 Sir 48, 1-15 (gr. 1-14); Ps 96, 1-2. 3-4. 5-6. 7.
Ev Mt 6, 7-15.
1985.
1993.
2000.
2002.
2005.
2010.
ANNIVERSARIA
Montréal. Fr. Philippe M. Forgues, presb., a. 78, r. 60.
Jesi. Fr. Carlo M. Zucchini, presb., a. 81, r. 64.
Orange. Fr. Gerard M. Calkins, presb., a. 81, r. 61.
Forlì. Fr. Girolamo M. Bellagamba, a. 82, r. 62.
Saviano. Fr. Raffaele M. Montanino, presb., a. 81, r. 63.
Piggs Peak. Fr. Stefano M. Papini, presb., a. 90, r. 72.
IUNIUS 2012
151
22. Vir. Feria VI hebd. XI per annum (III Psalt.).
De ea. Vel:
Alb. S. Paulini Nolani E. Vel:
Rub. Ss. Ioannis Fisher E. et Thomae More Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 11, 1-4. 9-18.20; Ps 131, 11. 12. 13-14. 17-18.
Ev Mt 6, 19-23.
ANNIVERSARIA
1997. Roma. Fr. Paolo M. Valente, a. 89, r. 60.
IUNIUS 2012
CL
ANNUS AB OBITU
BEATI FERDINANDI MARIAE BACCILIERI, PRESBYTERI,
TERTII ORDINIS SERVORUM MARIAE SODALIS
153
23. Alb. Sabb. hebd. XI per annum (III Psalt.).
De S. Maria in sabb. memoria.
MISSA memoriae.
L 1 2 Chron 24, 17-25; Ps 88, 4-5. 29-30. 31-32. 33-34.
Ev Mt 6, 24-34.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 22: Sancta Maria, ancilla Domini.
IN NATIVITATE S. IOANNIS BAPT., sollemnitas.
Anno 1862, die 23 iunii, in oppido Galeazza Pepoli, dioeceseos Bono-
niensis, obiit Beatus Ferdinandus Maria Baccilieri, parochus eiusdem
oppidi, qui fundamenta iecit Congregationis Servarum Mariae a Galeazza,
una cum piis iuvenibus M. Iiuliana Busi (1824-1891) [priora], M. Aloysia
Busi (1841-1896) et M. Rosa Gallerani (1836-1909). Congregatio proba-
ta est a dioeceseos episcopo die 21 novembris 1899 et a Sede Apostolica
die 19 maii 1939 et die 21 ianuarii 1947.
Il 23 giugno 1862, a Galeazza Pepoli, diocesi di Bologna, morì il beato
Ferdinando Maria Baccilieri, parroco di quella cittadina, fondatore insie-
me con le giovani M. Giuliana Busi (1824-1891) [priora], M. Luigia Busi
(1841-1896) e M. Rosa Gallerani (1836-1909), della Congregazione delle
Serve di Maria di Galeazza. Tale Congregazione ebbe l’approvazione dio-
cesana il 21 novembre 1899 e l’approvazione della Sede Apostolica il 19
maggio 1939 e il 21 gennaio 1947.
On 23 June 1862, at Galeazza Pepoli, Diocese of Bologna, Blessed
Ferdinando Maria Baccilieri died. He was the pastor of that town and foun-
der of the Congregation of Sister Servants of Mary of Galeazza, together
with the young M. Giuliana Busi (1824-1891) [prioress], M. Luigia Busi
(1841-1896) and M. Rosa Gallerani (1836-1909). The Congregation recei-
ved diocesan approval on 21 November 1899 and the approval of the Holy
See on 19 May, 1939 and 21 January 1947.
23. Alb. Sabb., vespere. – In Vigilia: MISSA VIGILIAE pr.,
Gloria, Credo, pf. pr.
L 1 Ier 1, 4-10; Ps 70, 1-2. 3-4a. 5-6ab. 15ab et 17.
L 2 1 Petr 1, 8-12.
Ev Lc 1, 5-17.
Ad Missam vigiliae et soll. adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
24. Alb. Dom. IN NATIVITATE S. IOANNIS BAPT.,
sollemnitas – Officium proprium. – Ad H. m. ant. pr.
cum psalm. complementari.
MISSA IN DIE pr., Gloria, Credo, pf. pr.
L 1 Is 49, 1-6; Ps 138, 1-3. 13-14ab. 14c-15.
L 2 Act 13, 22-26.
Ev Lc 1, 57-66. 80.
154
TEMPUS PER ANNUM
Prohibentur aliae celebrationes, excepta Missa exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
IUNIUS 2012
155
26. Vir. Feria III hebd. XII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria di
Galeazza, hanc diem qua, anno 1862, a beato Ferdi-
nando Baccilieri (1821-1893) est condita, tamquam
Diem Congregationis celebrat. Anno 1932 die 8 dicem-
bris Congregatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici, grates Deo et beatae Mariae Virgini rependen-
tes, enixas effundant preces pro Instituti bono atque
incremento.
ANNIVERSARIA
1973. Luggau. Fr. Gabriel M. Weisskopf, presb., a. 87, r. 69.
1976. Santiago de Chile. Fr. Luis M. Villalobos Román, a. 24,
r. 2.
1997. Anaheim. Fr. Timothy M. Culhane, a. 86, r. 60.
25. Vir. Feria II hebd. XII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 17, 5-8. 13-15a. 18; Ps 59, 3. 4-5. 12-13.
Ev Mt 7, 1-5.
ANNIVERSARIA
1981. Palermo. Fr. Gerardo M. Caligiore, presb., a. 68, r. 50.
1986. Conegliano. Fr. Clemente M. Francescon, presb., a. 73, r. 57.
L 1 2 Reg 19, 9b-11. 14-21. 31-35a. 36;
Ps 47, 2-3a. 3b-4. 10-11.
Ev Mt 7, 6. 12-14.
ANNIVERSARIA
1993. Madrid. Fr. Lorenzo M. Maeso Avila, a. 80, r. 39.
27. Vir. Feria IV hebd. XII per annum (IV Psalt.).
De ea. Vel:
Alb. B. Thomae de Urbe Vetere, religiosi O.N. Vel:
Alb. S. Cyrilli Alexandrini E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 22, 8-13; 23, 1-3; Ps 118, 33. 34. 35. 36. 37. 40.
Ev Mt 7, 15-20.
1969.
1971.
1980.
1982.
2009.
ANNIVERSARIA
Innsbruck. Fr. Justin M. Walser, presb., a. 80, r. 35.
London. Fr. Ambrose M. Castleton, presb., a. 54, r. 34.
Pistoia. Fr. Filippo M. Parretti, presb., a. 63, r. 42.
Montréal. Fr. Alessandro M. Pini, presb., a. 66, r. 48.
Negrar. Fr. Luigi M. Zonta, a. 87, r. 68.
28. Rub. Feria V hebd. XII per annum (IV Psalt.).
S. Irenaei E. M., memoria.
MISSA matutina memoriae.
L 1 2 Reg 24, 8-17; Ps 78, 1-2. 3-5. 8. 9.
Ev Mt 7, 21-29.
156
TEMPUS PER ANNUM
SS. PETRI ET PAULI APP., sollemnitas.
28. Rub. Feria V, vespere. – Ubi soll. Apostolorum est de
praecepto servanda, dicitur MISSA VIGILIAE pr.,
Gloria, Credo, pf. pr.
L 1 Act 3, 1-10; Ps 18, 2-3. 4-5.
L 2 Gal 1, 11-20.
Ev Io 21, 15-19.
Ad Missam vigiliae et diei adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
1985.
1996.
1999.
2002.
ANNIVERSARIA
Perugia. Fr. Ildefonso M. Bartolini, presb., a. 69, r. 53.
Rovato. Fr. Angelo M. Dal Maso, a. 69, r. 44.
Siracusa. Fr. Paolo M. Pasqua, presb., a. 75, r. 56.
Firenze. Fr. Angelo M. Conti, presb., a. 77, r. 57.
29. Rub. Feria VI. – Officium proprium – Ad H. m. ant.
pr. cum psalmodia complementari.
© MISSA IN DIE pr., Gloria, Credo, pf. pr.
L 1 Act 12, 1-11; Ps 33, 2-3. 4-5. 6-7. 8-9.
L 2 2 Tim 4, 6-8. 17-18.
Ev Mt 16, 13-19.
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
IUNIUS 2012
157
ANNIVERSARIA
1962. Budrio. Fr. Amadio M. Tinti, presb., a. 80, r. 63.
1990. Reggio Emilia. Fr. Raffaele M. Baldi, presb., a. 69, r. 51.
2007. Siracusa. Fr. Carlo M. Ramondetta, presb., a. 77, r. 55.
30. Alb. Sabb. hebd. XII per annum (IV Psalt.).
De S. Maria in sabb. memoria.
MISSA memoriae.
L 1 Lam 2, 2. 10-14. 18-19; Ps 73, 1-2. 3-5a. 5b-7. 20-21.
Ev Mt 8, 5-17.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 35: Beata Maria Virgo, fidei praesidium.
Ss. Protomartyrum S. Romanae Ecclesiae memoria omit-
titur.
I VESPERAE dom. – Cp. post I Vp. dom.
Pro sororibus vulgo nuncupatis «Serve di Maria di Galeazza»:
30. Alb. Sabb. B. FERDINANDI M. BACCILIERI, PRES-
BYTERI OSSM, FUNDATORIS CONGREGATIONIS
SERVARUM MARIAE VIRGINIS A GALEAZZA, fes-
tum. – Ad H. m. ant. et pss. sabbati hebd. IV.
MISSA pr., Gloria, lect. pr., pf. de beato.
L 1 1 Thes 2, 2b-8; Ps 23, 1-2. 3-4ab. 5-6.
Ev Mt 23, 8-12 vel Io 10, 11-16.
158
TEMPUS PER ANNUM
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1971. Ancona. Fr. Anselmo M. Voltolina, presb., a. 31, r. 12.
1976. Reggio Emilia. Fr. Giovanni M. Zamboni, presb., a. 61,
r. 4.
1978. Mboluzi (Manzini). Fr. Gabriele M. Signori, a. 83, r. 58.
IULIUS 2012
1. Vir. DOM. XIII PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Sap 1, 13-15; 2, 23-24; Ps 29, 2 et 4. 5-6. 11 et 12a
et 13b.
L 2 2 Cor 8, 7. 9. 13-15.
Ev Mc 5, 21-43 vel 5, 21-24. 35b-43.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
B. Ferdinandi M. Baccilieri presbyteri OSSM, Fundatoris
Congregationis Servarum Mariae Virginis a Galeazza,
memoria omittitur.
1972.
1974.
1987.
1995.
ANNIVERSARIA
Mátraháza. Fr. Rafael M. Jáger, presb., a. 71, r. 50.
Roma. Fr. Francesco M. Agostini, presb., a. 70, r. 52.
Chicago. Fr. John M. Wondrasek, presb., a. 74, r. 53.
Chicago. Fr. Thomas M. Calkins, presb., a. 72, r. 51.
2. Vir. Feria II hebd. XIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 2, 6-10. 13-16; Ps 49, 16bc-17. 18-19. 20-21.
22-23.
Ev Mt 8, 18-22.
160
1966.
1968.
1983.
1992.
TEMPUS PER ANNUM
ANNIVERSARIA
Manzini. Fr. Antonino M. Agostinelli, a. 83, r. 55.
Saint-Ortaire. Fr. Hildebrand M. Grannec, presb., a. 80,
r. 58.
Denver. Fr. Julius M. Porcellini, presb., a. 83, r. 63.
Roma. Fr. Giacinto M. Verna, presb., a. 78, r. 58.
3. Rub. Feria III. S. THOMAE AP., festum. – Ad H. m.
ant. et pss. feriae III hebd. I.
MISSA pr., Gloria, pf. App.
L 1 Eph 2, 19-22; Ps 116, 1. 2.
Ev Io 20, 24-29.
In India:
2. I VESPERAE seq. soll. – Cp. post I Vp. dom.
3. Rub. Feria III. S. THOMAE AP., PATRONI PRINCIPA-
LIS, sollemnitas. – Ad H. m. ant. pr. cum psalmodia com-
plementari.
MISSA pr., Gloria, Credo, lect. pr., pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Spa. Fr. Augustin M. Lépicier, presb., a. 82, r. 66.
2000. Carrara. Fr. Carlo M. Dell’Unto, a. 88, r. 70.
IULIUS 2012
161
4. Vir. Feria IV hebd. XIII per annum (I Psalt.).
De ea. Vel:
Alb. B. Ubaldi de Burgo Sancti Sepulcri, presbyteri
O.N. Vel:
Alb. S. Elisabeth Lusitaniae.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 5, 14-15. 21-24; Ps 49, 7. 8-9. 10-11. 12-13.
16bc-17.
Ev Mt 8, 28-34.
ANNIVERSARIA
1977. Kiralyhegyes. Fr. Gábor M. Takács, presb., a. 64, r. 40.
1983. London. Fr. Alexis M. Mullens, presb., a. 71, r. 53.
2002. Verona. Fr. Giuseppe M. Epis, presb., a. 67, r. 40.
5. Vir. Feria V hebd. XIII per annum (I Psalt.).
De ea. Vel:
Alb. S. Antonii M. Zaccaria P.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 7, 10-17; Ps 18, 8. 9. 10. 11.
Ev Mt 9, 1-8.
ANNIVERSARIA
1981. Santiago de Chile. Fr. Severino M. Bernardis, presb., a. 68,
r. 47.
1983. Todi. Fr. Pacifico M. Felici, presb., a. 64, r. 46.
1991. Kersal. Fr. John Angel M. Fletcher, presb., a. 87, r. 68.
6. Vir. Feria VI hebd. XIII per annum (I Psalt.).
De ea. Vel:
Rub. S. Mariae Goretti V. M.
162
TEMPUS PER ANNUM
IULIUS 2012
MISSA ad libitum (cf. p. XVIII). Prohibentur Missae defunctorum, excepta exsequiali.
L 1 Am 8, 4-6. 9-12; Ps 118, 2. 10. 20. 30. 40. 131.
Ev Mt 9, 9-13.
163
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1969. Ponhalma. Fr. Amideus M. Alyusik, a. 74, r. 36.
1974. Milano. Fr. Pio M. Della Pietra, presb., a. 84, r. 48.
7. Alb. Sabb. hebd. XIII per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Am 9, 11-15; Ps 84, 9. 11-12. 13-14.
Ev Mt 9, 14-17.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 34: Beata Maria Virgo, causa nostrae laetitiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1980. Torino. Fr. Alberto M. Ferrero, presb., a. 68, r. 51.
1986. Firenze. Fr. Tommaso M. Banci, presb., a. 74, r. 55.
1986. Vicenza. Fr. Alfredo M. Segafredo, presb., a. 74, r. 57.
8. Vir. DOM. XIV PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ez 2, 2-5; Ps 122, 1-2a. 2bcd. 3-4.
L 2 2 Cor 12, 7-10.
Ev Mc 6, 1-6.
ANNIVERSARIA
1980. Vicenza. Fr. Angelo M. Menon, a. 70, r. 52.
1980. Mbabane. Fr. Joseph M. Perkins, presb., a. 68, r. 15.
2003. Massa Carrara. Fr. Eliseo M. Ferraretto, a. 70, r. 50.
9. Vir. Feria II hebd. XIV per annum (II Psalt.).
De ea. Vel:
Rub. Ss. Augustini Zhao Rong P. et soc. Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 2, 16. 17b-18. 21-22; Ps 144, 2-3. 4-5. 6-7. 8-9.
Ev Mt 9, 18-26.
In Columbia:
9. Alb. Feria II. B. MARIAE V. A ROSARIO DE CHIQUIN-
QUIRÁ, COLUMBIAE PATRONAE, festum. – Ad H. m.
ant. et pss. feriae II hebd. II.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE seq. – Cp. post I Vp. dom.
Ss. Augustini Zhao Rong P. et soc. Mm. memoria omittitur.
ANNIVERSARIA
1998. Benoni. Fr. Michele M. Signori, presb., a. 72, r. 52.
164
TEMPUS PER ANNUM
10. Vir. Feria III hebd. XIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 8, 4-7. 11-13; Ps 113B, 3-4. 5-6. 7ab-8. 9-10.
Ev Mt 9, 32-38.
