• Accueil
  • > Recherche : photo notre dame bon port

29 mars, 2015

Eglise catholique en Alsace

Classé dans : Non classé — andreadicaffa02 @ 4:54

 

pentecote 2015

rechercher sur le site :
Information de votre paroisse :
——– Choisissez votre paroisse ——–ACHENHEIMADAMSWILLERALBEALLENWILLERALTECKENDORFALTENACHALTENHEIMALTENSTADTALTKIRCHALTORFALTWILLERAMMERSCHWIHRAMMERTZWILLERANDLAUANDOLSHEIMAPPENWIHRARTOLSHEIMARTZENHEIMASCHBACHASPACHASPACH LE BASASPACH LE HAUTASSWILLERATTENSCHWILLERAUBUREAUENHEIMAVENHEIMAVOLSHEIMBAERENDORFBALBRONNBALDENHEIMBALDERSHEIMBALGAUBALLERSDORFBALSCHWILLERBALTZENHEIMBAN DE LA ROCHEBANTZENHEIMBAREMBACHBARRBARTENHEIMBARTENHEIM LA CHAUSSEEBASSEMBERGBATTENHEIMBATZENDORFBEBLENHEIMBEHLENHEIMBEINHEIMBELLAMAGNYBENDORFBENFELDBENNWIHRBERENTZWILLERBERG ET THALBERGBIETENBERGHEIMBERGHOLTZBERGHOLTZ-ZELLBERNARDSWILLERBERNARDVILLEBERNOLSHEIMBERNWILLERBERRWILLERBERSTETTBERSTHEIMBETSCHDORFBETTENDORFBETTLACHBETTWILLERBIBLISHEIMBIEDERTHALBIESHEIMBIETLENHEIMBILTZHEIMBILWISHEIMBINDERNHEIMBIRKENWALDBIRLENBACHBISCHHEIM CHRIST ROIBISCHHEIM ST LAURENTBISCHHOLTZBISCHOFFSHEIMBISCHWIHRBISCHWILLERBISELBISSERTBITSCHHOFFENBITSCHWILLER THANNBLAESHEIMBLANCHERUPTBLIENSCHWILLERBLODELSHEIMBLOTZHEIMBOERSCHBOESENBIESENBOLLWILLERBOLSENHEIMBOOFZHEIMBOOTZHEIMBOSSELSHAUSENBOSSENDORFBOURBACH LE BASBOURBACH LE HAUTBOURG BRUCHEBOURGHEIMBOUXWILLER 67BOUXWILLER 68BRECHAUMONTBREITENAUBREITENBACHBREITENBACH (68)BREMMELBACHBRETTENBREUSCHWICKERSHEIMBRINCKHEIMBRUEBACHBRUMATHBRUNSTATT S GEORGESBRUNSTATT STE ODILEBUETHWILLERBUHLBUHLBURBACHBURNHAUPT LE BASBURNHAUPT LE HAUTBUSCHWILLERBUSTBUSWILLERBUTTENCARSPACHCERNAYCHALAMPECHATENOISCHAVANNES SUR L’ETANGCLEEBOURGCLIMBACHCOLMAR – SAINT ANTOINECOLMAR – SAINT JOSEPHCOLMAR – SAINT LEONCOLMAR – SAINT PAULCOLMAR – SAINTE MARIECOLMAR – ST MARTINCOLMAR ST FRANCOIS D’ASSISECOLMAR-ST VINCENT DE PAULCOLROY LA ROCHECOSSWILLERCOURTAVONCRASTATTCROETTWILLERDACHSTEINDAHLENHEIMDAHLUNDENDAMBACHDAMBACH LA VILLEDANGOLSHEIMDANNEMARIEDAUBENSANDDAUENDORFDEHLINGENDESSENHEIMDETTWILLERDIDENHEIMDIEBOLSHEIMDIEDENDORFDIEFFENBACH AU VALDIEFFENBACH L. WOERTHDIEFFENTHALDIEFMATTENDIEMERINGENDIETWILLERDIMBSTHALDINGSHEIMDINSHEIM SUR BRUCHEDOLLERENDOMFESSELDONNENHEIMDORLISHEIMDOSSENHEIMDOSSENHEIM/ZINSELDRACHENBRONNDRULINGENDRUSENHEIMDUNTZENHEIMDUPPIGHEIMDURLINSDORFDURMENACHDURNINGENDURRENBACHDURRENENTZENDURSTELDUSENBACHDUTTLENHEIMEBERBACHEBERBACH SELTZEBERSHEIMEBERSMUNSTERECKARTSWILLERECKBOLSHEIMECKWERSHEIMEGLINGENEGUISHEIMEICHHOFFENELBACHELSENHEIMEMLINGENENGWILLERENSISHEIMENTZHEIMEPFIGERCKARTSWILLERERGERSHEIMERNOLSHEIMERNOLSHEIM-LES-SAVERNEERSTEINESCHAUESCHBACHESCHBACH AU VALESCHBOURGESCHENTZWILLERESCHWILLERETEIMBESETTENDORFEYWILLERFALKWILLERFEGERSHEIMFELDBACHFELDKIRCHFELLERINGFERRETTEFESSENHEIMFESSENHEIM LE BASFISLISFLAXLANDENFLEXBOURGFOLGENSBOURGFORSTFELDFORSTHEIMFORT LOUISFORTSCHWIHRFOUCHYFRANKENFRECONRUPTFRELANDFRIEDOLSHEIMFRIESENFRIESENHEIMFROENINGENFROESCHWILLERFROHMUHLFULLERENFURCHHAUSENFURDENHEIMGALFINGUEGAMBSHEIMGEISHOUSEGEISPITZENGEISPOLSHEIMGEISPOLSHEIM