ANNIVERSARIA
1970. Roma. Fr. Lorenzo M. Orlandi, presb., a. 67, r. 38.
1979. Verona. Fr. Stanislao M. Zanetti, presb., a. 64, r. 46.
1983. Avellaneda. Fr. Girolamo M. Meneghini, presb., a. 69, r. 50.
1984. Portland. Fr. Victor M. Grabrian, presb., a. 76, r. 50.
1995. Perugia. Fr. Antonio M. Contardi, presb., a. 83, r. 66.
2004. El Paso. Fr. Francesco M. De Tomasi, presb., a. 76, r. 58.
11. Alb. Feria IV hebd. XIV per annum (II Psalt.).
S. Benedicti A., memoria.
MISSA memoriae.
L 1 Os 10, 1-3. 7-8. 12; Ps 104, 2-3. 4-5. 6-7.
Ev Mt 10, 1-7.
In Europa:
11. Alb. Feria IV. S. BENEDICTI A. ET EUROPAE PATRONI,
festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA festi, Gloria, lect. pr., pf. de sancto.
L 1 Prov 2, 1-9; Ps 33, 2-3. 4-5. 6-7. 8-9. 10-11.
Ev Mt 19, 27-29.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
IULIUS 2012
165
ANNIVERSARIA
1967. Montevideo. Fr. Augusto M. Pierasco, a. 48, r. 29.
1967. Firenze. Fr. Sergio M. Cerroni, presb., a. 34, r. 15.
12. Vir. Feria V hebd. XIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 11, 1-4. 8c-9; Ps 79, 2ac et 3b. 15-16.
Ev Mt 10, 7-15.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Riparatrici hanc diem qua, anno 1900, Serva Dei M.
Elisa Andreoli (1861-1935) una cum Matre ac duo-
bus sociis Instituti fundamenta iecit, tamquam Diem
Congregationis celebrat. Anno 1910 die 19 ianuarii
Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae cum in litur-
gicis tum in privatis orationibus dignas Deo et glo-
riosae Virgini grates referant et pro bono atque incre-
mento Congregationis fraternas effundant preces.
ANNIVERSARIA
1987. Perugia. Fr. Pellegrino M. Rocchi, a. 74, r. 54.
1999. Negrar. Fr. Carlo M. Calvillo, presb., a. 82, r. 64.
13. Alb. Feria VI hebd. XIV per annum (II Psalt.).
S. Cleliae Barbieri V., Fundatricis Minimarum B.
Mariae V. Perdolentis, memoria.
166
TEMPUS PER ANNUM
MISSA memoriae.
CCL
ANNUS A TITULO PROTECTORIS OPPIDI FAVENTIAE
B. IACOBO PHILIPPO BERTONI TRIBUTO
L 1 Os 14, 2-10; Ps 50, 3-4. 8-9. 12-13. 14 et 17.
Ev Mt 10, 16-23.
S. Henrici memoria omittitur.
Pro sororibus Minimis B. Mariae V. Perdolentis:
12. I VESPERAE soll. – Cp. post I Vp. dom.
13. Alb. Feria VI. S. CLELIAE BARBIERI VIRG., FUNDA-
TRICIS SORORUM MINIMARUM B. MARIAE V.
PERDOLENTIS, sollemnitas. – Ad H. m. pr. cum psalmo-
dia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Ct 8, 6-7; Ps 32, 12-13. 18-19. 20-21.
L 2 1 Cor 1, 26-31.
Ev Mt 11, 25-30.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Henrici memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1966. Viareggio. Fr. Giuliano M. Bernardi, presb., a. 55, r. 33.
1975. Innsbruck. Fr. Hermann M. Auer, presb., a. 93, r. 72.
Die 14 iulii 1762 Consilium civitatis iussit adnumerari in protec-
toribus oppidi Faventiae Beatum Iacobum Philippum Bertoni
(+1483), Servum Mariae, presbyterum. cui ab obitus anno pecu-
liaris cultus tributus erat.
Il 14 luglio 1762 il Consiglio comunale stabilì di annoverare fra i
protettori della città di Faenza il beato Giacomo Filippo Bertoni
(+1483), servo di Maria, presbitero, a cui era stato tributato un
particolare culto subito dopo la morte.
On 14 July 1762 the city council decided to include Blessed
James Philip Bertoni (+1483) among the protectors of the city.
He was a Servant of Mary and priest to whom particular devotion
was afforded immediately after death.
168
TEMPUS PER ANNUM
14. Alb. Sabb. hebd. XIV per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Is 6, 1-8; Ps 92, 1ab. 1c-2. 5.
Ev Mt 10, 24-33.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 32: Beata Maria Virgo, mater et magistra
spiritalis.
S. Camilli de Lellis P. memoria omittitur.
I VESPERAE seq. – Cp. post I Vp. dom.
15. Vir. DOM. XV PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Am 7, 12-15; Ps 84, 9ab-10. 11-12. 13-14.
L 2 Eph 1, 3-14 (vel 1, 3-10).
Ev Mt 6, 7-13.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Bonaventurae E.D. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
2006. Orange. Fr. George M. Luznicky, presb., a. 77, r. 56.
16. Vir. Feria II hebd. XV per annum (III Psalt.).
De ea. Vel:
Alb. B. Mariae V. de Monte Carmelo.
IULIUS 2012
169
MISSA ad libitum (cf. p. XVIII).
L 1 Is 1, 10-17; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mt 10, 34 – 11, 1.
Vel, in Missa B. Mariae V. de Monte Carmelo:
L 1 Zac 2, 14-17;
Ps Lc 1, 46-47. 48-49. 50-51. 52-53. 54-55.
Ev Mt 12, 46-50.
In Chilia:
15. I VESPERAE seq. – Cp. post I Vp. dom.
16. Alb. Feria II. B. MARIAE V. DE MONTE CARMELO,
CHILIAE MATRIS ATQUE REGINAE, sollemnitas. –
Ad H. m. pr. cum psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1985. Firenze. Fr. Paolino M. Pezzini, a. 87, r. 62.
17. Vir. Feria III hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 7, 1-9; Ps 47, 2-3a. 3b-4. 5-6. 7-8.
Ev Mt 11, 20-24.
170
1967.
1995.
2002.
2008.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Stegi. Fr. Agostino M. Botta, presb., a. 65, r. 47.
Firenze. Fr. Lorenzo M. Perri, presb., a. 70, r. 50.
Verona. Fr. Antonio M. Crevattin, a. 87, r. 62.
Magog. Fr. Jacques M. Coderre, presb., a. 92, r. 72.
Magog. Fr. Columba M. McManus, presb., a. 75, r. 54.
18. Vir. Feria IV hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 10, 5-7. 13-16; Ps 93, 5-6. 7-8. 9-10. 14-15.
Ev Mt 11, 25-27.
ANNIVERSARIA
1982. Valmontone. Fr. Gaetano M. Del Brusco, presb., a. 82,
r. 62.
2004. Verona. Fr. Gabriele M. Rocca, presb., a. 83, r. 65.
19. Vir. Feria V hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 26, 7-9. 12. 16-19; Ps 101, 13-14ab et 15. 16-18.
19-21.
Ev Mt 11, 28-30.
1982.
1994.
1996.
1999.
Firenze.
Firenze.
Hillside.
Firenze.
ANNIVERSARIA
Fr. Alfonso M. Bottai, presb., a. 63, r. 46.
Fr. Francesco M. Banci, presb., a. 84, r. 66.
Fr. Martin M. Jenco, presb., a. 61, r. 42.
Fr. Giorgio M. Francini, presb., a. 78, r. 60.
IULIUS 2012
171
20. Vir. Feria VI hebd. XV per annum (III Psalt.).
De ea. Vel:
Rub. S. Apollinaris E. M.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 38, 1-6. 21-22. 7-8; Ps Is 38, 10. 11. 12abcd. 16.
Ev Mt 12, 1-8.
ANNIVERSARIA
1970. Johannesburg. Fr. Michael M. Ramsey, presb., a. 88, r. 45.
1970. Calgary. Fr. Tarcisio M. Hajdusik, presb., a. 56, r. 36.
1977. Volders. Fr. Plazidus M. Schulz, presb., a. 83, r. 61.
1982. Vicenza. Fr. Giuseppe M. Lovato, a. 70, r. 46.
1982. Vicenza. Fr. Gabriele M. Pigato, a. 68, r. 37.
1985. Albuquerque. Fr. John M. Castillo, presb., a. 72, r. 50.
21. Alb. Sabb. hebd. XV per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Mic 2, 1-5; Ps 9, 22-23. 24-25. 28-29. 35.
Ev Mt 12, 14-21.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 36: Beata Maria Virgo, mater pulchrae
dilectionis.
S. Laurentii de Brindisi P.D. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
172
1965.
1992.
1998.
2004.
2006.
TEMPUS PER ANNUM
ANNIVERSARIA
Graz. Fr. Karl M. Zangerle, presb., a. 72, r. 49.
Massa. Fr. Pellegrino M. Pieretti, presb., a. 72, r. 53.
Roma. Fr. Antonio M. Vinciguerra, presb., a. 72, r. 55.
Montréal. Ep. André M. Cimichella, a. 83, r. 64.
Maria Luggau. Fr. Franz M. Weiss, a. 72, r. 42.
22. Vir. DOM. XVIII PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ier 23, 1-6; Ps 22, 1-3a. 3b-4. 5. 6.
L 2 Eph 2, 13-18.
Ev Mc 6, 30-34.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Mariae Magdalenae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Tirano. Fr. Bonfiglio M. Mascioni, presb., a. 47, r. 29.
1987. Buenos Aires. Fr. Giuseppe M. Fogliatto, presb., a. 50, r. 30.
23. Vir. Feria II hebd. XVI per annum (IV Psalt.).
De ea. Vel:
Alb. S. Birgittae Rel.
MISSA ad libitum (cf. p. XVIII).
L 1 Mic 6, 1-4. 6-8; Ps 49, 5-6. 8-9. 16bc-17. 21 et 23.
Ev Mt 12, 38-42.
IULIUS 2012
173
In Europa:
23. Alb. Feria II. S. BIRGITTAE REL., EUROPAE PATRO-
NAE, festum. – Ad H. m. ant. et pss. feriae II hebd. IV.
MISSA festi, Gloria, lect. pr., pf. de sancta.
L 1 Gal 2, 19-20; Ps 33, 2-3. 4-5. 6-7. 8-9. 10-11.
Ev Io 15, 1-8.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1980. Alessandria. Fr. Leone M. Botta, presb., a. 80, r. 62.
24. Vir. Feria III hebd. XVIII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Sarbelii Makhlüf P.
MISSA ad libitum (cf. p. XVIII).
L 1 Mic 7, 14-15. 18-20; Ps 84, 2-4. 5-6. 7-8.
Ev Mt 12, 46-50.
ANNIVERSARIA
1961. Arco. Fr. Pietro M. Tuninetti, a. 45, r. 19.
2004. Santiago del Cile. Fr. Faustino M. Gazziero De Stefani,
presb., a. 69, r. 50.
2010. Bologna. Fr. Pellegrino M. Santucci, presb., a. 89, r. 72.
25. Rub. Feria IV. S. IACOBI AP., festum. – Ad H. m.
ant. et pss. feriae IV hebd. IV.
174
TEMPUS PER ANNUM
MISSA pr., Gloria, lect. pr., pf. App.
L 1 2 Cor 4, 7-15; Ps 125, 1-2ab. 2cd-3. 4-5. 6.
Ev Mt 20, 20-28.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
IULIUS 2012
175
In Missa de Ss. Ioachim et Anna:
L 1 Sir 44, 1. 10-15; Ps 131, 11. 13-14. 17-18.
Ev Mt 13, 16-17.
ANNIVERSARIA
1971. Graz. Fr. Blasius M. Walcher, a. 71, r. 39.
1990. Prata Sannita. Fr. Amadio M. Arcopinto, presb., a. 72, r. 53.
1996. Ottawa. Fr. Henri M. Gamache, presb., a. 75, r. 54.
In Hispania:
24. I VESPERAE soll. – Cp. post I Vp. dom.
25. Rub. Feria IV. S. IACOBI AP., PATRONI PRINCIPALIS
HISPANIAE, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Foligno. Fr. Anselmo M. Torelli, presb., a. 79, r. 63.
26. Alb. Feria V hebd. XVI per annum (IV Psalt.).
Ss. Ioachim et Annae, Parentum B. Mariae V.,
memoria.
MISSA memoriae.
L 1 Ier 2, 1-3. 7-8. 12-13; Ps 35, 6-7ab. 8-9. 10-11.
Ev Mt 13, 10-17.
27. Vir. Feria VI hebd. XVI per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 3, 14-17; Ps Ier 31, 10. 11-12ab. 13.
Ev Mt 13, 18-23.
ANNIVERSARIA
1961. Stegi. Fr. Luigi M. Da Meda, a. 79, r. 49.
28. Alb. Sabb. hebd. XVI per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Ier 7, 1-11; Ps 83, 3. 4. 5-6a et 8a-11.
Ev Mt 13, 24-30.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 20: Sancta Maria, mulier nova.
I VESPERAE dom. – Cp. post I Vp. dom.
176
1962.
1972.
2002.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Saluzzo. Fr. Luigi M. Triulzi, presb., a. 49, r. 32.
Genova. Fr. Luigi M. Pazzaglia, presb., a. 66, r. 46.
Denia. Fr. Clemente M. Payá Martí, presb., a. 71, r. 49.
Firenze. Fr. Marcello M. Pisanelli, presb., a. 87, r. 69.
29. Vir. DOM. XVII PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 2 Reg 4, 42-44; Ps 144, 10-11. 15-16. 17-18.
L 2 Eph 4, 1-6.
Ev Io 6, 1-15.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Marthae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. S. José dos Campos. Fr. Filippo M. Gallerani, presb., a. 86,
r. 70.
1977. Siteki. Fr. Elia M. Dal Magro, a. 72, r. 49.
2001. Denia. Fr. José M. Fernández Calvo, presb., a. 66, r. 46.
2009. Treviso. Fr. Costanzo M. Roncato, presb., a. 90, r. 72.
30. Vir. Feria II hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Petri Chrysologi E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 13, 1-11; Ps Deut 32, 18-19. 20. 21.
Ev Mt 13, 31-35.
IULIUS 2012
177
ANNIVERSARIA
1984. Roma. Fr. Luigi M. Bertini, presb., a. 61, r. 44.
31. Vir. Feria III hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Ignatii de Loyola P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 14, 17-22; Ps 78, 8. 9. 11 et 13.
Ev Mt 13, 36-43.
ANNIVERSARIA
1987. Pisa. Fr. Pio M. Signorini, presb., a. 76, r. 57.
1988. Negrar. Fr. Ildefonso M. Graziotto, presb., a. 75, r. 57.
1988. Roma. Fr. Tommaso M. Cimaroli, presb., a. 72, r. 56.
AUGUSTUS 2012
AUGUSTUS 2012
1. Alb. Feria IV hebd. XVII per annum (I Psalt.).
S. Alfonsi M. de’ Liguori E. D., memoria.
MISSA memoriae.
L 1 Ier 15, 10. 16-21; Ps 58, 2-3. 4-5a. 10-11. 17. 18.
Ev Mt 13, 44-46.
ANNIVERSARIA
1963. Firenze. Fr. Vincenzo M. Mancini, a. 85, r. 59.
1970. Todmorden. Fr. John Angel M. Fitzpatrick, a. 79, r. 7.
1998. Colorado Springs. Fr. Ralph Otto M. Jensen, presb., a. 79,
r. 58.
179
tica et oratione ad mentem Summi Pontificis. Huiusmodi
indulgentia semel tantum acquiri potest. Visitatio fieri
potest a meridie diei praecedentis usque ad mediam noctem
quae statutum diem claudit (Enchiridion indulgentiarum,
ed. 1999, concessio n. 33).
ANNIVERSARIA
1968. Detroit. Fr. Joseph M. Markey, presb., a. 76, r. 59.
2000. Marina di Carrara. Fr. Venanzio M. Giamperini, presb.,
a. 81, r. 62.
2004. Negrar. Fr. Filippo M. Mondin, presb., a. 87, r. 69.
3. Vir. Feria VI hebd. XVII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
2. Vir. Feria V hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Eusebii Vercellensis E. Vel:
Alb. S. Petri Iuliani Eymard P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 18, 1-6; Ps 145, 2abc. 2d-4. 5-6.
Ev Mt 13, 47-53.
Die 2 Augusti, vel alio die ab Ordinario statuendo in fide-
lium utilitatem, in basilicis minoribus, in sanctuariis et in
ecclesiis paroecialibus acquiri potest indulgentia plenaria
«Portiunculae». Opus praescriptum ad acquirendam huius-
modi indulgentiam est pia ecclesiae visitatio, in qua recitan-
tur oratio dominica et fidei symbolum (Pater et Credo),
additis sacramentali confessione, communione eucharis-
L 1 Ier 26, 1-9; Ps 68, 5. 8-10. 14.
Ev Mt 13, 54-58.
ANNIVERSARIA
1971. Ronzano. Fr. Lorenzo M. Falconi, presb., a. 59, r. 43.
1977. Pieve di Soligo. Fr. Gaetano M. Crivello, a. 69, r. 47.
2008. México. Fr. Lorenzo M. Arroyo Vargas, presb., a. 49, r. 28.
4. Alb. Sabb. hebd. XVII per annum (I Psalt.).
S. Ioannis Mariae Vianney P., memoria.
MISSA memoriae.
L 1 Ier 26, 11-16. 24; Ps 68, 15-16. 30-31. 33-34.
Ev Mt 14, 1-12.
180
TEMPUS PER ANNUM
Reposito vol. III, incip. vol. IV Liturgiae Horarum.
I VESPERAE dom. – Cp. post I Vp. dom.
1966.
1969.
1991.
1996.
1998.
1999.
ANNIVERSARIA
Arco. Fr. Pio M. Sartor, a. 61, r. 40.
Langegg. Fr. Alex M. Fahrnholz, presb., a. 88, r. 67.
Negrar. Fr. Anastasio Nunzio M. Bertossi, presb., a. 79,
r. 60.
Rio Branco. Fr. José M. Carneiro de Lima, presb., a. 84,
r. 65.
Chieri. Fr. Pietro M. Frua, presb., a. 70, r. 52.
Saviano. Fr. Antonino M. Mautone, presb., a. 67, r. 49.
5. Vir. DOM. XVIII PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ex 16, 2-4. 12-15; Ps 77, 3 et 4bc. 23-24. 25 et 54.
L 2 Eph 4, 17. 20-24.
Ev Io 6, 24-35.
Prohibentur Missae defunctorum, excepta exsequiali.
In Dedicatione basilicae S. Mariae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
Crastina die anniversarium recurret piae mortis Pauli Pp.
VI (1978).
ANNIVERSARIA
1962. Vicenza. Fr. Alfonso M. Sansigolo, presb., a. 71, r. 52.
1965. Pannonhalma. Fr. Bonfilius M. Laluk, presb., a. 67, r. 47.
AUGUSTUS 2012
1966.
1971.
1972.
1974.
2006.
2008.
181
Trieste. Fr. Alessio M. Piva, presb., a. 53, r. 33.
Viareggio. Fr. Alessio M. Pezzini, presb., a. 55, r. 36.
Oruro. Fr. Pablo M. Guarino, a. 39, r. 9.
Napoli. Fr. Filippo M. Micillo, presb., a. 91, r. 74.
Firenze. Fr. Filippo M. Tessari, a. 90, r. 71.
Chicago. Fr. Charles M. Brennan, presb., a. 87, r. 66.
6. Alb. Feria II. IN TRANSFIGURATIONE DOMINI,
festum. – Ad H. m. ant et pss. Feriae II hebd. II.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Dan 7, 9-10. 13-14 vel 2 Petr 1, 16-19;
Ps 96, 1-2. 5-6. 9.
Ev Mc 9, 2-10.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
1975.
1978.
1978.
1992.
ANNIVERSARIA
Detroit. Fr. Vincent M. Healy, presb., a. 86, r. 65.
Firenze. Fr. Antonio M. Cervelli, a. 83, r. 40.
Castelgandolfo. Pp. Paulus VI, a. 80. p. 15.
Wien. Fr. Theodor M. Mann, presb., a. 78, r. 60.
7. Vir. Feria III hebd. XVIII per annum (II Psalt.).
De ea. Vel:
Rub. Ss. Xisti II Pp. Soc. Mm. Vel:
Alb. S. Caietani P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 30, 1-2. 12-15. 18-22; Ps 101, 16-18. 19-21. 29
et 22-23.
Ev Mt 14, 22-36.
182
TEMPUS PER ANNUM
ANNIVERSARIA
1965. Weihenlinden. Fr. Franzicus Salesius M. Saier, presb., a. 82,
r. 61.
1973. Csatka. Fr. Károly M. Laták, a. 77, r. 35.
1988. Alençon. Fr. Augustin M. Brunon, presb., a. 74, r. 53.
8. Alb. Feria IV hebd. XVIII per annum (II Psalt.).
S. Dominici P., memoria.
MISSA memoriae.
L 1 Ier 31, 1-7; Ps Ier 31, 10. 11-12ab. 13.
Ev Mt 15, 21-28.
ANNIVERSARIA
1980. Rovato. Fr. Giuseppe M. Tosoni, a. 84, r. 57.
1982. São Paolo. Fr. Ugo M. Poli, presb., a. 74, r. 57.
2000. Manchester. Fr. Paul M. Knowles, presb., a. 83, r. 58.
9. Vir. Feria V hebd. XVIII per annum (II Psalt.).
De ea. Vel:
Rub. S. Teresiae Benedictae a Cruce V. M.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 31, 31-34; Ps 50, 12-13. 14-15. 18-19.
Ev Mt 16, 13-23.
In Europa:
9. Rub. Feria V. S. TERESIAE BENEDICTAE A CRUCE
(Edith Stein) V. M., EUROPAE PATRONAE, festum. –
Ad H. m. ant. et pss. feriae V hebd. II.
AUGUSTUS 2012
183
MISSA festi, Gloria, lect. pr., pf. de sancta.
L 1 Os 2, 16b. 17b. 21-22; Ps 44, 11-12. 14-15. 16-17.
Ev Mt 25, 1-13.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
10. Rub. Feria VI. S. LAURENTII DIAC. M., festum. –
Ad H. m. ant. et pss. feriae VI hebd. II.
MISSA pr., Gloria, lect. pr., pf. Martyrum.
L 1 2 Cor 9, 6-10; Ps 111, 1-2. 5-6. 7-8. 9.
Ev Io 12, 24-26.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
11. Alb. Sabb. hebd. XVIII per annum (II Psalt.).
S. Clarae V., memoria.
MISSA memoriae, pf. com. vel de sancta.
L 1 Hab 1, 12 – 2, 4; Ps 9, 8-9. 10-11. 12-13.
Ev Mt 17, 14-20.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1971. Portland. Fr. Ambrose M. Mayer, presb., a. 88, r. 69.
1999. Figline Valdarno. Fr. Enrico M. Gori, presb., a. 77, r. 61.
2008. Roma. Fr. Manetto M. Salvador, presb., a. 93, r. 72.
12. Vir. DOM. XIX PER ANNUM (Hebd. III Psalt.).
De ea.
184
TEMPUS PER ANNUM
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Reg 19, 4-8; Ps 33, 2-3. 4-5. 6-7. 8-9.
L 2 Eph 4, 30 – 5, 2.
Ev Io 6, 41-51.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Ioannae Franciscae de Chantal Rel. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1972.
1977.
1981.
1985.
2005.
ANNIVERSARIA
Vicenza. Fr. Romedio M. Zuecco, a. 50, r. 17.
Avellaneda. Fr. Gioacchino M. Bonaldo, presb., a. 67, r. 49.
Pómaz. Fr. Pal M. Szabó, a. 66, r. 46.
Firenze. Fr. Zanobi M. Luisi, a. 85, r. 51.
Vicenza. Fr. Egidio M. Merlo, presb., a. 75, r. 57.
13. Vir. Feria II hebd. XIX per annum (III Psalt.).
De ea. Vel:
Rub. Ss. Pontiani Pp. et Hippolyti P., Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 1, 2-5. 24-28c; Ps 148, 1-2. 11-12ab. 12c-14a.
14bcd.
Ev Mt 17, 22-27.
ANNIVERSARIA
1994. Saint-Vaast (Belgique). Fr. Josef M. Commandeur, presb.,
a. 71, r. 51.
14. Rub. Feria III hebd. XIX per annum (III Psalt.).
S. Maximiliani M. Kolbe P. M., memoria.
AUGUSTUS 2012
185
MISSA MATUTINA memoriae.
L 1 Ez 2, 8 – 3, 4; Ps 118, 14. 24. 72. 103. 111. 131.
Ev Mt 18, 1-5. 10. 12-14.
ANNIVERSARIA
1970. Ronzano. Fr. Michele M. Boni, a. 81, r. 31.
1973. Firenze. Fr. Amadio M. Serpi, presb., a. 73, r. 51.
1986. Orvieto. Fr. Vincenzo M. De Paolis, presb., a. 63, r. 45.
IN ASSUMPTIONE B. MARIAE V., sollemnitas.
14. Alb. Feria III, vespere. – IN VIGILIA: MISSA VIGILIAE,
Gloria, lect. pr., Credo, pf. pr.
L 1 1 Chron 15, 3-4. 15-16; 16, 1-2;
Ps 131, 6-7. 9-10. 13-14.
L 2 1 Cor 15, 54b-57.
Ev Lc 11, 27-28.
Ad Missam vigiliae et soll. adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
15. Alb. Feria IV – Officium proprium soll. – Ad H. m.
ant. pr. cum psalmodia complementari.
© MISSA IN DIE pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Apoc 11, 19a; 12, 1-6a. 10ab; Ps 44, 10bc. 11. 12ab.
16.
L 2 1 Cor 15, 20-27.
Ev Lc 1, 39-56.
186
TEMPUS PER ANNUM
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
AUGUSTUS 2012
187
16. Vir. Feria V hebd. XIX per annum (III Psalt.).
De ea. Vel:
Alb. S. Stephani Hungariae.
MISSA ad libitum (cf. p. XVIII).
In Gallia et in Africa Australi:
Sollemnitas ASSUMPTIONIS B. MARIAE V. celebratur
quoque ut patronae principalis totius Regionis.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
(Ravenna), hanc diem qua, anno 1852, venerabilis
presbyter Georgius Ghiselli (1815-1897) una cum
Margarita Zamara, pia iuvene, Instituti fundamenta
iecit, tamquam Diem Congregationis festive celebrat.
Anno 1926 die 24 aprilis Congregatio Ordini nostro
aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
gloriosae Virgini reddant atque pro fidelitate Con-
gregationis erga Spiritus Sancti donum ferventes
effundant preces.
1965.
1966.
1991.
2000.
ANNIVERSARIA
Meyerton. Fr. Cristoforo M. Tapparello, presb., a. 34, r. 15.
Torino. Fr. Luigi M. Zanetta, presb., a. 65, r. 47.
Alessandria. Fr. Tommaso M. Dente, a. 82, r. 57.
Napoli. Fr. Antonio M. Fedele, presb., a. 79, r. 46.
L 1 Ez 12, 1-12; Ps 77, 56-57. 58-59. 61-62.
Ev Mt 18, 21 – 19, 1.
1965.
1982.
1986.
1992.
2008.
ANNIVERSARIA
Arco. Fr. Tommaso M. Campagnolo, a. 84, r. 54.
Roma. Fr. Hilaire M. Morris, presb., a. 90, r. 72.
Milano. Fr. Mario M. Manganelli, presb., a. 65, r. 46.
Udine. Fr. Albino M. Candido, presb., a. 76, r. 57.
El Paso. Fr. Andrea M. Ponso Bellon, presb., a. 82, r. 63.
17. Vir. Feria VI hebd. XIX per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 16, 1-15. 60. 63 vel 16, 59-63;
Ps Is 12, 2-3. 4bcd. 5-6.
Ev Mt 19, 3-12.
ANNIVERSARIA
1982. Olympia Fields. Fr. Frank M. Marron, presb., a. 75, r. 55.
1994. Rum (Innsbruck). Fr. Nivard M. Fuchs, presb., a. 81, r. 62.
1998. Montréal. Fr. Rosaire M. Latraverse, presb., a. 73, r. 54.
18. Alb. Sabb. hebd. XIX per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
188
TEMPUS PER ANNUM
L 1 Ez 18, 1-10. 13b. 30-32; Ps 50, 12-13. 14-15. 18-19.
Ev Mt 19, 13-15.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 25: Beata Maria Virgo, imago et mater
Ecclesiae I.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1961. S. José dos Campos. Fr. Pellegrino M. Bellezze, presb., a. 77,
r. 61.
2007. Isola Vicentina. Fr. Giorgio M. Sasso, presb., a. 78, r. 51.
2009. Negrar. Fr. Giovanni M. Lupatin, presb., a. 90, r. 73.
AUGUSTUS 2012
189
TRIDUUM
S. PHILIPPI BENIZI
Diebus 20-21-22 augusti in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut
fratres omnesque sodales ad festum S. Philippi
Benizi celebrandum apte disponantur. Ad hoc
opportune adhibebuntur subsidia, quibus sunt
tituli In lode di san Filippo Benizi vel In praise of saint Philip
Benizi vel À la louange de saint Philippe Benizi vel En honor de
san Felipe Benizi et Benedizionale di san Filippo Benizi vel Livre
des bénédictions de saint Philippe Benizi.
20. Alb. Feria II hebd. XX per annum (IV Psalt.).
S. Bernardi A. D., memoria.
MISSA memoriae, pf. com. vel de sancto.
19. Vir. Dom. XX PER ANNUM (Hebd. IV Psalt.).
De ea.
L 1 Ez 24, 15-24; Ps Deut 32, 18-19. 20. 21.
Ev Mt 19, 16-22.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Prov 9, 1-6; Ps 33, 2-3. 10-11. 12-13. 14-15.
L 2 Eph 5, 15-20.
Ev Io 6, 51-58.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Ioannis Eudes P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1974. Roma. Fr. Luigi M. Artusi, presb., a. 74, r. 57.
In Hungaria:
19. I VESPERAE soll. – Cp. post I Vp. dom.
20. Alb. Feria II. S. STEPHANI HUNGARIAE, PATRONI
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
190
1962.
1972.
1973.
1992.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Luggau. Fr. Emmeran M. Schicker, presb., a. 50, r. 30.
Rio Branco. Fr. Carlo M. Casavecchia, presb., a. 31, r. 14.
Budapest. Fr. József M. Herhoffer, a. 63, r. 37.
Nigel. Fr. Norberto M. Signori, presb., a. 81, r. 62.
Firenze. Fr. Luciano M. Guidi, a. 97, r. 69.
21. Vir. Feria III hebd. XX per annum (IV Psalt.).
De ea. Vel:
Alb. S. Pii X Pp.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 28, 1-10; Ps Deut 32, 26-27ab. 27cd-28. 30.
35cd-36ab.
Ev Mt 19, 23-30.
1968.
1969.
1993.
1994.
ANNIVERSARIA
Pointe-Navarre. Fr. Jean-M. Watier, presb., a. 70, r. 42.
Montefano. Fr. Tommaso M. Del Lungo, a. 72, r. 36.
Saviano. Fr. Carmelo M. Abbate, presb., a. 80, r. 61.
Bolzano. Fr. Enrico M. Zanotto, presb., a. 83, r. 62.
22. Alb. Feria IV hebd. XX per annum (IV Psalt.).
B. Mariae Virg. Reginae, memoria.
MISSA memoriae, pf. B. Mariae V.
L 1 Ez 34, 1-11; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Mt 20, 1-16a.
Vel, e Lectionario Sanctorum:
L 1 Is 9, 1-6; Ps 112, 1-2. 3-4. 5-6. 7-8.
Ev Lc 1, 26-38.
Adhibeatur PE cum praefatione variabili.
AUGUSTUS 2012
1978.
2000.
2006.
2007.
191
ANNIVERSARIA
Rottanova. Fr. Emanuele M. Alba, presb., a. 50, r. 32.
Roma. Fr. Emilio M. Gallini, a. 81, r. 63.
Firenze. Fr. Martino M. Santini, presb., a. 91, r. 54.
Québec. Fr. Marcel M. Dégarie, presb., a. 81, r. 60.
23. Alb. Feria V. S.P. PHILIPPI BENIZI, O.N. PROPA-
GATORIS INSIGNIS, festum. – Ad H. m. ant. et
pss. feriae V hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 Col 3, 12-17; Ps 30, 2 et 6. 12-13. 15-16. 17 et 25.
Ev Io 13, 12-17. 34-35 vel Mc 9, 33-37.
Vel:
L 1 2 Cor 5, 17-20; Ps 84, 9-10. 11-12. 13-14.