GAREGEISWASSERGEISWILLERGERSTHEIMGERTWILLERGEUDERTHEIMGILDWILLERGIMBRETTGINGSHEIMGOERLINGENGOERSDORFGOLDBACHGOMMERSDORFGOTTENHOUSEGOTTESHEIMGOUGENHEIMGOXWILLERGRANDFONTAINEGRASSENDORFGRAUFTHALGRENDELBRUCHGRENTZINGENGRESSWILLERGRIESGRIESBACHGRIESBACH AU VALGRIESHEIM PRES MOLSHEIMGRIESHEIM SUR SOUFFELGRUNENWALDGRUSSENHEIMGUEBERSCHWIHRGUEBWILLER – NOTRE-DAMEGUEBWILLER – SAINT LEGERGUEMARGUEVENATTENGUEWENHEIMGUMBRECHTSHOFFENGUNDERSHOFFENGUNDOLSHEIMGUNGWILLERGUNSBACHGUNSTETTHABSHEIMHACHIMETTEHAEGENHAGENBACHHAGENTHAL LE BASHAGENTHAL LE HAUTHAGUENAU – SAINT-GEORGESHAGUENAU – SAINT-JOSEPHHAGUENAU – SAINT-NICOLASHANDSCHUHEIMHANGENBIETENHARSKIRCHENHARTHOUSEHARTMANNSWILLERHATMATTHATTENHATTSTATTHAUSGAUENHECKENHEGENEYHEGENHEIMHEIDOLSHEIMHEIDWILLERHEILIGENBERGHEILIGENSTEINHEIMERSDORFHEIMSBRUNNHEITERENHEIWILLERHELFRANTZKIRCHHENFLINGENHENGWILLERHERBITZHEIMHERBSHEIMHERMERSWILLERHERRLISHEIMHERRLISHEIM P/COLMARHERSBACHHESINGUEHESSENHEIMHETTENSCHLAGHILSENHEIMHINDISHEIMHINDLINGENHINSBOURGHINSINGENHINTERFELDHIPSHEIMHIRSCHLANDHIRSINGUEHIRTZBACHHIRTZFELDENHOCHFELDENHOCHSTATTHOCHSTETTHOELSCHLOCHHOENHEIMHOERDTHOFFENHOHATZENHEIMHOHENGOEFTHOHFRANKENHEIMHOHRODHOHWILLERHOLTZHEIMHOLTZWIHRHOMBOURGHORBOURG WIHRHOUSSENHUNAWIHRHUNDSBACHHUNINGUEHUNSPACHHURTIGHEIMHUSSEREN LES CHATEAUXHUSSEREN WESSERLINGHUTTENDORFHUTTENHEIMICHTRATZHEIMILLFURTHILLHAEUSERNILLKIRCH GRAFF N DAMEILLKIRCH GRAFFENSTADENILLZACHIMBSHEIMINGENHEIMINGERSHEIMINGOLSHEIMINGWILLERINNENHEIMIRMSTETTISSENHAUSENISSENHEIMITTERSWILLERITTLENHEIMJEBSHEIMJETTERSWILLERJETTINGENJUNGHOLTZ-THIERENBACHKAIDENBOURGKALTENHOUSEKAPPELENKATZENTHALKAUFFENHEIMKAYSERSBERGKEFFENACHKEFFENDORFKEMBSKEMBS LOECHLEKERTZFELDKESKASTELKESSELDORFKIENHEIMKIENTZHEIMKIFFISKILSTETTKINDWILLERKINGERSHEIM – S. ADELPHEKINGERSHEIM – STE ELISABETHKINTZHEIMKIRCHBERGKIRCHHEIMKIRRBERGKIRRWILLERKLEINFRANKENHEIMKLEINGOEFTKLINGENTHALKNOERINGUEKNOERSHEIMKOESTLACHKOETZINGUEKOGENHEIMKOLBSHEIMKRAUTERGERSHEIMKRAUTWILLERKRIEGSHEIMKRUTHKUHLENDORFKUNHEIMKURTZENHOUSEKUTTOLSHEIMKUTZENHAUSENLA BROQUELA CLAQUETTELA PETITE PIERRELA VANCELLELA WALCKLA WANTZENAULABAROCHELALAYELAMPERTHEIMLAMPERTSLOCHLANDERSHEIMLANDSERLANGENSOULTZBACHLAPOUTROIELARGITZENLAUBACHLAUTENBACHLAUTENBACH-ZELLLAUTERBOURGLAUWLE BONHOMMELE HOHWALDLEIMBACHLEITERSWILLERLEMBACHLEUTENHEIMLEVONCOURTLEYMENLICHTENBERGLIEBENSWILLERLIEBSDORFLIEPVRELIGSDORFLIMERSHEIMLINGOLSHEIM S JEAN BAPTISTELINGOLSHEIM STE CROIXLINSDORFLINTHALLIPSHEIMLITTENHEIMLIXHAUSENLOBSANNLOCHWILLERLOGELBACH-WINTZENHEIMLOGELHEIMLOHRLORENTZENLUCELLELUEMSCHWILLERLUPSTEINLUTRANLUTTENBACH PRES MUNSTERLUTTERLUTTERBACHLUTZELHOUSEMACKENHEIMMACKWILLERMAENNOLSHEIMMAGNYMAGSTATT LE BASMAGSTATT LE HAUTMAISONSGOUTTEMALMERSPACHMANSPACHMARCKOLSHEIMMARIENTHALMARLENHEIMMARMOUTIERMASEVAUXMATTSTALLMATZENHEIMMEISTRATZHEIMMELSHEIMMEMMELSHOFFENMENSCHHOFFENMERKWILLER PECHELBRONNMERTZENMERTZWILLERMERXHEIMMETZERALMEYENHEIMMICHELBACHMICHELBACH LE BASMICHELBACH LE HAUTMIETESHEIMMINVERSHEIMMITSCHDORFMITTELBERGHEIMMITTELHAUSBERGENMITTELHAUSENMITTELSCHAEFFOLSHEIMMITTELWIHRMITTLACHMITZACHMODENHEIMMOERNACHMOLLAUMOLLKIRCHMOLSHEIMMOMMENHEIMMONSWILLERMONT STE ODILEMONTREUX JEUNEMONTREUX VIEUXMOOSCHMOOSLARGUEMORSBRONNMORSCHWILLERMORSCHWILLER LE BASMORTZWILLERMOTHERNMUESPACHMUESPACH LE HAUTMUHLBACH SUR BRUCHEMUHLBACH SUR