Ev Lc 6, 27-31. 35b-38.
«Benedictio panis et aquae in honorem S. Philippi» fieri debet
secundum ritum in novissima editione Proprii Missarum
O.S.M. (anno 1998) descriptum, vel secundum unum e riti-
bus in Benedizionale di S. Filippo Benizi vel Livre des bénédic-
tions de saint Philippe Benizi (anno 1987) describuntur.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Rosae de Lima V. memoria omittitur.
In Americae Latinae Nationibus:
23. Alb. Feria V. S. ROSAE DE LIMA V., TOTIUS AMERICAE
LATINAE PATRONAE, festum. – Ad H. m. ant. et pss.
feriae V hebd. IV.
192
TEMPUS PER ANNUM
MISSA pr., Gloria, lect. pr., pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
In Chilia et in Rei Publica Argentina festum S. Rosae de
Lima V. die 30 augusti celebratur.
ANNIVERSARIA
1973. Chieti. Fr. Antonio M. Firmani, a. 56, r. 22.
1983. Verona. Fr. Mariano M. Todero, a. 82, r. 60.
1985. Trapani. Fr. Camillo M. Fioretti, presb., a. 74, r. 58.
24. Rub. Feria VI. S. BARTHOLOMEI AP., festum. –
Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Apoc 21, 9b-14; Ps 144, 10-11. 12-13ab. 17-18.
Ev Io 1, 45-51.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
ANNIVERSARIA
1998. Negrar. Fr. Marino M. Moro, presb., a. 76, r. 56.
1999. Melbourne (USA). Fr. John M. Martin, presb., a. 72, r. 52.
25. Alb. Sabb. hebd. XX per annum (IV Psalt.).
De S. Maria in sabbato, memoria.
MISSA memoriae.
L 1 Ez 43, 1-7a; Ps 84, 9ab.10. 11-12. 13-14.
Ev Mt 23, 1-12.
AUGUSTUS 2012
193
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 24: Beata Virgo Maria, sedes Sapientiae.
S. Ludovici et S. Ioseph de Calasanz P memoriae omittuntur.
.
I VESPERAE dom. – Cp. post I Vp. dom.
1972.
1976.
1977.
1985.
1998.
ANNIVERSARIA
Pisa. Fr. Sostegno M. Benedetti, presb., a. 84, r. 66.
Turvo. Fr. Egidio M. Muscini, a. 92, r. 66.
Rovato. Fr. Vincenzo M. Tessarolo, a. 69, r. 45.
Elmhurst. Fr. Clarence M. Brissette, presb., a. 85, r. 62.
Chicago. Fr. Kevin M. O’Byrne, a. 77, r. 46.
26. Vir. Dom. XXI PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ios 24, 1-2a. 15-17. 18b;
Ps 33, 2-3. 16-17. 18-19. 20-21. 22-23.
L 2 Eph 5, 21-32.
Ev Io 6, 60-69.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1977.
1988.
1997.
1997.
2003.
2008.
ANNIVERSARIA
Portland. Fr. Bartholomew M. Wright, presb., a. 67, r. 34.
Negrar. Fr. Lorenzo M. Boratto, presb., a. 86, r. 69.
Montréal. Fr. Julien M. Brodeur, presb., a. 80, r. 61.
Reggio Emilia. Fr. Pietro M. Rizzi, presb., a. 82, r. 63.
Roma. Fr. Mario M. Castelli, presb., a. 83, r. 66.
Coyhaique. Fr. José M. Belló Marcolín, a. 95, r. 77.
194
TEMPUS PER ANNUM
27. Alb. Feria II hebd. XXI per annum (I Psalt.).
S. Monicae, memoria.
MISSA memoriae.
L 1 2 Thes 1, 1-5. 11b-12; Ps 95, 1-2a. 2b-3. 4-5.
Ev Mt 23, 13-22.
ANNIVERSARIA
1967. S. José dos Campos. Fr. Michele M. Lorenzini, presb., a. 79,
r. 63.
1974. La Plata. Fr. Augusto M. Incao, presb., a. 59, r. 40.
1989. Oruro. Fr. Agostino M. Gobbo, presb., a. 81, r. 59.
28. Alb. Feria III. S. AUGUSTINI E. D. ATQUE LEGI-
SLATORIS ORDINIS NOSTRI, festum. – Ad H.
m. ant. et pss. feriae III hebd. I.
MISSA pr., Gloria, pf. pr.
L 1 1 Io 4, 7-16 vel 1 Cor 12, 31 – 13, 8a. 13;
Ps 36, 3-4. 5-6. 30-31.
Ev Mt 23, 8-12.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1982. Firenze. Ep. Girolamo M. Casalini, a. 66, r. 50.
1987. Pietralba. Fr. Sostegno M. Parise, a. 67, r. 47.
1993. Firenze. Fr. Stefano M. Galeotti, a. 77, r. 56.
29. Rub. Feria IV hebd. XXI per annum (I Psalt.).
In Passione S. Ioannis Baptistae, memoria.
Ad Ld. ant. pr. cum psalmis dom. hebd. I.
AUGUSTUS 2012
195
MISSA memoriae, lect. pr., pf. pr.
L 1 Ier 1, 17-19; Ps 70, 1-2. 3-4a. 5-6ab. 15ab et 17.
Ev Mc 6, 17-19.
Adhibeatur PE cum praefatione variabili.
Ad Vp. ant. pr. cum psalmis de Communi Martyrum.
ANNIVERSARIA
1975. Siracusa. Fr. Agostino M. Pappalardo, presb., a. 63, r. 47.
1988. Milano. Fr. Giorgio M. Cavasin, a. 66, r. 46.
2007. Léon. Fr. José Alejandro M. Medina Frausto, presb., a. 39,
r. 18.
30. Vir. Feria V hebd. XXI per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 1, 1-9; Ps 144, 2-3. 4-5. 6-7.
Ev Mt 24, 42-51.
ANNIVERSARIA
1981. Melbourne. Fr. Vincent M. Harkins, presb., a. 47, r. 28.
2007. Vincenza. Fr. Prospero M. Bobbato, diac., a. 80, r. 60.
2009. Valencia. Fr. Antonio M. Sánchez Iglesias, presb., a. 69, r. 50.
31. Vir. Feria VI hebd. XXI per annum (I Psalt.).
De ea. Vel:
Alb. B. Andreae de Burgo Sancti Sepulcri Rel. O.N.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 1, 17-25; Ps 32, 1-2. 4-5. 10ab et 11.
Ev Mt 25, 1-13.
ANNIVERSARIA
1976. Gaspé. Fr. Percival M. Sainte-Croix, presb., a. 57, r. 34.
1991. Vicenza. Fr. Ilario M. Marchesan, presb., a. 64, r. 46.
SEPTEMBER 2012
SEPTEMBER 2012
1. Alb. Sabb. hebd. XXI per annum (I Psalt.).
De S. Maria in sabbato, memoria.
MISSA memoriae.
L 1 1 Cor 1, 26-31; Ps 32, 12-13. 18-19. 20-21.
Ev Mt 25, 14-30.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 41: Beata Maria Virgo, mater consolationis.
B. Ioannae de Florentia Virg. O.N. memoria omittitur.
197
L 1 Deut 4, 1-2. 6-8; Ps 14, 2-3a. 3cd-4ab. 5.
L 2 Iac 1, 17-18. 21b-22. 27.
Ev Mc 7, 1-8. 14-15. 21-23.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Bruxelles. Fr. Joseph M. Brown, presb., a. 81, r. 62.
1995. Mbabane. Fr. Albert M. Mndzebele, presb., a. 69, r. 43.
2009. Roma. Fr. Raffaele M. Crivello, presb., a. 86, r. 68.
3. Alb. Feria II hebd. XXII per annum (II Psalt.).
S. Gregorii Magni Pp. D., memoria.
I VESPERAE dom. – Cp. post I Vp. dom. MISSA memoriae.
Pro Monialibus et Sororibus O.N.: L 1 1 Cor 2, 1-5; Ps 118, 97. 98. 99. 100. 101. 102.
Ev Lc 4, 16-30.
1. Alb. B. Ioannae de Florentia, Virg. O.N., memoria.
ANNIVERSARIA
1995. Salerno. Fr. Tarcisio M. Mascagni, presb., a. 74, r. 56.
MISSA memoriae.
ANNIVERSARIA
1970. Vicenza. Fr. Emilio M. Toffano, a. 83, r. 58.
2003. Des Plaines (Illinois). Fr. Michael M. Scanlon, presb., a. 95,
r. 77.
2. Vir. DOM. XXII PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
4. Vir. Feria III hebd. XXII per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 2, 10b-16; Ps 144, 8-9. 10-11. 12-13ab.
13cd-14.
Ev Lc 4, 31-37.
ANNIVERSARIA
1967. München. Fr. Paul M. Schifflers, presb., a. 66, r. 44.
2003. Roma. Fr. Giuseppe M. Bortone, presb., a. 77, r. 55.
198
TEMPUS PER ANNUM
5. Vir. Feria IV hebd. XXII per annum (II Psalt.).
De ea. Vel:
Alb. B. Mariae Magdalenae Starace, Virg. O.N.,
Fundatricis Congregationis Sororum Servarum Mariae
a Compassione.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 3, 1-9; Ps 32, 12-13. 14-15. 20-21.
Ev Lc 4, 38-44.
Pro sororibus Servis Mariae a Compassione:
5. Alb. Feria IV. MARIAE MAGDALENAE STARACE,
VIRG. O.N., FUNDATRICIS CONGREGATIONIS
SORORUM SERVARUM MARIAE A COMPASSIONE,
festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. de beata.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
VESPERAE festi – Cp. post I Vp. dom.
ANNIVERSARIA
1976. Siteki. Fr. Alfonso M. Borelli, presb., a. 73, r. 56.
1980. Firenze. Fr. Ubaldo M. Forconi, presb., a. 73, r. 55.
1994. Venezia. Fr. Mario M. Turato, a. 84, r. 60.
6. Alb. Feria V hebd. XXII per annum (II Psalt.).
B. Bonaventurae de Foro Livii, presbyteri O.N.,
memoria.
SEPTEMBER 2012
199
MISSA memoriae.
L 1 1 Cor 3, 18-23; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 5, 1-11.
ANNIVERSARIA
1993. Cattolica. Fr. Francesco M. Di Blasio, presb., a. 50, r. 32.
2011. Torino. Fr. Germano M. Vassallo, presb., a. 84, r. 65.
7. Vir. Feria VI hebd. XXII per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 4, 1-5; Ps 36, 3-4. 5-6. 27-28. 39-40.
Ev Lc 5, 33-39.
ANNIVERSARIA
1962. Sublimity. Fr. Francis M. Wiehl, presb., a. 74, r. 55.
2010. Torino. Fr. Giovanni M. Onini, presb., a. 82, r. 65.
8. Alb. Sabb. IN NATIVITATE B. MARIAE V., fes-
tum. – Ad H. m. ant. cum pss. sabbati hebd. II.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
L 1 Mic 5, 1-4a vel Rom 8, 28-30; Ps 12, 6ab. 6cd.
Ev Mt 1, 1-16. 18-23 vel 1, 18-23.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
200
TEMPUS PER ANNUM
DIES DIACONIARUM LAICARUM SERVORUM SANCTAE
MARIAE
Motus Diaconiae laicae OSM Diem Consociationis cele-
brant. Orta die 8 septembris 1982 ex felici consilio fra-
tris David M. Montagna (†2000), Consociatio probata
et sociata est Ordini Servorum die 1 ianuarii 1999 a fra-
tre Hubert M. Moons, Priore generali. Omnis diaconia
domi suae lectioni divinae assidue vacat, Nazaretanam
Familiam ut exemplar colit et tamquam festum pro-
prium unam ex festivitatibus marianis celebrant.
Fratres et sorores Ordinis nostri preces effundant ut
Consociatio diaconiarum laicarum in die augeatur
Evangelii testimonium et operum alacritatem.
ANNIVERSARIA
1988. Siteki. Fr. Raimondo M. Dal Magro, a. 85, r. 64.
1989. Vicenza. Fr. Paolino M. Montagna, presb., a. 72, r. 55.
9. Vir. DOM. XXIII PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 35, 4-7a; Ps 145, 7. 8-9a. 9bc-10.
L 2 Iac 2, 1-5.
Ev Mc 7, 31-37.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Petri Claver P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Milano. Fr. Giovanni M. Trevisan, a. 72, r. 47.
1985. Maroslele. Fr. Venáncz M. Bezdán, a. 63, r. 35.
1992. Massa. Fr. Fedele M. Bonini, presb., a. 78, r. 59.
SEPTEMBER 2012
201
10. Vir. Feria II hebd. XXIII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 5, 1-8; Ps 5, 5-6. 7. 12.
Ev Lc 6, 6-11.
11. Vir. Feria III hebd. XXIII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 6, 1-11; Ps 149, 1-2. 3-4. 5-6a et 9b.
Ev Lc 6, 12-19.
ANNIVERSARIA
1975. Roma. Fr. Giovanni M. Poscolieri, presb., a. 63, r. 47.
1986. Arezzo. Fr. Bonagiunta M. Manetti, presb., a. 75, r. 55.
1993. Vicenza. Fr. Felice M. Filippi, a. 67, r. 25.
TRIDUUM
B. MARIÆ VIRGINIS PERDOLENTIS, O.N.
PATRONÆ PRINCIPALIS
Diebus 12-13-14 septembris in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut fra-
tres omnesque sodales disponantur ad sollemnita-
tem B. Mariæ Virginis Perdolentis, O.N. Patronæ
Principalis, celebrandam apte disponantur. Ad hoc opportune
adhibebuntur subsidia, quibus sunt tituli Corona dell’Addolorata
vel Rosary of our Lady of sorrows vel Chapelet de Notre-Dame des
douleurs et Via Matris.
202
TEMPUS PER ANNUM
12. Vir. Feria IV hebd. XXIII per annum (III Psalt.).
De ea. Vel:
Alb. Ss.mi Nominis B. Mariae Virginis.
MISSA ad libitum (cf. p. XVIII).
Vel, in Missa B. Mariae V.:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 21: Sanctum Nomen beatae Mariae Virginis.
L 1 1 Cor 7, 25-31; Ps 44, 11-12. 14-15. 16-17.
Ev Lc 6, 20-26.
ANNIVERSARIA
1977. Roma. Fr. Gabriele M. Roschini, presb., a. 76, r. 57.
1979. Palma Campania. Fr. Fortunato M. Frattin, a. 83, r. 49.
1988. Montréal. Fr. Gilles M. Beaulac, presb., a. 61, r. 42.
13. Alb. Feria V hebd. XXIII per annum (III Psalt.).
S. Ioannis Chrysostomi E. D., memoria.
MISSA memoriae.
L 1 1 Cor 8, 1b-7. 11-13; Ps 138, 1-3. 13-14ab. 23-24.
Ev Lc 6, 27-38.
ANNIVERSARIA
2002. Chicago. Fr. Thomas M. Duff, presb., a. 80, r. 59.
14. Rub. Feria VI. IN EXALTATIONE S. CRUCIS, fes-
tum. – Ad H. m. ant. pr. cum pss. feriae VI hebd. III.
MISSA pr., Gloria, lect. pr., pf. pr. vel I Pass.
SEPTEMBER 2012
203
L 1 Num 21, 4b-9 vel Phil 2, 6-11;
Ps 77, 1-2. 34-35. 36-37. 38.
Ev Io 3, 13-17.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE soll. – Cp. post I Vp. dom.
1961.
1961.
1981.
1992.
ANNIVERSARIA
Modena. Fr. Giuseppe M. Gherardi, presb., a. 52, r. 34.
Montréal. Fr. Luigi M. Leonelli, a. 79, r. 55.
S. Colombano. Fr. Bernardo M. Michelato, presb., a. 70,
r. 53.
Rio Branco. Fr. Peregrino M. Carneiro de Lima, presb.,
a. 79, r. 61.
15. Alb. Sabb. B. MARIAE VIRGINIS PERDOLEN-
TIS, O.N. PATRONAE PRINCIPALIS, sollemnitas.
– Ad H. m. ant. pr. cum psalmodia complementari.
MISSA pr., Gloria, lect. pr., sequentia ad libitum, Credo,
pf. pr.
L 1 Iudith 13, 22-25 (gr. 17b-20); Ps 144, 1-2. 4-6. 8-9.
L 2 Col 1, 18-24.
Ev Lc 2, 33-35 vel Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
204
TEMPUS PER ANNUM
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Sisters of the
Mother of Sorrows Servants of Mary (India) hanc
diem qua beatam Virginem Perdolentem Patronam
Instituti venerantur, celebrat quoque tanquam Diem
Congregationis. Anno 1927 die 18 septembris Con-
gregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Liturgiae Horarum necnon Sacrificii eucharistici
Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
DIES CONGREGATIONIS
Sorores quae Misioneras de María Dolorosa (Ciudad
Juárez, México) vocantur, hunc diem quo earum Insti-
tutum, anno 1947, canonice est erectum, tamquam
Diem Congregationis celebrant. Anno 1953 die 29
martii Congregatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri cum in
matutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini laudes
agant et pro bono atque incremento Congregationis
enixe supplicent.
ANNIVERSARIA
1974. Trieste. Fr. Leandro M. Zanussi, a. 70, r. 46.
1994. St. Petersburg Beach. Fr. Dominic M. Manzo, presb., a. 78,
r. 59.
1995. Vicenza. Fr. Andrea M. Cecchin, presb., a. 80, r. 62.
1997. Chieti. Fr. Michele M. Garofalo, presb., a. 77, r. 24.
2000. Napoli. Fr. Tommaso M. Chianese, presb., a. 79, r. 61.
SEPTEMBER 2012
205
16. Vir. DOM. XXIV PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf., dom. per annum.
L 1 Is 50, 5-9a; Ps 114, 1-2. 3-4. 5-6. 8-9.
L 2 Iac 2, 14-18.
Ev Mc 8, 27-35.
Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Cornelii P. et Cypriani E. Mm. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1972. Monte Senario. Fr. Filippo M. Ferrini, presb., a. 91, r. 75.
1981. Vicenza. Fr. Giuseppe M. Micottis, a. 64, r. 43.
2009. Santiago del Cile. Fr. Venancio M. Petracco Orlando,
a. 93, r. 68.
17. Vir. Feria II hebd. XXIV per annum (IV Psalt.).
De ea. Vel:
Alb. S. Roberti Bellarmino E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 11, 17-26. 33; Ps 39, 7-8a. 8b-9. 10. 17.
Ev Lc 7, 1-10.
ANNIVERSARIA
1999. Bologna. Fr. Tiago M. Coccolini, presb., a. 84, r. 68.
18. Vir. Feria III hebd. XXIV per annum (IV Psalt.).
De ea.
206
TEMPUS PER ANNUM
MISSA ad libitum (cf. p. XVIII).
C
ANNUS A CONDITO
INSTITUTO SERVARUM MARIAE A LADYSMITH
L 1 1 Cor 12, 12-14. 27-31a; Ps 99, 2. 3. 4. 5.
Ev Lc 7, 11-17.
1964.
1974.
1976.
1983.
ANNIVERSARIA
Stegi. Fr. Anselmo M. Marsigli, presb., a. 74, r. 55.
Begbroke. Fr. Joachim M. King, presb., a. 66, r. 48.
Chicago. Fr. Gregor M. Ford, presb., a. 70, r. 51.
Firenze. Fr. Celestino M. Bresci, presb., a. 68, r. 48.
Anno 1912, die 19 septembris, in oppido Ladysmith (Wisconsin), USA,
condita est communitas religiosa cui anno 1919 nomen datum est Insti-
tutum Servarum Mariae a Ladysmith. Primae sorores, in quibus numeran-
tur M. Alphonse Bradley (1880-1950), M. Rose Smith (1879-1955), M.
Evangelist Corcoran (1875-1962), in oppido Ladysmith (Wisconsin) perve-
nerunt, ut puellas docerent in schola paroeciali, quo fratres Servi Mariae
anno 1910 venerant. Anno 1919, die 8 decembris, Institutum iuris dioece-
sani factum et appellatum est Congregatio Servarum Mariae a Ladysmith.
Il 19 settembre 1912, fu fondata a Ladysmith (Wisconsin), USA, in cui i
Servi di Maria erano arrivati nel 1910, una comunità religiosa a cui fu
dato il nome di «Istituto delle Serve di Maria di Ladysmith. Le prime
sorelle, fra cui si ricordano M. Alphonse Bradley (1880-1950), M. Rose
Smith (1879-1955), M. Evangelist Corcoran (1875-1962), giunsero a
Ladysmith per insegnare alle ragazze della scuola parrocchiale. L’8 dicembre
1919 l’Istituto divenne di diritto diocesano e presero il nome di Congre-
gazione delle Serve di Maria di Ladysmith.
On 19 September 1912, at Ladysmith (Wisconsin), USA, where the friar
Servants of Mary had arrived in 1910, a religious community of women was
founded with the name “Institute of Sister Servants of Mary of Ladysmith”.
The first sisters, among whom were M. Alphonse Bradley (1880-1950),
M. Rose Smith (1879-1955), and M. Evangelist Corcoran (1875-1962),
went to Ladysmith to teach the girls in the parish school. On 8 December,
1919 it became an Institute of diocesan right and took the name Congre-
gation of Sister Servants of Mary of Ladysmith.
208
TEMPUS PER ANNUM
19. Vir. Feria IV hebd. XXIV per annum (IV Psalt.).
De ea. Vel:
Rub. S. Ianuarii E. M.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 12, 31 – 13, 13; Ps 32, 2-3. 4-5. 12 et 22.
Ev Lc 7, 31-35.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Servants of Mary
(Ladysmith) hanc diem qua, anno 1912, primae
Sorores ad civitatem Ladysmith pervenerunt, tam-
quam Diem Congregationis celebrat. Anno 1921
die 16 novembris Congregatio Ordini nostro aggre-
gata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii eucha-
ristici Deo gratias agant et pro bono atque incre-
mento Instituti fraternas effundant preces.
ANNIVERSARIA
1975. Ladysmith. Fr. James M. Keane, presb., a. 74, r. 54.
2000. Santiago de Chile. Fr. Paolo M. Venezian, presb., a. 89,
r. 71.
2001. Nepi. Fr. Giuseppe M. Zamin, presb., a. 75, r. 54.
20. Rub. Feria V hebd. XXIV per annum (IV Psalt.).
Ss. Andreae Kim Taegon, Pauli Chong et Soc.
Mm., memoria.
MISSA memoriae.
SEPTEMBER 2012
209
L 1 1 Cor 15, 1-11; Ps 117, 1-2. 16ab-17. 28.
Ev Lc 7, 36-50.
ANNIVERSARIA
2003. Negrar. Fr. Gioacchino M. Pizzolato, a. 90, r. 71.
2010. Negrar. Fr. Giulio M. Signori, presb., a. 93, r. 74.
2011. Chicago. Fr. Martin M. Doherty, presb., a. 77, r. 56.
21. Rub. Feria VI. S. MATTHAEI AP. ET EV., festum. –
Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Eph 4, 1-7. 11-13; Ps 18, 2-3. 4-5.
Ev Mt 9, 9-13.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1991. Firenze. Fr. Giovanni M. Catocci, presb., a. 84, r. 63.
2000. Wien. Fr. Amideus M. Schuhmaier, presb., a. 83, r. 65.
2010. Negrar. Fr. Alessio M. Zanollo, a. 85, r. 56.
22. Alb. Sabb. hebd. XXIV per annum (IV Psalt.).
In Dedicatione Basilicae sacri conventus Montis
Senarii, memoria.
MISSA memoriae.
L 1 1 Cor 15, 35-37. 42-49; Ps 55, 10. 11-12. 13-14.
Ev Lc 8, 4-15.
I VESPERAE dom. – Cp. post I Vp. dom.
210
TEMPUS PER ANNUM
In Monte Senario:
21. I VESPERAE soll. – Cp. post I Vp. dom.
22. Alb. Sabb. IN DEDICATIONE BASILICAE SACRI
CONVENTUS MONTIS SENARII, sollemnitas. – Ad
H. m. ant. pr. cum psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 56, 1. 6-7; Ps 83, 3. 4. 5-6a et 8a. 11.
L 2 1 Petr 2, 4-9.
Ev Io 4, 19-24.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
Tirano. Fr. Francesco M. Paolazzi, presb., a. 69, r. 45.
Wheeling. Fr. George M. Wheeler, presb., a. 84, r. 64.
Milano. Fr. Maurizio M. Gamba, a. 84, r. 60.
Bologna. Fr. Luigi M. Barbieri, presb., a. 81, r. 65.
Jolimont (Belgique). Fr. Gérard M. Biron, presb., a. 50,
r. 30.
2000. Detroit. Fr. Frederick M. Reiman, presb., a. 80, r. 63.
2005. Negrar. Fr. Alessio M. Eugelmi, a. 77, r. 59.
1972.
1990.
1991.
1992.
1995.
23. Vir. DOM. XXV PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
SEPTEMBER 2012
211
L 1 Sap 2, 12. 17-20; Ps 53, 3-4. 5. 6 et 8.
L 2 Iac 3, 16 – 4, 3.
Ev Mc 9, 30-37.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Pii de Pietrelcina P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1978. Wien. Fr. Gotthard M. Kreuzer, presb., a. 71, r. 49.
1989. Torino. Fr. Giovanni M. Pollaroli, a. 94, r. 40.
1990. Pesaro. Fr. Vincenzo M. Gualtieri, presb., a. 52, r. 34.
24. Vir. Feria II hebd. XXV per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 3, 27-34; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Lc 8, 16-18.
ANNIVERSARIA
1987. Genova. Fr. Alessio M. Cerrato, presb., a. 81, r. 64.
25. Vir. Feria III hebd. XXV per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 21, 1-6. 10-13; Ps 118, 1. 27. 30. 34. 35. 44.
Ev Lc 8, 19-21.
ANNIVERSARIA
1966. Chicago. Fr. Maurice M. Cronin, presb., a. 38, r. 19.
2002. Waterford. Fr. Aidan M. Kennedy, a. 87, r. 62.
2009. Valencia. Fr. Lorenzo M. Pochettino, presb., a. 83, r. 64.
212
TEMPUS PER ANNUM
26. Vir. Feria IV hebd. XXV per annum (I Psalt.).
De ea. Vel:
Rub. Ss. Cosmae et Damiani Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 30, 5-9; Ps 118, 29. 72. 89. 101. 104. 163.
Ev Lc 9, 1-6.
ANNIVERSARIA
2002. Firenze. Fr. Alessio M. Danti, a. 85, r. 53.
2003. Orléans. Fr. Patrice M. Pharand, presb., a. 84, r. 66.
27. Alb. Feria V hebd. XXV per annum (I Psalt.).
S. Vincentii de Paul P., memoria.
MISSA memoriae.
L 1 Qoh 1, 2-11; Ps 89, 3-4. 5-6. 12-13. 14 et 17.
Ev Lc 9, 7-9.
Crastina die anniversarium recurret piae mortis Ioannis
Pauli Pp. I (1978).
SEPTEMBER 2012
1965.
1971.
1977.
1978.
1992.
213
ANNIVERSARIA
Monte Senario. Fr. Enrico M. Gargiani, presb., a. 75, r. 58.
Sena Madureira. Ep. Giocondo M. Grotti, a. 43, r. 27.
Furtwangen. Fr. Fridolin M. Müller, a. 69, r. 47.
Città del Vaticano. Pp. Ioannes Paulus I, a. 65. p. 33 dierum.
Denver. Fr. Hugh M. Moffett, presb., a. 78, r. 53.
29. Alb. Sabb. SS. MICHAELIS, GABRIELIS ET
RAPHAELIS, ARCHANG., festum. – Ad H. m. ant.
pr. et pss. de sabbati hebd. I.
MISSA pr., Gloria, lect. pr., pf. Angelorum.
L 1 Dan 7, 9-10. 13-14 vel Apoc 12, 7-12a;
Ps 137, 1-2a. 2bc-3. 4-5.
Ev Io 1, 47-51.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA ANNIVERSARIA
1982. Perugia. Fr. Gregorio M. Logli, presb., a. 71, r. 53. 1988. Anaheim. Fr. Philip M. Grimes, presb., a. 81, r. 62.
1991. San Diego. Fr. Raymond M. Geb, presb., a. 65, r. 47. 2007. Firenze. Fr. Ermenegildo M. Biagini, presb., a. 88, r. 70.
28. Vir. Feria VI hebd. XXV per annum (I Psalt.). 30. Vir. DOM. XXVI PER ANNUM (Hebd. II Psalt.).
De ea. Vel: De ea.
Rub. S. Venceslai M. Vel:
Rub. Ss. Laurentii Ruiz et Soc. Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Qoh 3, 1-11; Ps 143, 1a et 2abc. 3-4.
Ev Lc 9, 18-22.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Num 11, 25-29; Ps 18, 8. 10. 12-13. 14.
L 2 Iac 5, 1-6.
Ev Mc 9, 38-43. 45. 47-48.
214
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
S. Hieronymi P.D. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1978. Superga. Fr. Mauro M. Rapido, a. 49, r. 2.
1992. El Paso. Fr. Egidio M. Pasquon, presb., a. 54, r. 34.
1999. Ceské Budejovice. Fr. Kasimir M. Jindra, presb., a. 84, r. 61.
OCTOBER 2012
Oratio per Mariale Rosarium fidelibus commendetur
eiusque natura et momentum in luce ponantur.
Indulgentia plenaria conceditur recitantibus mariale
Rosarium in ecclesia aut oratorio, vel in familia, in
religiosa communitate, in christifidelium consocia-
tione et generatim cum plures ad aliquem honestum
finem convenerint; indulgentia vero partialis in aliis
rerum adiunctis (Enchiridion Indulgentiarum, ed. 1999,
concessio n. 17).
1. Alb. Feria II hebd. XXVI per annum (II Psalt.).
S. Theresiae a Iesu Infante V. D., memoria.
MISSA memoriae.
L 1 Iob 1, 6-22; Ps 16, 1. 2-3. 6-7.
Ev Lc 9, 46-50.
1974.
1982.
1984.
1991.
2003.
ANNIVERSARIA
Reggio Emilia. Fr. Giuseppe M. Milani, a. 70, r. 36.
Treviso. Fr. Tarcisio M. Campagnolo, presb., a. 47, r. 27.
Ancona. Ep. Bernardino M. Piccinelli, a. 79, r. 62.
Chicago. Fr. Dominic M. Monforti, a. 58, r. 36.
Dundee. Fr. Philip M. Walsh, presb., a. 76, r. 54.
2. Alb. Feria III hebd. XXVI per annum (II Psalt.).
Ss. Angelorum Custodum., memoria.
MISSA pr., lect. pr., pf. de Angelis.
216
TEMPUS PER ANNUM
L 1 Ex 23, 20-23; Ps 90, 1-2. 3-4. 5-6. 10-11.
Ev Mt 18, 1-5. 10.
Adhibeatur PE cum praefatione variabili.
ANNIVERSARIA
1985. Viareggio. Fr. Luca M. Caramelli, presb., a. 65, r. 49.
2001. Las Toscas. Fr. Eligio M. Giacomozzi, presb., a. 90, r. 72.
2004. Derry. Fr. Seamus M. Heffernan, a. 65, r. 42.
3. Rub. Feria IV hebd. XXVI per annum (II Psalt.).
B. Maria Guadalupe Ricart Olmos Virg. M. O.N.,
memoria.
OCTOBER 2012
217
ANNIVERSARIA
1971. Viareggio. Fr. Benedetto M. Maltempi, presb., a. 83, r. 66.
1988. Saint-Augustin (Québec). Fr. Jean M. Gervais, presb., a. 43,
r. 22.
1989. Dundee. Fr. Joseph M. Hynd, a. 58, r. 27.
4. Alb. Feria V hebd. XXVI per annum (II Psalt.).
S. Francisci Assisiensi, memoria.
MISSA memoriae.
L 1 Iob 19, 21-27; Ps 26, 7-8a. 8b-9abc. 13-14.
Ev Lc 10, 1-12.
MISSA memoriae.
L 1 Iob 9, 1-12. 14-16; Ps 87, 10bc-11. 12-13. 14-15.
Ev Lc 9, 57-62.
In Italia:
4. Alb. Feria V. S. FRANCISCI ASSISIENSIS, ITALIAE
PATRONI, festum. Ad H. m. ant. et pss. feriae V hebd. II.
Pro Monialibus O.N.:
Rub. Feria IV. B. Mariae Guadalupe Ricart Olmos, Virg.
M. O.N., festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA festi, Gloria, lect. pr., pf. de martyr. vel de virg.