MUNSTERMULHAUSENMULHOUSE – SACRE-COEURMULHOUSE – SS.PIERRE & PAULMULHOUSE BOURTZWILLERMULHOUSE DORN  S.FRANC.D’ASSISEMULHOUSE DORN S BARTHELEMYMULHOUSE DORN S LUCMULHOUSE DORNACH STE THERESEMULHOUSE ST ETIENNEMULHOUSE ST FRIDOLINMULHOUSE ST JEAN BOSCOMULHOUSE ST JOSEPHMULHOUSE STE GENEVIEVEMULHOUSE STE JEANNE D’ARCMULHOUSE STE MARIEMUNCHHAUSENMUNCHHOUSEMUNDOLSHEIMMUNSTERMUNTZENHEIMMUNWILLERMURBACHMUSSIGMUTTERSHOLTZMUTZENHOUSEMUTZIGNAMBSHEIMNATZWILLERNEEWILLERNEHWILLERNEUBOISNEUF BRISACHNEUGARTHEIMNEUHAEUSELNEUNHOFFENNEUNKIRCHNEUVE EGLISENEUWILLERNEUWILLER LA ROCHENEUWILLER LES SAVERNENIEDERALTDORFNIEDERBRONN LES BAINSNIEDERBRUCKNIEDERENTZENNIEDERHASLACHNIEDERHAUSBERGENNIEDERHERGHEIMNIEDERLAUTERBACHNIEDERMODERNNIEDERMORSCHWIHRNIEDERNAINIEDERROEDERNNIEDERSCHAEFFOLSHEIMNIEDERSEEBACHNIEDERSOULTZBACHNIEDERSTEINBACHNIFFERNORDHEIMNORDHOUSENOTHALTENOBENHEIMOBERBRONNOBERBRUCKOBERDORF (67)OBERDORF (68)OBERENTZENOBERHASLACHOBERHAUSBERGENOBERHERGHEIMOBERHOFFENOBERHOFFEN SUR MODEROBERKUTZENHAUSENOBERLARGOBERLAUTERBACHOBERMODERNOBERMORSCHWIHROBERMORSCHWILLEROBERNAIOBERROEDERNOBERSAASHEIMOBERSCHAEFFOLSHEIMOBERSOULTZBACHOBERSTEINBACHODERENODRATZHEIMOERMINGENOFFENDORFOFFENHEIMOFFWILLEROHLUNGENOHNENHEIMOHNHEIMOLTINGUEOLWISHEIMORBEYORBEY LES HUTTESORBEY PAIRISORSCHWIHRORSCHWILLEROSENBACHOSTHEIMOSTHOFFENOSTHOUSEOSTWALDOTTERSTHALOTTERSWILLEROTTMARSHEIMOTTROTTOTTWILLERPETERSBACHPETIT LANDAUPFAFFENHEIMPFAFFENHOFFENPFALZWEYERPFASTATTPFETTERHOUSEPFETTISHEIMPFULGRIESHEIMPLAINEPLOBSHEIMPREUSCHDORFPRINTZHEIMPUBERGPULVERSHEIMQUATZENHEIMRAEDERSDORFRAEDERSHEIMRAMMERSMATTRANGEN-MITTELKURTZRANRUPTRANSPACHRANSPACH LE BASRANSPACH LE HAUTRANTZWILLERRATZWILLERRAUWILLERREGUISHEIMREICHSFELDREICHSHOFFENREICHSTETTREIMERSWILLERREINHARDSMUNSTERREININGUEREIPERTSWILLERREITWILLERRETSCHWILLERRETZWILLERREUTENBOURGREXINGENRHINAURIBEAUVILLERICHTOLSHEIMRICHWILLERRIEDHEIMRIEDISHEIM – ST J. BAPTISTERIEDISHEIM – STE. AFRERIEDISHEIM N DAME PERP SECORIEDSELTZRIEDWIHRRIESPACHRIMBACH PRES GUEBWILLERRIMBACH PRES MASEVAUXRIMBACH-ZELLRIMSDORFRINGELDORFRINGENDORFRIQUEWIHRRITTERSHOFFENRIXHEIMRIXHEIM ILE NAPOLEONRODERENRODERNROESCHWOOGROGGENHOUSEROHRROHRWILLERROMAGNYROMANSWILLERROMBACHROMBACH LE FRANCROPPENHEIMROPPENTZWILLERRORSCHWIHRROSENAUROSENWILLERROSENWILLERROSHEIMROSSFELDROSTEIGROTHAUROTHBACHROTTROTTELSHEIMROUFFACHROUNTZENHEIMRUEDERBACHRUELISHEIMRUMERSHEIMRUMERSHEIM LE HAUTRUSSRUSTENHARTSAALESSAASENHEIMSAESSOLSHEIMSAINT AMARINSAINT BERNARDSAINT COSMESAINT HIPPOLYTESAINT JEAN SAVERNESAINT LOUIS – N.D. DE PAIXSAINT LOUIS – ST-LOUISSAINT LOUIS BOURGFELDENSAINT MARTINSAINT MAURICESAINT NABORSAINT PIERRESAINT PIERRE BOISSAINT ULRICHSAINTE CROIX EN PLAINESAINTE MARIE AUX MINESSALENTHALSALMBACHSANDSARRE UNIONSARREWERDENSAULXURESSAUSHEIMSAVERNESCHAEFFERSHEIMSCHAFFHOUSESCHAFFHOUSE SUR ZORNSCHALKENDORFSCHARRACHBERGHEIMSCHEIBENHARDSCHERLENHEIMSCHERWILLERSCHILLERSDORFSCHILTIGHEIM – STE FAMILLESCHILTIGHEIM IMM. CONCEPTIONSCHIRLENHOFSCHIRMECKSCHIRRHEINSCHLEITHALSCHLIERBACHSCHNERSHEIMSCHOENAUSCHOENBOURGSCHOENENBOURGSCHOPPERTENSCHWABWILLERSCHWARTZBACHSCHWEBWILLERSCHWEIGHOUSESCHWEIGHOUSE PRES THANNSCHWEIGHOUSE S/MODERSCHWENHEIMSCHWINDRATZHEIMSCHWOBENSCHWOBSHEIMSEEBACHSELESTAT