L 1 Rom 8, 31b-39; Ps 114-115, 1-2. 3-4. 14-15.
Ev Mt 10, 28-33.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
VESPERAE festi.
Missa pr., Gloria, lect. pr., pf. Sanctorum.
L 1 Gal 6, 14-18; Ps 15, 1-2a et 5. 7-8. 11.
Ev Mt 11, 25-30.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
218
TEMPUS PER ANNUM
DIES MISSIONIS
Missio in regione Acre (Brasilia), die 4 octobris 1919
in Praefecturam apostolicam erecta, hodie Diem
Missionis celebrat.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii eucari-
stici fraternas Deo effundant preces pro propagatio-
ne Evangelii in illa regione.
OCTOBER 2012
219
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 40: Beata Maria Virgo, divinae providentiae
mater.
S. Brunonis P. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
DIES CONGREGATIONIS
ANNIVERSARIA
2003. Pesaro. Fr. Pietro M. Giogoli, presb., a. 85, r. 66.
2004. London. Fr. Joseph M. Colella, presb., a. 73, r. 53.
2011. Roma. Fr. Mario M. Bozzi, presb., a. 85, r. 69.
5. Vir. Feria VI hebd. XXVI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iob 38, 1. 12-21; 40, 3-5; Ps 138, 1-3. 7-8. 9-10.
13-14ab.
Ev Lc 10, 13-16.
6. Alb. Sabb. hebd. XXVI per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iob 42, 1-3. 5-6. 12-16 (hebr. 1-3. 5-6. 12-17);
Ps 118, 66. 71. 75. 91. 125. 130.
Ev Lc 10, 17-24.
Congregatio Sororum cui est titulus Mantellate Serve
di Maria di Pistoia, hanc diem qua, anno 1861, in
pago Treppio (Pistorii) Philomena Rossi (1822-1878)
et Ioanna Ferrari (1832-1900) initium Instituti fece-
runt, tamquam Diem Congregationis celebrat. Anno
1868 die 16 novembris Congregatio Ordini nostro
aggregata est.
Omnes fratres et sorores Ordinis nostri cum in mati-
tutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini laudes
agant et pro bono atque incremento Congregationis
enixe supplicent.
ANNIVERSARIA
1971. Innsbruck. Fr. Anton M. Mosandl, a. 78, r. 48.
1987. Negrar. Fr. Cirillo M. Diquigiovanni, presb., a. 77, r. 55.
7. Vir. DOM. XXVII PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Gen 2, 18-24; Ps 127, 1-2. 3. 4-5. 6.
L 2 Hebr 2, 9-11.
Ev Mc 10, 2-16 vel 10, 2-12.
220
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
B. Mariae Virg. a Rosario memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1969.
1988.
2005.
2008.
ANNIVERSARIA
Gutenstein. Fr. Angelicus M. Schwarzenbach, presb., a. 57,
r. 40.
Fullerton. Fr. Bernard M. Paul, presb., a. 62, r. 39.
Montréal. Fr. Gabriel M. Saint-Germain, presb., a. 77, r. 58.
Vicenza. Fr. Graziano M. Casarotto, presb., a. 95, r. 76.
8. Vir. Feria II hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 1, 6-12; Ps 110, 1-2. 7-8. 9 et 10c.
Ev Lc 10, 25-37.
In Hungaria:
7. I VESPERAE soll. – Cp. post I Vp. dom.
8. Alb. Feria II. B. MARIAE V. MAGNAE DOMINAE
HUNGARORUM, sollemnitas. – Ad H. m. ant. pr. cum
psalmodia complementari.
MISSA pr., Gloria, lect. pr., Credo, pr. B. Mariae V.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
OCTOBER 2012
221
ANNIVERSARIA
1989. Orvieto. Fr. Giuseppe M. Conti, presb., a. 61, r. 45.
9. Vir. Feria III hebd. XXVII per annum (III Psalt.).
De ea. Vel:
Rub. Ss. Dionysii E. et Soc. Mm. Vel:
Alb. S. Ioannis Leonardi P.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 1, 13-24; Ps 138, 1-3. 13-14ab. 14c-15.
Ev Lc 10, 38-42.
ANNIVERSARIA
1984. Monte Senario. Fr. Gioacchino M. Bottaro, a. 80, r. 50.
2006. Innsbruck. Fr. Gregor M. Heine, presb., a. 75, r. 48.
2010. Milano. Fr. Giovanni M. Pressacco, a. 89, r. 71.
10. Vir. Feria IV hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 2, 1-2. 7-14; Ps 116, 1. 2.
Ev Lc 11, 1-4.
1981.
1982.
1991.
2004.
2005.
ANNIVERSARIA
Sherbrooke. Fr. Paulin M. Roger, a. 68, r. 28.
Maria Luggau. Fr. Lásló M. Héder, presb., a. 74, r. 54.
Negrar. Fr. Agostino M. Vasina, presb., a. 77, r. 57.
Chicago. Fr. George M. O’Connell, presb., a. 91, r. 72.
Ottawa. Fr. Hervé M. Rochon, a. 74, r. 35.
OCTOBER 2012
L
ANNUS AB INITIO CONCILII OECUMENICI VATICANO II
223
11. Vir. Feria V hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 3, 1-5; Ps Lc 1, 69-70. 71-72. 73-75.
Ev Lc 11, 5-13.
Hodie (die 11 octobris) commemoratur initium Concilii oecu-
menici Vaticani II, quod convocatum est ab beato Ioanne XXIII
(+1963), Summo Pontifici, die 25 decembris 1959.
Oggi (11 ottobre) si commemora l’inizio del Concilio ecumeni-
co Vaticano II, convocato dal beato Sommo Pontefice Giovanni
XXIII (+1963) il 25 dicembre 1959.
Today (11 October) commemorates the start of the Ecumenical
Council, Vatican II, convoked by Blessed Pope John XXIII
(+1963) on 25 December, 1959.
ANNIVERSARIA
1980. Arpadföld. Fr. Bonaventura M. Rácz, presb., a. 67, r. 48.
1983. Abbadia Lariana. Fr. Augusto M. Bottazzi, presb., a. 70,
r. 51.
1987. Chicago. Fr. Ralph M. O’Brien, presb., a. 52, r. 32.
1996. Saviano. Fr. Carlo M. Ruocco, presb., a. 70, r. 53.
2004. Francavilla al Mare. Fr. Mario M. Mariani, presb., a. 82,
r. 63.
2005. Nové Hrady. Fr. Bonfilius M. Wagner, presb., a. 79, r. 55.
12. Vir. Feria VI hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 3, 7-14; Ps 110, 1-2. 3-4. 5-6.
Ev Lc 11, 15-26.
In Brasilia:
11. I VESPERAE seq. – Cp. post I Vp. dom.
12. Alb. Feria VI. B. MARIAE VIRGINIS «NOSSA SEN-
HORA DA CONCEIÇÃO APARECIDA, PADROEIRA
PRINCIPAL DO BRASIL», BRASILIAE PATRONAE
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
224
TEMPUS PER ANNUM
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Est 5, 1b-2; 7, 2b-3;
Ps 44, 11-12a. 12b-13. 14-15a. 15b-16.
L 2 Apoc 12, 1- 5. 13a. 15-16a.
Ev Io 2, 1-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
1978.
1990.
1997.
2004.
ANNIVERSARIA
Portland. Fr. Lawrence M. Quigley, presb., a. 85, r. 64.
Firenze. Fr. Stanislao M. Cogo, presb., a. 54, r. 35.
São Paolo. Fr. Antonio M. Venturoli, presb., a. 70, r. 53.
Saviano. Fr. Filippo M. Arianna, presb., a. 81, r. 62.
13. Alb. Sabb. hebd. XXVII per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Gal 3, 22-29; Ps 104, 2-3. 4-5. 6-7.
Ev Lc 11, 27-28.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 19: Sancta Maria, mater Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1968. Roma. Fr. Pellegrino M. Righele, a. 69, r. 45.
1975. Portland. Fr. Stanislaus M. Trojanowski, a. 65, r. 19.
OCTOBER 2012
225
1983. Roma. Fr. Paolino M. Lirussi, a. 75, r. 55.
2003. Downers Grove (Illinois). Fr. Robert M. Lee, a. 63, r. 40.
2004. Torino. Fr. Salvatore M. Mulas, a. 77, r. 43.
14. Vir. DOM. XXVIII PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Sap 7, 7-11; Ps 89, 12-13. 14-15. 16-17.
L 2 Hebr 4, 12-13.
Ev Mc 10, 17-30 vel 10, 17-27.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Callisti Pp. M. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1975.
1996.
2009.
2010.
ANNIVERSARIA
Udine. Fr. Lorenzo M. Cazzola, presb., a. 81, r. 60.
Cuneo. Fr. Giuseppe M. Garelli, presb., a. 74, r. 57.
Saluzzo. Fr. Felice M. Savio, presb., a. 83, r. 66.
Vicenza. Fr. Carlo M. Turati, presb., a. 87, r. 69.
15. Alb. Feria II hebd. XXVIII per annum (IV Psalt.).
S. Teresiae a Iesu V. D., memoria.
MISSA memoriae.
L 1 Gal 4, 22-24. 26-27. 31 – 5, 1; Ps 112, 1-2. 3-4. 5a
et 6-7.
Ev Lc 11, 29-32.
ANNIVERSARIA
1982. Chicago. Fr. Aurelius M. Capra, presb., a. 90, r. 51.
1985. Blue Island. Fr. Terence M. O’Connor, presb., a. 67, r. 47.
226
TEMPUS PER ANNUM
16. Vir. Feria III hebd. XXVIII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Hedvigis Rel. Vel:
Alb. S. Margaritae M. Alacoque V.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 5, 1-6; Ps 118, 41. 43. 44. 45. 47. 48.
Ev Lc 11, 37-41.
ANNIVERSARIA
1962. Ala (Trento). Fr. Clemens M. Gleinzer, presb., a. 47, r. 30.
1975. Bologna. Fr. Paolo M. Gabrielli, presb., a. 87, r. 71.
1979. Roma. Fr. Alessio M. Cuttano, a. 77, r. 34.
1984. Orvieto. Fr. Michele M. Feudo, presb., a. 68, r. 51.
2010. Negrar. Fr. Agostino M. Rizzotto, presb., a. 87, r. 67.
2010. Negrar. Ep. Aldo M. Lazzarin, a. 83, r. 67.
17. Rub. Feria IV hebd. XXVIII per annum (IV Psalt.).
S. Ignatii Antiocheni E. M., memoria.
OCTOBER 2012
227
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1974. Wien. Fr. Martin M. Schulz, a. 83, r. 58.
1981. Budapest. Fr. Peregrin M. Quikker, presb., a. 67, r. 44.
2008. Manduria. Fr. Raffaele M. Bonaldo, presb., a. 83, r. 58.
19. Vir. Feria VI hebd. XXVIII per annum (IV Psalt.).
De ea. Vel:
Rub. Ss. Ioannis de Brébeuf P. et Isaac Jogues P. et
Soc. Mm. Vel:
Alb. S. Pauli a Cruce P.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 1, 11-14; Ps 32, 1-2. 4-5. 12-13.
Ev Lc 12, 1-7.
MISSA memoriae.
L 1 Gal 5, 18-25; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 11, 42-46.
ANNIVERSARIA
1976. Klagenfurt. Fr. Magnus M. Herbst, presb., a. 69, r. 50.
1988. Ottawa. Fr. Denis M. Fortin, presb., a. 56, r. 35.
1988. Bologna. Fr. Marco M. Brunori, a. 86, r. 66.
18. Rub. Feria V. S. LUCAE EVANG., festum. – Ad H.
m. ant. et pss. feriae V hebd. IV.
MISSA pr., Gloria, lect. pr., pf. II App.
L 1 2 Tim 4, 10-17b; Ps 144, 10-11. 12-13ab. 17-18.
Ev Lc 10, 1-9.
In Canada festum Ss. Ioannis de Brébeuf P. et Isaac Jogues
P. et Soc. Mm. die 26 septembris celebratur.
Hodie dies anniversaria electionis fratris ÁNGEL M. RUIZ
GARNICA ad Prioris generalis munus recurrit. Impensas
Deo effundamus preces ut, Domina nostra intercedente,
eum, qui universae Servorum Familiae praeest eiusdemque
exsistit unitatis signum, custodiat atque caelestibus repleat
muneribus.
228
TEMPUS PER ANNUM
ANNIVERSARIA
1997. Siteki. Fr. Michael M. Tsabedze, presb., a. 59, r. 33.
20. Alb. Sabb. hebd. XXVIII per annum (IV Psalt.).
De S. Maria in sabb., memoria.
OCTOBER 2012
1972.
1995.
1997.
2000.
229
ANNIVERSARIA
Ottawa. Fr. Jérôme M. Ferraro, presb., a. 53, r. 35.
Chicago. Fr. Tommaso M. Ferrazzi, presb., a. 83, r. 67.
Portland. Fr. Lawrence M. Calkins, presb., a. 86, r. 68.
Wheeling. Fr. Louis M. Cortney, presb., a. 86, r. 67.
MISSA memoriae.
L 1 Eph 1, 15-23; Ps 8, 2-3a. 4-5. 6-7.
Ev Lc 12, 8-12.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 33: Beata Maria Virgo, mater boni consilii.
I VESPERAE dom. – Cp. post I Vp. dom.
1967.
1980.
1983.
1988.
1996.
2008.
ANNIVERSARIA
Knightsville. Fr. Matthew M. Steiger, a. 23, r. 4.
Saluzzo. Fr. Pio M. Mussi, presb., a. 72, r. 53.
Napoli. Fr. Luigi M. Coluzzi, presb., a. 73, r. 56.
Fullerton. Fr. Joseph Steven M. Gibbons, presb., a. 68, r. 48.
Moretta (Cuneo). Fr. Fedele M. Banchio, presb., a. 83, r. 66.
Negrar. Fr. Giovanni M. Apolloni, presb., a. 91, r. 71.
21. Vir. DOM. XXIX PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 53, 10-11; Ps 32, 4-5. 18-19. 20 et 22.
L 2 Hebr 4, 14-16.
Ev Mc 10, 35-45 vel 10, 42-45.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
DIES MISSIONUM
Recurrente, hac die, dominica ad commemorandum
opus missionum dicata, dici potest Missa «Pro evan-
gelizatione populorum», prouti in Missali Romano
indicatur.
22. Vir. Feria II hebd. XXIX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 2, 1-10; Ps 99, 2. 3. 4. 5.
Ev Lc 12, 13-21.
ANNIVERSARIA
1987. Kersal. Fr. Charles M. Cunningham, presb., a. 76, r. 53.
1988. Bologna. Fr. Tommaso M. Santi, presb., a. 76, r. 59.
2005. Chicago. Fr. Matthew M. Ford, presb., a. 83, r. 63.
23. Vir. Feria III hebd. XXIX per annum (I Psalt.).
De ea. Vel:
Alb. S. Ioannis de Capestrano P.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 2, 12-22; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 12, 35-38.
230
TEMPUS PER ANNUM
ANNIVERSARIA
1984. Roma. Fr. Camillo M. Bartolomei, presb., a. 86, r. 68.
1985. Wheeling. Fr. Tibor M. Furák, presb., a. 59, r. 38.
2007. Portland. Fr. Louis M. Breton, presb., a. 85, r. 64.
24. Vir. Feria IV hebd. XXIX per annum (I Psalt.).
De ea. Vel:
Alb. S. Antonii M. Claret E., O.S.S.M.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 3, 2-12; Ps Is 12, 2-3. 4bcd. 5-6.
Ev Lc 12, 39-48.
ANNIVERSARIA
1997. Mtubatuba. Fr. Malachy M. Skelton, presb., a. 63, r. 44.
25. Alb. Feria V hebd. XXIX per annum (I Psalt.).
B. Ioannis Angeli Porro, presbyteri O.N., memoria.
MISSA memoriae.
L 1 Eph 3, 14-21; Ps 32, 1-2. 4-5. 11-12. 18-19.
Ev Lc 12, 49-53.
ANNIVERSARIA
2007. Borgorose. Fr. Mauro M. De Sanctis, presb., a. 71, r. 50.
26. Vir. Feria VI hebd. XXIX per annum (I Psalt.).
De ea.
OCTOBER 2012
231
ANNIVERSARIA
1974. Winfield. Fr. Clement M. Hanley, presb., a. 61, r. 42.
1976. Rovato. Fr. Giuseppe M. Gallo, a. 67, r. 38.
27. Alb. Sabb. hebd. XXIX per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Eph 4, 7-16; Ps 121, 1-2. 3-4a. 4b-5.
Ev Lc 13, 1-9.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 39: Sancta Maria, regina et mater misericordiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1974. Siracusa. Fr. Ambrogio M. Rugginenti, presb., a. 68, r. 44.
1989. Goma (Zaïre). Fr. Camille M. Homan, presb., a. 66, r. 47.
28. Vir. DOM. XXX PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ier 31, 7-9; Ps 125, 1-2ab. 2cd-3. 4-5. 6.
L 2 Hebr 5, 1-6.
Ev Mc 10, 46-52.
MISSA ad libitum (cf. p. XVIII). Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Simonis et Iudae App. festum omittitur.
L 1 Eph 4, 1-6; Ps 23, 1-2. 3-4ab. 5-6. II VESPERAE dominicae. – Cp. post II Vp. dom.
Ev Lc 12, 54-59.
232
TEMPUS PER ANNUM
ANNIVERSARIA
1977. Milano. Fr. Luigi M. Biotto, a. 61, r. 42.
1990. Turvo. Fr. Girolamo M. Amigoni, presb., a. 73, r. 53.
2002. Negrar. Fr. Valentino M. Ravagnolo, a. 90, r. 64.
29. Vir. Feria II hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 4, 32 – 5, 8; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 13, 10-17.
1964.
1967.
1975.
1983.
1999.
ANNIVERSARIA
Vicenza. Fr. Angelo M. Saggin, presb., a. 72, r. 43.
Montréal. Fr. Bonfilius M. Dubois, presb., a. 56, r. 37.
Spello. Fr. Urbano M. Bataloni, presb., a. 60, r. 44.
London. Fr. Francis M. McEnerney, presb., a. 87, r. 68.
Wien. Fr. Hugo M. Körbel, presb., a. 76, r. 58.
30. Vir. Feria III hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 5, 21-33; Ps 127, 1-2. 3. 4-5.
Ev Lc 13, 18-21.
ANNIVERSARIA
1962. Arco. Fr. Tarcisio M. Sgarabotto, presb., a. 65, r. 46.
1978. Ottawa. Fr. Pérégrin M. Chénier, a. 68, r. 44.
2007. Marina di Massa. Fr. Sebastiano M. Ferrari, presb., a. 92,
r. 76.
OCTOBER 2012
233
31. Vir. Feria IV hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 6, 1-9; Ps 144, 10-11. 12-13ab. 13cd-14.
Ev Lc 13, 22-30.
I VESPERAE soll. Omnium Sanctorum. – Cp. post I
Vp. dom.
ANNIVERSARIA
1976. Roma. Fr. Alfonso M. Gallina, a. 67, r. 46.
NOVEMBER 2012
NOVEMBER 2012
1. Alb. Feria V. OMNIUM SANCTORUM, sollemnitas.
– Ad H. m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Apoc 7, 2-4. 9-14; Ps 23, 1-2. 3-4ab. 5-6.
L 2 1 Io 3, 1-3.
Ev Mt 5, 1-12a.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
Celebratio Vesperarum defunctorum post II Vesperas diei
1 nov., quae pro pietate fidelium peragi consuevit, conti-
nuari potest, una cum aliis piis exercitiis forsitan consue-
tudine traditis, tamquam peculiare pietatis obsequium.
Plenaria indulgentia, animabus in Purgatorio detentis tan-
tummodo applicabilis, conceditur christifideli qui 1) sin-
gulis diebus, a primo usque ad octavum novembris, coe-
meterium devote visitaverit et, vel mente tantum, pro
defunctis exoraverit; 2) die Commemorationis omnium
fidelium defunctorum (vel, de consensu Ordinarii, die
Dominico antecedenti aut subsequenti aut die sollemnita-
tis Omnium Sanctorum) ecclesiam aut oratorium pie visi-
taverit ibique recitaverit Pater et Credo.
Partialis indulgentia, animabus in Purgatorio detentis tan-
tummodo applicabilis, conceditur christifideli qui, 1) coe-
meterium devote visitaverit et, vel mente tantum, pro
defunctis exoraverit; 2) Laudes vel Vesperas Officii defuncto-
rum, vel invocationem Requiem aeternam devote recitaverit
(Enchiridion Indulgentiarum, ed. 1999, concessio n. 29).
235
ANNIVERSARIA
1992. Montréal. Fr. François M. Bertrand, presb., a. 81, r. 58.
1993. Chicago. Fr. Thomas M. Keenan, presb., a. 82, r. 63.
2. Viol. vel Nig. Feria VI. IN COMM. OMNIUM FIDE-
LIUM DEFUNCTORUM. Off. ut in Com. et Pr.
MISSA pr., pf. def.
Lectiones seligendae sunt ex iis quae in lectionario defunc-
torum proponuntur.
Ex Constitutione Apostolica Benedicti Pp. XV (10 aug.
1915), hodie licet omnibus sacerdotibus tres Missas cele-
brare aut concelebrare, dummodo celebrationes diversis
temporibus fiant; ea tamen lege, ut unam e tribus cui-
cumque maluerint applicare et pro ea stipem percipere
queant; teneantur vero, nulla stipe percepta, applicare alteram
Missam in suffragium omnium fidelium defunctorum, ter-
tiam ad mentem Summi Pontificis.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, excepta Missa
exsequiali.
ANNIVERSARIA
1964. Avellaneda. Fr. Victorio M. Cordero, a. 72, r. 30.
1966. Arco. Fr. Alessio M. Zanotto, a. 53, r. 18.
1996. Pesaro. Fr. Tarcisio M. Ceciliani, presb., a. 81, r. 63.
3. Alb. Sabb. hebd. XXX per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
236
TEMPUS PER ANNUM
L 1 Phil 1, 18b-26; Ps 41, 2. 3. 5bcd.
Ev Lc 14, 1. 7-11.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 31: Beata Maria Virgo, fons salutis.
NOVEMBER 2012
237
L 1 Phil 2, 1-4; Ps 130, 1. 2. 3.
Ev Lc 14, 12-14.
ANNIVERSARIA
1975. Roma. Fr. Vincenzo M. Buffon, presb., a. 61, r. 45.
2009. Marina di Massa. Fr. Lino M. Dalle Lucche, presb., a. 96,
r. 73.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Firenze. Fr. Roberto M. Mancuso, presb., a. 28, r. 8.
6. Vir. Feria III hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
4. Vir. DOM. XXXI PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Deut 6, 2-6; Ps 17, 2-3a. 3bc-4. 47 et 51ab.
L 2 Hebr 7, 23-28.
Ev Mc 12, 28b-34.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Caroli Borromeo E. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1974.
1982.
1987.
2006.
ANNIVERSARIA
Trapani. Fr. Giuseppe M. Mazziotta, a. 60, r. 32.
Ancona. Fr. Ivano M. Fabbri, a. 30, r. 9.
São Paolo. Fr. Denis M. McSwiney, presb., a. 35, r. 13.
Negrar. Fr. Vincenzo M. Zanotto, presb., a. 84, r. 65.
5. Vir. Feria II hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 2, 5-11; Ps 21, 26b-27. 28-30a. 31-32.
Ev Lc 14, 15-24.
ANNIVERSARIA
1968. Portland. Fr. Augustine M. Riesenmy, presb., a. 88, r. 59.
7. Vir. Feria IV hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 2, 12-18; Ps 26, 1. 4. 13-14.
Ev Lc 14, 25-33.
ANNIVERSARIA
1996. Pesaro. Fr. Domenico M. Nicolai, presb., a. 60, r. 41.
8. Vir. Feria V hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 3, 3-8a; Ps 104, 2-3. 4-5. 6-7.
Ev Lc 15, 1-10.
238
TEMPUS PER ANNUM
In Uruguay:
7. I VESPERAE soll. – Cp. post I Vp. dom.
8. Alb. Feria V. «PURISIMA VIRGEN DE LOS TREINTA
Y TRES, PATRONA PRINCIPAL DE LA REPUBLICA
ORIENTAL DEL URUGUAY», sollemnitas. – Ad H. m.
ant. pr. cum psalmodia complementari.
Missa pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
NOVEMBER 2012
1971.
1987.
1988.
1994.
1996.
2003.
2010.
239
ANNIVERSARIA
Joliet. Fr. Vincent M. Scheltinga, presb., a. 71, r. 51.
Pesaro. Fr. Bruno M. Torelli, presb., a. 66, r. 49.
Nola. Fr. Mariano M. Casoria, presb., a. 73, r. 55.
Avellaneda. Fr. Ruggero M. Scortegagna, a. 79, r. 58.
Roma. Fr. Alberto M. Tuccimei, presb., a. 66, r. 6.
Montréal. Fr. Étienne M. Gagnon, presb., a. 83, r. 62.
Vicenza. Fr. Costanzo M. Simoni, presb., a. 87, r. 67.
10. Alb. Sabb. hebd. XXXI per annum (III Psalt.).
S. Leonis Magnis Pp. D., memoria.
MISSA memoriae.
L 1 Phil 4, 10-19; Ps 111, 1-2. 5-6. 8a et 9.
Ev Lc 16, 9-15.
ANNIVERSARIA ANNIVERSARIA
1971. Nepi. Fr. Nazareno M. Mecarocci, a. 80, r. 39. 1974. Innsbruck. Fr. Bonajunkta M. Schönauer, a. 66, r. 46.
1999. Siteki. Fr. Augustine M. Magongo, presb., a. 45, r. 23. 2000. Nepi. Fr. Tommaso M. Brigotti, presb., a. 79, r. 63.
2008. Genova. Fr. Bruno M. Reverberi, presb., a. 88, r. 70. 2006. Ronzano. Fr. Bruno M. Quercetti, presb., a. 71, r. 50.
9. Alb. Feria VI. IN DEDICATIONE BASILICAE 11. Vir. DOM. XXXII PER ANNUM (Hebd. IV Psalt.).
LATERANENSIS, festum. – Ad H. m. ant. et pss. De ea.
feriae VI hebd. III.
MISSA de festo, Gloria, lect. pr., pf. pr.
L 1 Ez 47, 1-2. 8-9. 12 vel 1 Cor 3, 9c-11. 16-17;
Ps 45, 2-3. 5-6. 8-9.
Ev Io 2, 13-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Reg 17, 10-16; Ps 145, 7. 8-9a. 9bc-10.
L 2 Hebr 9, 24-28.
Ev Mc 12, 38-44 vel 12, 41-44.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Martini Turonensis E. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
240
TEMPUS PER ANNUM
12. Rub. Feria II hebd. XXXII per annum (IV Psalt.).
S. Iosaphat E. M., memoria.
MISSA memoriae.
L 1 Tit 1, 1-9; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 17, 1-6.
DIES MISSIONIS
Missio Ingwavuma in regione Zululand, die 12 novem-
bris 1963 in Praefecturam apostolicam erecta, hodie
Diem Missionis celebrat.
Fratres et sorores Ordinis nostri in celebratione
Liturgiae Horarum necnon Sacrificii eucharistici
Deum enixe exorent ut operam missionariorum con-
firmet et Ecclesiae, quae est in illa regione, foveat
incrementum.
ANNIVERSARIA
1966. Mestre. Fr. Lino M. Pedot, presb., a. 54, r. 38.
2002. Pestrino-Verona. Fr. Davino M. Trento, presb., a. 70, r. 50.
13. Vir. Feria III hebd. XXXII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Tit 2, 1-8. 11-14; Ps 36, 3-4. 18 et 23. 27 et 29.
Ev Lc 17, 7-10.
14. Vir. Feria IV hebd. XXXII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
NOVEMBER 2012
241
L 1 Tit 3, 1-7; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Lc 17, 11-19.
ANNIVERSARIA
1972. Saluzzo. Fr. Giorgio M. Capello, presb., a. 67, r. 51.
1994. Wien. Fr. Philipp M. Thaler, presb., a. 66, r. 45.
2003. Genova. Fr. Lorenzo M. Borio, presb., a. 87, r. 69.
15. Vir. Feria V hebd. XXXII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Alberti Magni E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Phm 7-20; Ps 145, 7. 8-9a. 9bc-10.
Ev Lc 17, 20-25.
ANNIVERSARIA
1976. Caracas. Fr. Enrico M. Filippin, presb., a. 67, r. 48.
1987. Saluzzo. Fr. Gioacchino M. Pappini, a. 75, r. 48.
1988. Córdoba. Fr. Rafael M. Nadales Bonilla, presb., a. 61, r. 38.
16. Alb. Feria VI. OMNIUM SANCTORUM O.N.,
festum. – Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 1 Cor 12, 4-13 vel Apoc 7, 13-17; Ps 99, 2. 3. 4. 5.
Ev Lc 12, 22-32.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Margaritae Scotiae et Gertrudis V. memoriae omittuntur.
ANNIVERSARIA
1979. Orense. Fr. Gioacchino M. Montà, presb., a. 55, r. 38.
2002. Sainte-Foy. Fr. Anselme M. Desjardins, presb., a. 85, r. 67.
242
243
TEMPUS PER ANNUM NOVEMBER 2012
17. Viol. vel Nig. Sabb. IN COMMEMORATIONE 18. Vir. DOM. XXXIII PER ANNUM (Hebd. I Psalt.).
OMNIUM FRATRUM, SORORUM, PROPIN- De ea.
QUORUM BENEFACTORUMQUE O.N. DE-
FUNCTORUM.
Officium pr.
MISSA pr., lect. pr., pf. pr.
L 1 Rom 14, 7-9; Ps 114, 3-4. 5-6; 115, 15-16.
Ev Mt 25, 31-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, excepta Missa
exsequiali.
S. Elisabeth Hungariae Rel. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
Ubi debita facultate impetrata, haec Commemoratio in
aliam diem transfertur.
17. Alb. Sabb. hebd. XXXII per annum (IV Psalt.).
S. Elisabeth Hungariae Rel., memoria.
MISSA memoriae.
L 1 3 Io 5-8; Ps 111, 1-2. 3-4. 5-6.
Ev Lc 18, 1-8.
I VESPERAE dom. – Cp. post I Vp. dom.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Dan 12, 1-3; Ps 15, 5 et 8. 9-10. 11.
L 2 Hebr 10, 11-14. 18.
Ev Mc 13, 24-32.
Prohibentur Missae defunctorum, excepta exsequiali.
In Dedicatione basilicarum Ss. Petri et Pauli App. memoria
omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1992.
1993.
2006.
2009.
ANNIVERSARIA
Roma. Fr. Giovanni M. Catena, presb., a. 73, r. 57.
Avellino. Fr. Alessio M. Crispo, presb., a. 79, r. 63.
Manchester. Fr. Kevin M. Donaghey, preb., a. 72, r. 53.
Roma. Fr. Giovanni M. Marini, presb., a. 87, r. 68.
19. Vir. Feria II hebd. XXXIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 1, 1-4; 2, 1-5a; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 18, 35-43.
20. Vir. Feria III hebd. XXXIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
ANNIVERSARIA
2002. Gutenstein. Fr. Albert M. Guggenberger, presb., a. 92, r. 74.
L 1 Apoc 3, 1-6. 14-22; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Lc 19, 1-10.
244
TEMPUS PER ANNUM
NOVEMBER 2012
DIES CONGREGATIONIS
1963.
1963.
1986.
1996.
2000.
2009.
DIES MONIALUM O.S.M.
Congregatio Sororum cui est titulus Serve di Maria
Ss. Addolorata (Firenze), hanc diem, qua, anno 1873,
M. Iuliana Signorini (1815-1873), Congregationis
Fundatrix, ad caelestem patriam migravit, tamquam
Diem Congregationis celebrat. Anno 1876 die 27
martii Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deo gratias agant et pro bono atque incremen-
to Instituti fraternas effundant preces.
245
Ex constituto Ecclesiae, quod antiquam respicit tra-
ditionem tum Orientis tum Occidentis, memoria
Praesentationis B. Mariae Virginis celebratur ut dies
«Pro orantibus».
Hac die ergo pro Monialibus Ordinis nostri (Madrid,
Mislata, Sagunto [Hispania], Arco, Carpenedo di
Mestre, Montecchio, Pesaro, Roma, Sant’Angelo in
Vado, Verona [Italia], München [Germania], Celaya
[México], Nampula, Lichinga, Chokwe [Moçambique])
quae cotidie pro tota Servorum Familia Deum exorant,
supplices effundamus preces.