NOTRE DAME DE PAIXSELESTAT ST GEORGESSELTZSENGERNSENTHEIMSEPPOIS LE BASSEPPOIS LE HAUTSERMERSHEIMSESSENHEIMSEWENSICKERTSIEGENSIERENTZSIEWILLERSIGOLSHEIMSILTZHEIMSINGRISTSONDERNACHSONDERSDORFSOPPE LE BASSOPPE LE HAUTSOUFFELWEYERSHEIMSOUFFLENHEIMSOULTZSOULTZ LES BAINSSOULTZ SOUS FORETSSOULTZBACH LES BAINSSOULTZERENSOULTZMATTSPACHBACHSPECHBACH LE BASSPECHBACH LE HAUTST BLAISE LA ROCHEST LOUIS LA CHAUSSEE S PIERRESTAFFELFELDENSTAFFELFELDEN ROSSALMENDSTAMPOUMONTSTATTMATTENSTE CROIX AUX MINESSTE MARIE MINES – ST LOUISSTEIGESTEINBACHSTEINBOURGSTEINBRUNN LE BASSTEINBRUNN LE HAUTSTEINSELTZSTEINSOULTZSTERNENBERGSTETTENSTILLSTORCKENSOHNSTOSSWIHRSTOTZHEIMSTRASBOURG – BON PASTEURSTRASBOURG – CATHEDRALESTRASBOURG – ELSAUSTRASBOURG – N.D. LOURDESSTRASBOURG – SACRE COEURSTRASBOURG – ST CHRISTOPHESTRASBOURG – ST JEAN BAPTISTESTRASBOURG – ST JEAN BOSCOSTRASBOURG – ST LOUISSTRASBOURG – ST VINCENT PAULSTRASBOURG – STE MADELEINESTRASBOURG – T. STE TRINITESTRASBOURG CHRIST RESSUSCITESTRASBOURG ROB. – ST LOUISSTRASBOURG ST ALOYSESTRASBOURG ST AMANDSTRASBOURG ST ANTOINESTRASBOURG ST ARBOGASTSTRASBOURG ST BENOITSTRASBOURG ST BERNARDSTRASBOURG ST FLORENTSTRASBOURG ST IGNACESTRASBOURG ST JOSEPHSTRASBOURG ST LEONSTRASBOURG ST MAURICESTRASBOURG ST PIERRE LE JEUNESTRASBOURG ST PIERRE VIEUXSTRASBOURG ST URBAINSTRASBOURG STE BERNADETTESTRASBOURG STE JEANNE D’ARCSTRUETHSTRUTHSTUNDWILLERSTUTZHEIMSUNDHOFFENSUNDHOUSESURBOURGTAGOLSHEIMTAGSDORFTHALTHANNTHANNENKIRCHTHANVILLETIEFFENBACHTRAENHEIMTRAUBACH LE BASTRAUBACH LE HAUTTRIEMBACH AU VALTRIMBACHTROIS EPISTRUCHTERSHEIMTURCKHEIMUBERACHUEBERSTRASSUFFHEIMUFFHOLTZUHLWILLERUHRWILLERUNGERSHEIMURBEISURBESURMATTURSCHENHEIMUTTENHEIMUTTENHOFFENUTTWILLERVALFFVENDENHEIMVIEUX FERRETTEVIEUX THANNVILLAGE NEUFVILLEVOEGTLINSHOFFENVOELLERDINGENVOGELGRUNVOLGELSHEIMVOLKSBERGWACKENBACHWAHLBACHWAHLENHEIMWALBACHWALBOURGWALDHAMBACHWALDIGHOFFENWALDOLWISHEIMWALHEIMWALTENHEIMWALTENHEIM SUR ZORNWANGENWANGENBOURG-ENGENTHALWASSELONNEWASSERBOURGWATTWILLERWECKOLSHEIMWEGSCHEIDWEILERWEINBOURGWEISLINGENWEITBRUCHWEITERSWILLERWENGELSBACHWENTZWILLERWERENTZHOUSEWESTHALTENWESTHOFFENWESTHOUSE MARMOUTIERWESTHOUSE PRES BENFELDWETTOLSHEIMWEYERWEYERSHEIMWICKERSCHWIHRWICKERSHEIMWIDENSOLENWIHR AU VALWILDENSTEINWILDERSBACHWILLERWILLER SUR THURWILLGOTTHEIMWILSHAUSENWILWISHEIMWIMMENAUWINGENWINGEN SUR MODERWINGERSHEIMWINKELWINTERSHOUSEWINTZENBACHWINTZENHEIMWINTZENHEIM (68)WINTZFELDENWISCHESWISSEMBOURGWITTELSHEIM – S. MICHELWITTELSHEIM AMELIE II CH ROWITTELSHEIM GRAF. N.D. ROS.WITTELSHEIM LANGENZUGE J.BOSWITTENHEIM – SAINTE BARBEWITTENHEIM – SAINTE MARIEWITTENHEIM FERN. ANNA S.CHRWITTENHEIM JEUNE BOISWITTERNHEIMWITTERSDORFWITTERSHEIMWITTISHEIMWIWERSHEIMWOELLENHEIMWOERTHWOLFERSDORFWOLFGANTZENWOLFISHEIMWOLFSKIRCHENWOLSCHHEIMWOLSCHWILLERWOLXHEIMWUENHEIMZAESSINGUEZEHNACKERZEINHEIMZELLENBERGZELLWILLERZELSHEIMZILLISHEIMZIMMERBACHZIMMERSHEIMZINSWILLERZITTERSHEIMZOEBERSDORFZUTZENDORF
AGENDA DES MANIFESTATIONS
Mars2015
L Ma Me J V S D
23 24 25 26 27 28 1
2 3 4 5 6 7 8
9 10 11 12 13 14 15
16 17 18 19 20 21 22
23 24 25 26 27 28 29
30 31 1 2 3 4 5
NOTRE ÉMISSION RADIO
btn radio rencontre 2

Écoutez Rencontre Catholique dans son intégralité
Retrouvez les anciennes émissions

btn webtv

btn projet diocesain2014

1000ans-cathedrale

maladies curie

Eglise catholique en Alsace btn_actualites

Déclarations de l'Evêque

Don en ligne

Newsletter

btn messesinfos

Partez en pélerinage

Église Catholique en France

www.eglise.catholique.fr

www.eglisse.catholique.fr

btn rencontrer-jesus

btn findevie

btn_blogBioethique

www.eglisse.catholique.fr

Vous êtes ici : Accueil

banniere-a-la-une

Prions aux intentions de l’Église Universelle :
- Prions pour que, en cette année dédiée à la vie consacrée, les religieuses et les religieux redécouvrent la joie de suivre le Christ et s’engagent avec zèle au service des pauvres.

Prions pour l’évangélisation :
- Prions pour que tous les croyants et tous les hommes de bonne volonté collaborent à la paix.

Mgr Martin Bogner, vicaire général, est décédé subitement

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 13:28 Publié le vendredi 27 mars 2015 10:08

martin bogner webMgr Martin Bogner, vicaire général du diocèse de Strasbourg, est décédé subitement jeudi 26 mars aux environs de 17h, victime d’un arrêt cardiaque, alors qu’il trouvait dans la salle d’attente de son cardiologue pour un rendez-vous médical. Les pompiers appelés d’urgence n’ont pas réussi le sauver.

Mgr Grallet, archevêque de Strasbourg actuellement à Lourdes pour la Conférence des évêques de France a appris avec énormément de tristesse la nouvelle, perdant un compagnon fidèle et précieux, portant la responsabilité, entre autre, des ressources humaines du diocèse.

Les obsèques de Mgr Bogner seront présidées par Mgr Grallet le mercredi 1er avril à 14h30 en la cathédrale de Strasbourg. L’inhumation suivra au cimétière de Aschbach.

Monseigneur Martin BOGNER, né le 27 janvier 1949 à Aschbach, de parents cultivateurs.

Messe chrismale : le mardi 31 mars à 18h30

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:46 Publié le vendredi 27 mars 2015 14:15

messechrismaleLa messe chrismale sera célébrée le mardi 31 mars à 18h30 en la cathédrale de Strasbourg.

Bernard Xibaut en précise la signification.

Parmi les célébrations de la Semaine Sainte figure à une place originale celle de la Messe chrismale. Elle a ceci de particulier qu’elle est unique dans chaque diocèse et qu’elle doit être célébrée en principe le matin du Jeudi Saint, sachant qu’il est possible, pour des raisons pastorales, de l’anticiper à un autre jour de la Semaine Sainte. Dans notre diocèse, elle est célébrée le soir du Mardi Saint.