ANNIVERSARIA
Ottawa. Fr. Ubald M. Furlan, presb., a. 41, r. 16.
Ottawa. Fr. André M. Lalancette, presb., a. 35, r. 17.
Bologna. Fr. Gerardo M. Maestrami, presb., a. 58, r. 42.
Guadalajara. Fr. Marcos M. Romero Díaz, presb., a. 60,
r. 37.
Oruro. Fr. Alfonso M. Massignani, presb., a. 79, r. 61.
Civita Castellana. Fr. Roberto M. Fagioli, presb., a. 91,
r. 74.
21. Alb. Feria IV hebd. XXXIII per annum (I Psalt.).
In Praesentatione B. Mariae V., memoria.
MISSA memoriae, lect. pr., pf. B. Mariae V.
L 1 Zac 2, 14-17; Ps Lc 1, 46-47. 48-49. 50-51. 52-53.
54-55.
Ev Mt 12, 46-50.
ANNIVERSARIA
2003. Dundee. Fr. Nicholas M. Martin, presb., a. 59, r. 41.
2008. Portland. Fr. Patrick M. McNamara, presb., a. 88, r. 65.
22. Rub. Feria V hebd. XXXIII per annum (I Psalt.).
S. Ceciliae V. M., memoria.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 5, 1-10; Ps 149, 1-2. 3-4. 5-6a et 9b.
Ev Lc 19, 41-44.
ANNIVERSARIA
1984. Roma. Fr. Gabriele M. Berardi, presb., a. 72, r. 54.
1985. Berkeley. Fr. Neal M. Flanagan, presb., a. 65, r. 47.
2001. Siteki. Fr. Thomas Mdolomba M. Zwane, presb., a. 36,
r. 12.
NOVEMBER 2012
CCC
ANNUS AB OBITU ARCANGELAE BIONDINI, MONIALIS
SERVAE MARIAE, MONASTERII OPPIDI ARCI FUNDATRICIS
247
23. Vir. Feria VI hebd. XXXIII per annum (I Psalt.).
De ea. Vel:
Rub. S. Clementis I Pp. M. Vel:
Alb. S. Columbani Abb.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 10, 8-11; Ps 118, 14. 24. 72. 103. 111. 131.
Ev Lc 19, 45-48.
Anno 1712, die 23 novembris, Arci, in dioecesi tridentina, obiit Arcangela
Biondini, monialis serva Mariae. Anno 1655, in Monasterium Servarum
Mariae oppidi Burani (Venetiis) ingressa est ibique commorata est multos
per annos, fungens quoque munere antistitae. Anno 1689 in oppidum
Arcum (dioeceseos Tridentinae) se contulit atque monaterium condidit,
cuius Contitutiones probatae sunt anno 1699 a Innocentio XII (+1700).
Arcangelae Biondini complures scripta spiritualia exstant, in quibus iussu
episcopi Blasii Fragiorgi (+1707) patris spiritualis, aliqua facta quae mysti-
ce experta erat enarravit.
Il 23 novembre 1712 morì ad Arco (Trento) suor Arcangela Biondini,
monaca serva di Maria. Essa era entrata nel 1655 nel monastero delle
Serve di Maria di Burano (Venezia) dove rimase molte anni ricoprendo
l’ufficio di abbadessa. Nel 1689 si trasferì ad Arco (Trento) per fondarvi
un monastero, le cui Costituzioni furono approvate nel 1699 dal papa
Innocenzo XII (+1700). Di Arcangela Biondini si conservano molti scrit-
ti spirituali, in cui, per ordine del vescovo Biagio Fragiorgi (+1707), suo
direttore spirituale, narrò alcune esperienze mistiche da lei vissute.
On 23 November 1712, Sister Arcangela Biondini, a Servite nun, died at
Arco (Trento). In 1655 she entered the Servite monastery of Burano (Venice)
where she remained for many years serving as abbess. In 1689 she moved to
Arco (Trento) to found a monastery whose Constitutions were approved by
Pope Innocent XII(+1700). Many of Arcangela Biondini’s spiritual writings
still exist, including some in which, at the order of Bishop Biagio Fragiorgi
(+1707), her spiritual director, she narrated several mystical experiences.
1983.
1988.
1996.
2008.
2010.
ANNIVERSARIA
Wien. Fr. Innozenz M. Krub, presb., a. 83, r. 63.
Milano. Fr. Matteo M. Beretta, a. 73, r. 50.
Tirano. Fr. Ferdinando M. Malva, presb., a. 84, r. 65.
San Marino. Fr. Tarcisio M. Turchetti, presb., a. 88, r. 70.
Perth. Fr. Francis M. Christie, presb. a. 83, r. 60.
24. Rub. Sabb. hebd. XXXIII per annum (I Psalt.).
Ss. Andreae Dung-Lac P. et Soc. Mm., memoria.
MISSA memoriae.
L 1 Apoc 11, 4-12; Ps 143, 1. 2. 9-10.
Ev Lc 20, 27-40.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Vicenza. Fr. Fulvio M. Mondin, presb., a. 59, r. 39.
1973. Innsbruck. Fr. Ambros M. Dangel, presb., a. 82, r. 64.
1996. Livorno. Fr. Filippo M. Grigioni, presb., a. 75, r. 49.
25. Alb. Dominica. D. N. IESU CHRISTI UNIVER-
SORUM REGIS, sollemnitas. – Ad H. m. ant. pr.
cum psalmodia dom. hebd. II.
248
TEMPUS PER ANNUM
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Dan 7, 13-14; Ps 92, 1ab. 1c-2. 5.
L 2 Apoc 1, 5-8.
Ev Io 18, 33b-37.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Catharinae de Alexandria V.M. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. Padova. Fr. Alfonso M. Galarce Ayala, a. 28, r. 1.
1969. Oderzo. Fr. Mariano M. Mattiussi, a. 62, r. 38.
2000. Denver. Fr. Roger M. Manning, presb., a. 81, r. 61.
26. Vir. Feria II hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 14, 1-3. 4b-5; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 21, 1-4.
27. Vir. Feria III hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 14, 14-19; Ps 95, 10. 11-12. 13.
Ev Lc 21, 5-11.
ANNIVERSARIA
2005. Innsbruck. Fr. Lukas M. Huber, presb., a. 63, r. 43.
28. Vir. Feria IV hebd. XXXIV per annum (II Psalt.).
De ea.
NOVEMBER 2012
249
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 15, 1-4; Ps 97, 1. 2-3ab. 7-8. 9.
Ev Lc 21, 12-19.
ANNIVERSARIA
1974. Montevideo. Fr. Giovanni M. Gonzo, presb., a. 60, r. 41.
29. Vir. Feria V hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 18, 1-2. 21-23; 19, 1-3. 9a; Ps 99, 2. 3. 4. 5.
Ev Lc 21, 20-28.
ANNIVERSARIA
1985. Poschiavo. Fr. Giuseppe M. Ferin, presb., a. 77, r. 59.
30. Rub. Feria VI. S. ANDREAE AP., festum. – Ad H.
m. ant. de temp. et pss. feriæ VI, hebd. II.
De ea.
© MISSA pr., Gloria, lect. pr., pf. App.
L 1 Rom 10, 9-18; Ps 18, 2-3. 4-5.
Ev Mt 4, 18-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
Langegg. Fr. Ignaz M. Millik, presb., a. 91, r. 72.
Saviano. Fr. Girolamo M. Russo, presb., a. 85, r. 67.
Montréal. Fr. Armand M. Gaudreau, presb., a. 65, r. 43.
Gelsenkirchen-Buer. Fr. Gabriel M. Kurzenhäuser, presb.,
a. 62, r. 38.
2010. Viareggio. Fr. Luigi M. De Vittorio, presb., a. 80, r. 63.
1968.
1970.
1992.
2001.
DECEMBER 2012
TEMPUS ADVENTUS
1. Alb. Sabb. hebd. XXXIV per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Apoc 22, 1-7; Ps 94, 1-2. 3-5. 6-7.
Ev Lc 21, 34-36.
DECEMBER 2012
02. Dominica
03. Feria II
04. Feria III
Vel: 05. Feria IV
Una e missis CMBMV Temp. per annum, praesertim 06. Feria V
form. n. 46: Beata Maria Virgo, ianua caeli.
ANNIVERSARIA 07. Feria VI
1976. El Paso. Fr. Tarcisio M. Bressan, a. 62, r. 43. 08. Sabbato
2001. México. Fr. Giovannangelo M. Gasperini Tomasel, presb.,
a. 85, r. 64.
Explicit tempus per annum.
A sequenti dominica prima Adventus sumitur Lectiona-
rium festivum, Anno C.
N.B. – Utilitatis causa praebentur, paginis sequentibus,
indicationes fundamentales pro celebrationibus usque ad
diem 31 decembris 2012 occurrentibus.
09. Dominica
10. Feria II
11. Feria III
12. Feria IV
13. Feria V
14. Feria VI
15. Sabbato
16. Dominica
17. Feria II
18. Feria III
De Dominica I Adventus.
S. Francisci Xavier P., memoria.
De feria Adventus. Vel:
S. Ioannis Damasceni P. D.
De feria Adventus.
De feria Adventus. Vel:
S. Nicolai E.
S. Ambrosii E. D., memoria.
In Conceptione Immaculata
B. Mariae V., sollemnitas.
De Dominica II Adventus.
De feria Adventus. Vel:
B. Hieronymi de Sancto Angelo
in Vado Presb. O.N.
De feria Adventus. Vel:
S. Damasi I Pp.
De feria Adventus. Vel:
B. Mariae Virginis de Guadalupe.
S. Luciae V. M., memoria.
S. Ioannis a Cruce, memoria.
De feria Adventus. Vel:
B. Bonaventurae de Pistorio P. O.N.
De Dominica III Adventus.
De feria Adventus.
De feria Adventus.
19. Feria IV
20. Feria V
21. Feria VI
22. Sabbato
23. Dominica
24. Feria II
De feria Adventus.
De feria Adventus.
De feria Adventus.
Comm. S. Petri Canisii P. D.
De feria Adventus.
De Dominica IV Adventus.
De feria Adventus.
TEMPUS NATIVITATIS
DECEMBER 2012
24. Feria II
25. Feria III
26. Feria IV
27. Feria V
28. Feria VI
29. Sabbato
30. Dominica
31. Feria II
Vespere:
MISSA Vigiliaris de Nativitate Domini.
In Nativitate Domini, sollemnitas.
S. Stephani Protomart., festum
S. Ioannis Ap. et Evang., festum.
S. Innocentium Mart., festum.
De V die infra octavam Nativ.
Comm. S. Thomae Becket.
S. Familiae Iesu, Mariae et Ioseph, festum
De VII die infra octavam Nativ.
Comm. S. Silvestri I Pp.
CALENDARIUM PERPETUUM
ORDINIS FRATRUM SERVORUM
BEATÆ MARIÆ VIRGINIS
IANUARIUS
12 S. ANTONII MARIÆ PUCCI, PRESBYTERI O.N.,
15 B. Iacobi de Villa, Eleemosynarii nuncupati *
FEBRUARIUS
3 B. Ioachimi Senensis, religiosi O.N.
17 SS. SEPTEM PATRUM FUNDATORUM O.N.
19 B. Elisabeth Picenardi, virginis O.N.
MARTIUS
19 S. IOSEPH, SPONSI BEATÆ MARIÆ VIRGINIS,
O.N. PATRONUS SECUNDARIUS
Feria VI post dominicam V Quadragesimæ:
B. MARIÆ VIRGINIS IUXTA CRUCEM
4
8
11
12
30
MAIUS
S. PEREGRINI LAZIOSI, RELIGIOSI O.N.
B. Mariæ Virginis gratiæ Matris ac Mediatricis
B. Benincasæ, religiosi O.N.
B. Francisci Senensis, presbyteri O.N.
B. Iacobi Philippi Bertoni, presbyteri O.N.
IUNIUS
19 S. M. IULIANÆ FALCONIERI, VIRGINIS O.N.
(Pro Monialibus et Sororibus:
27 B. Thomæ de Urbe Veteri, religiosi O.N.
IULIUS
1 B. Ferdinandi Mariae Baccilieri, presbyteri, Fundatoris
Servarum Mariae Galeazzae
(Pro sororibus Servis Mariae Galeazzae:
4 B. Ubaldi de Burgo Sancti Sepulcri, presbyteri O.N.
13 S. Cleliæ Barbieri, virginis, Fundatricis
Minimarum B.M.V. Perdolentis,
(Pro Sororibus Minimis B. Mariae V. Perdolentis:
* Quando non indicatur gradus celebrationis, fit memoria ad libitum
Festum
Memoria
Sollemnitas
Memoria
Sollemnitas
Festum
Festum
Memoria
Memoria
Festum
Sollemnitas)
Festum)
Memoria
Sollemnitas)
AUGUSTUS
23 S.P.N. PHILIPPI BENIZI, O.N. PROPAGATORIS INSIGNIS, PRESBYTERI
28 S. AUGUSTINI, EPISCOPI ET ECCLESIÆ DOCTORIS ATQUE
LEGISLATORIS NOSTRI
31 B. Andreæ de Burgo Sancti Sepulcri, religiosi O.N.
SEPTEMBER
1 B. Ioannæ de Florentia, virginis O.N.
(Pro Monialibus et Sororibus:
5 B. Mariae Magdalenae Starace, Virg. O.N., Fundatricis
Congregationis Sororum Servarum Mariae a Compassione
(Pro sororibus Servis Mariae a Compassione:
6 B. Bonaventuræ de Foro Livii, presbyteri O.N.
15 B. MARIÆ VIRGINIS PERDOLENTIS,
O.N. PATRONÆ PRINCIPALIS
22 In Dedicatione Basilicæ sacri Conventus Montis Senarii
OCTOBER
3 B. M. Guadalupe Ricart Olmos, virginis et martyre O.N.
(Pro Monialibus:
25 B. Ioannis Angeli Porro, presbyteri O.N.
Festum
Festum
Memoria)
Festum)
Memoria
Sollemnitas
Memoria
Memoria
Festum)
Memoria
NOVEMBER
16 OMNIUM SANCTORUM O.N.
17 IN COMMEMORATIONE OMNIUM FRATRUM, SORORUM,
PROPINQUORUM BENEFACTORUMQUE O.N. DEFUNCTORUM 1
Festum
DECEMBER
10 B. Hieronymi de Sancto Angelo in Vado, presbyteri O.N.
15 B. Bonaventuræ de Pistorio, presbyteri O.N.
MISSA DE S. MARIA IN SABBATO celebratur:
- Tempore Adventus usque ad diem 16 decembris inclusive, ut memoria obliga-
toria, nisi alia memoria obligatoria occurrat;
- Tempore Nativitatis, ut memoria ad libitum, nisi memoria obligatoria occurat;
- Tempore Paschali, ut memoria ad libitum, nisi memoria obligatoria occurrat;
- Tempore per Annum, ut memoria obligatoria, nisi alia memoria obligatoria
occurrat.
1 Nisi Provincia, iusta de causa, debita facultate impetrata, alium diem statuerit.
INDEX
Explicatio abbreviationum …………………………………. III
Pro Calendario anni liturgici 2010-2011 ………………..V
Tabula dierum liturgicorum ……………………………… VIII
De Anno Liturgico et de Calendario…………………….. XI
De Celebratione Eucharistica……………………………… XII
Tabula missis ritualibus …………………………………….. XV
De Liturgia Horarum ………………………………………. XX
Tempus Adventus ……………………………………………….. 1
Tempus Nativitatis ……………………………………………. 17
Tempus per annum (ante Quadragesimam) ………….. 33
Tempus Quadragesimae …………………………………….. 57
Hebdomada Sancta ……………………………………………. 83
Triduum Paschale ……………………………………………… 90
Tempus Paschale ……………………………………………….. 96
Tempus per annum (post Tempus Paschale) ………… 135
Calendarium perpetuum O.S.M. ………………………. 253
FINITO DI STAMPARE PER
I TIPI DELL’ISTITUTO ARTI
GRAFICHE MENGARELLI
R O M A

S A B A T O
XXIX OTTOBRE MMXI
NELLA MEMORIA DI
S A N T A M A R I A
I B
N
S
A
A
T
O

riogrande |
aidoCopro |
zokafric |
Unblog.fr | Créer un blog | Annuaire | Signaler un abus | l'actue des starlette
| Pont Tracy-Lanoraie
| texia1904