Trois points méritent d’être particulièrement éclaircis car ils sont souvent mal compris :

5è centenaire de la naissance de Sainte Thérèse d’Avila

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:57 Publié le vendredi 27 mars 2015 09:52

thérès davilaL’Ordre du Carmel déchaussé célèbre le samedi 28 mars le cinquième centenaire de la naissance de sa fondatrice, Sainte Thérèse de Jésus, Docteur de l’Eglise, plus connue sous le nom de Sainte Thérèse d’Avila.

Le Carmel de Marienthal invite à fêter cet anniversaire lors d’une célébration eucharistique au Carmel le samedi 28 mars à 8h15.

Vivre les jours saints avec les séminaristes

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:40 Publié le vendredi 27 mars 2015 14:40

triduum seminaireTu es un jeune homme de plus de 17 ans et souhaites vivre durant les trois jours les plus importants de l’année chrétienne un moment fort de prière d’enseignement et de vie fraternelle joyeuse en compagnie des futurs prêtres du diocèse de Strasbourg. Viens rejoindre les séminaristes du jeudi saint au dimanche de Pâques.

Ce temps fort se déroule au Grand Séminaire Sainte Marie Majeure de Strasbourg et les offices sont célébrés à la cathédrale Notre-Dame de Strasbourg autour de notre archevêque.

Du jeudi 2 avril à 18h au dimanche 5 avril après le déjeuner. Libre participation aux frais

Inscription auprès du P. Didier Dehan 2 rue des Frères à Strasbourg. Tél : 03 88 36 03 28

Après un tiers de millénaire, demeurer ensemble

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 14:56 Publié le vendredi 27 mars 2015 14:44

respirePour le vendredi Saint, 3 avril, les deux communautés proposent un chemin de croix oecuménique à 12h départ de Saint-Pierre-le -Jeune protestant, étape au temple Neuf et arrivée à la cathédrale à 13h. Ce même jour à 18h30 Respire, une heure ailleurs propose une médiattion sur le vendredi saint, le déchirement du monde.

Ecouter l’interview de Rudi Popp, pasteur du temple Neuf

Méditation autour de la Semaine Sainte

ImprimerE-mail
Mis à jour le vendredi 27 mars 2015 16:00 Publié le vendredi 27 mars 2015 14:24

semainesainteEn ouverture de la Semaine Sainte, nous vous proposons la méditation de François Wernert, curé de Saint-Nicolas et de Saint Joseph à Haguenau :

26 décembre, 2014

l’ouvrage de Bernard Vignot un gps très utile …pour ne pas se tromper de chemin

Classé dans : Non classé — andreadicaffa02 @ 10:06
www.religion.info : Religioscope
 
News.Conferences.Archives.FAQ.Site Map.Mailing List.Contact
English Homel'ouvrage de Bernard Vignot un gps très utile ...pour ne pas se tromper de chemin  horizontalblueFrançais: Accueil
pixelConférences.Archives.FAQ.Plan.Liste de Diffusion.Liens.Contact

french:Articles
Livre: le phénomène des évêques indépendants
pixel
Jean-François Mayer
10 Apr 2011

A l’occasion de la récente parution du nouveau livre de Bernard Vignot sur les «Eglises parallèles», un compte rendu de celui-ci et quelques réflexions sur les communautés épiscopales indépendantes, en élargissant le regard vers le monde anglophone.

0527_vignot

Tous les chercheurs de langue française qui s’intéressent aux groupes religieux constitués autour d’évêques indépendants des Eglises historiques, connaissent le nom de Bernard Vignot. Et les responsables de ces communautés aussi! Depuis plusieurs dizaines d’années, Bernard Vignot prête attention aux évolutions (en France) de ce petit milieu dont il a acquis une connaissance encyclopédique. Dès les années 1970, il a publié, sous forme polycopiée et à compte d’auteur, plusieurs répertoires de «petites Eglises catholiques non romaines», puis également orthodoxes, bien utiles pour les curieux en quête de renseignements sur ces groupes.

En 1991, Bernard Vignot avait publié un petit volume introductif sur Les Eglises parallèles aux Editions du Cerf. C’est chez le même éditeur qu’est paru un nouvel ouvrage de même nature,Le phénomène des Eglises parallèles. Celui-ci s’inscrit dans la ligne de ses publications antérieures. Il s’ouvre par quelques anecdotes pour faire entrer le lecteur dans le petit monde des évêques indépendants qui sont au coeur de ces initiatives — puisque le principe de la succession apostolique est fortement mis en avant dans ces groupes: seul un évêque consacré par d’autres évêques et pouvant ainsi, en théorie, faire remonter leur ligné jusqu’aux apôtre du 1er siècle de l’ère chrétienne peut validement ordonner des prêtres, et seuls des prêtres validement ordonnés peuvent ensuite, selon la compréhension traditionnelle des Eglises catholiques et orthodoxes, célébrer l’Eucharistie.

Evêques indépendants et succession apostolique

Ce qui frappe souvent, dans ces communautés épiscopales indépendantes, est une compréhension de la succession apostolique et des consécrations épiscopales dans un sens que des observateurs qualifient de «mécanique»: du moment que la lignée existe et que la consécration de l’évêque a été effectuée en respectant toutes les formes rituelles, elle est «valide»; tous les actes qui en découleront (ordinations de prêtres, etc.) seront donc également valides. Ce qui devient crucial, dans cette perspective, est la solidité «formelle» de la succession apostolique: cela a conduit certains évêques indépendants à se faire reconsacrer plusieurs fois, sub conditione, afin de cumuler des successions et de créer ainsi une succession incontestable (il explique même des cas d’ordinations sub conditione réciproques). Illustration pittoresque: l’évêque indépendant américain Lewis Keizer, évêque président du Home Temple et promoteur d’approches assez originales, a excommunié Benoît XVI en 2010 (en raison des condamnations de ce dernier contre les ordinations de femmes) et, procédant à cet acte dans sa chapelle, souligne: «Je suis un évêque indépendant avec vingt-deux lignages de succession apostolique valides, même plus de lignages de succession que le Pape, car les miens incluent des lignages dit hérétiques.»

A l’opposé, dans les Eglises historiques, les critiques de cette approche de la succession apostolique estiment qu’elle réduit celle-ci à une automaticité liée uniquement aux formes, voire en font une opération « magique »: ils soutiennent que la succession apostolique n’a de sens que dans la communion de l’Eglise et au service de celle-ci, un épiscopat à l’usage d’un individu et « propriété » de celui-ci se trouvant dénué de toute valeur. L’approche de bien des évêques indépendants est liée à une notion de l’épiscopat et du sacerdoce comme conférant des «pouvoirs» (cf. pp. 74-75), un aspect important pour des évêques et prêtres indépendants exerçant des activités d’exorcistes et guérisseurs.

0527_vilatte
Mgr Joseph-René Vilatte (1854-1929)

Quoi qu’il en soit, par suite de diverses circonstances dans le détail desquelles nous ne pouvons entrer ici, des évêques ont, à différents moments de l’histoire, pris l’initiative de consacrer à l’épiscopat des personnages qui, par la suite, ont entamé des carrières indépendantes et ont, dans certains cas, eu une abondante progéniture épiscopale, chacun de ces évêques en créant d’autres à leur tour. L’un des cas les plus connus a été celui, de Mgr Joseph-René Vilatte (1854-1929), auquel Bernard Vignot consacre légitimement une section (pp. 49-60), à côté de la biographie de deux autres figures importantes de l’histoire de ces courants. Il émigre au Canada, se rapproche du protestantisme, puis adhère au courant vieux-catholique (né en opposition aux orientations dominantes du catholicisme romain de l’époque et à la proclamation de l’infaillibilité pontificale à l’époque du concile Vatican I), y est ordonné prêtre, puis est sacré évêque en 1892 à Ceylan par un évêque syro-jacobite, avant de se lancer dans des tentatives de création de mouvements catholiques indépendants et de procéder à la consécration de plusieurs évêques.

Il arrive que des évêques catholiques romains procèdent à des consécrations indépendantes: un cas connu a été celui de Mgr Pierre Martin Ngo Dinh Thuc (1897-1984), ancien archevêque de Hué (Vietnam), qui a sacré plusieurs personnages appartenant à des mouvances traditionalistes, ceux-ci ayant à leur tour une postérité épiscopale.

Quelques traits caractéristiques des «Eglises parallèles»

Pour en venir à l’ouvrage de Vignot, certaines parties sont écrites dans un style plus fluide que d’autres (par exemple le chapitre IV). Dans les premières pages, les divisions des paragraphes ne semblent pas toujours des plus logiques. La construction aurait probablement pu être pensée plus rigoureusement. La bibliographie est abondante (pp. 117-127), mais aurait pu être organisée plus clairement. Quant à la liste non exhaustive des Eglises parallèles (pp. 99-105), elle offre un joli florilège de dénominations, mais il aurait été judicieux de préciser que certains des groupes cités n’existent plus.

Cela n’ôte rien à l’intérêt des anecdotes et réflexions que Bernard Vignot partage avec nous, car elles reposent sur une expérience sans équivalent dans le monde francophone. Le ton de l’ouvrage montre qu’il est notamment pensé par rapport à des préoccupations pastorales: c’est d’ailleurs un évêque catholique qui en donne la préface (Bernard Vignot, pour sa part, est prêtre de l’Eglise vieille-catholique - Union d’Utrecht). Les observations partagées par Vignot sont cependant utiles également pour une approche plus sociologique.

Bernard Vignot souligne l’insistance de beaucoup de ces groupes sur le fait que leurs ordinations sont valides, à défaut d’être licites (pp. 68-73). Mais licites ou illicites par rapport à qui? Par rapport à l’Eglise catholique romaine, prise comme référence. Il ne manque pas, en effet, d’évêques indépendants qui rêvent d’être intégrés par Rome, avec reconnaissance de leur épiscopat et sacerdoce. Rêve difficilement réalisable — mais il existe des cas de figures du monde des évêques indépendants qui ont réussi à être intégrés dans des Eglises historiques: l’on se souvient par exemple du cas de Mgr Johannes Van Assendelft (1923-2008), qui se rallia, après une longue carrière dans le milieu des «Eglises parallèles» (y devenant évêque dans les années 1950), à l’Eglise copte, dans laquelle il fut consacré évêque en 1974. Mais de tels cas sont rares.

La dépendance psychologique par rapport à une référence romaine à l’aune de laquelle l’on juge de la validité de son propre épiscopat semble étrange — même s’il est vrai qu’il existe aussi quelques cas d’Eglises épiscopales indépendantes qui s’engagent délibérément dans un chemin propre, sans rêve d’union avec Rome. Mais dans nombre d’entre elles, en France notamment, le visiteur peut même trouver une photographie du Pape bien en évidence: autant dire qu’une personne peu informée ne se rendra pas vraiment compte du statut du groupe (p. 85). Vignot y voit une manière de «calmer les inquiétudes de leurs fidèles» (p. 69): la plupart de ceux-ci ne viennent pas dans de telles chapelles, en effet, parce qu’ils voudraient rompre avec l’Eglise romaine, mais parce qu’ils sont en quête d’un lieu où ils seront écoutés, où ils pourront recevoir des bénédictions, éventuellement un exorcisme, ou encore en quête d’un prêtre disposé à célébrer le remariage de personnes divorcées.

Il s’agit donc rarement de groupes avec une doctrine originale, ni d’ailleurs un clergé bien formé: Vignot souligne qu’il ne manque pas, dans ces milieux, d’hommes qui avaient aspiré à devenir prêtres, mais, pour différentes raisons, n’ont pu réaliser cette aspiration, et ayant plus d’une fois exercé des professions sans qualifications élevées. Là encore, bien sûr, il y a des exceptions.

En outre, le milieu des évêques indépendants est loin d’être homogène. Il convient de veiller à ne pas les réduire à un modèle unique. Il en est qui souhaitent avant tout cultiver un type de piété populaire. D’autres groupes se forment autour de visions ou messages (c’est le cas de l’Eglise catholique palmarienne, en Espagne, autour d’un pape espagnol, et maintenant de son successeur, pour ne citer que cet exemple). Certains «prélats» indépendants manifestent un goût prononcé pour l’occultisme et autres doctrines secrètes (ainsi, à l’enseigne de «spécialiste et conseil en exorcisme», l’un — très actif — donne des cours sur la Kabbale, le magnétisme personnel, la bio-respiration, et même la création d’un élémental servant ou «esprit familier»…).

Un autre point à noter: il existe des groupes qui attirent un nombre de fidèles substantiels, comme l’Eglise Sainte-Marie du Mont-Saint-Aignan, près de Rouen, dirigée par Mgr Maurice Cantor, un ancien bénédictin et prêtre de paroisse catholique romain, dont la communauté se veut «une Eglise autocéphale de tradition catholique au service d’un accueil pastoral pour tous»; bien d’autres, en revanche, restent très petits (ce qui n’empêche pas de multiplier les ordinations), et ont parfois plutôt un public de «clients», en quête de bénédictions et exorcismes.

La question que l’on peut poser, en refermant le livre de Bernard Vignot et en réfléchissant à ce monde dans lequel il nous fait entrer, est de savoir s’il y a d’autres angles d’approche possibles? Et aussi dans quelle mesure le terrain français est semblable, ou se distingue au contraire, du milieu des évêques indépendants dans d’autres pays?

Evêques indépendants… Eglises parallèles… quelle étiquette?

Avant d’aller plus loin, quelques remarques rapides sur le vocabulaire. Dans les cercles francophones spécialistes des minorités religieuses, l’on avait d’abord parlé d’Eglises et évêque catholiques non romains, selon le titre d’un ouvrage publié en 1962 par Ivan Drouet de la Thibauderie, lui-même évêque indépendant. Quant au P. Chéry, un dominicain qui mena dans les années 1950 une remarquable et vaste enquête sur les mouvements religieux minoritaires en France, il parlait semblablement, mais avec un adjectif, de «petites Eglises françaises ‘catholiques non romaines’» (L’Offensive des Sectes, 3e éd., Paris, Ed. du Cerf, 1961, p. 471). L’expression de «petites Eglises catholiques non romaines» fut consacrée par la publication de l’érudit article de Jean-Michel Hornus utilisant cette expression comme titre de son article en deux parties dans la Revue d’histoire et de philosophie religieuse (50/2 et 3, 1970).

Dans ses répertoires polycopiés des années 1980, Vignot parlait de «petites Eglises catholiques non romaines et orthodoxes non canoniques», tenant compte d’un nombre croissant de groupes se référant à l’héritage orthodoxe. Son livre de 1991 introduit dans le discours sur le sujet le terme d’Eglises parallèles, qui présente l’avantage de la concision. Il ne l’utilise cependant pas comme titre de ses fascicules, Dans les années 1990, une nouvelle série de répertoires utilise l’expression neutre d’«Eglises et communautés indépendantes d’origine catholique». Puis les répertoires des années 2000, préparés en coopération avec Marc Béret-Allemand, parlent d’Eglises et de communautés sans liens canoniques avec les Eglises catholiques et orthodoxes.

Chacune de ces expressions met l’accent sur une facette du sujet, tout en soulignant le rapport généalogique de ces groupes (ou plus exactement de leur épiscopat, à l’origine) avec les grandes Eglises historiques à structure épiscopale. Chacune révèle aussi des efforts pour essayer d’adopter une désignation si possible «neutre». Bien entendu, chaque étiquette pourrait aussi être soumise à discussion.

Dans le présent compte rendu, l’expression «évêques indépendants» a été utilisée à plusieurs reprises, comme une tentative de plus de cerner le sujet de façon adéquate et n’impliquant pas d’emblée un jugement de valeur; dans la même ligne, l’on pourrait parler de communautés (ou Eglises) épiscopales indépendantes. Il n’est pas sûr que ce soit la meilleure solution. Mais elle a été inspirée par les travaux de John P. Plummer, un évêque indépendant américain, qui a produit quelques intéressants ouvrages pour essayer d’analyser les mouvements qui retiennent ici notre attention — à partir d’un contexte américain, religieusement pluraliste au départ, ce qui permet de proposer un angle un peu différent d’une approche française. Plummer a également parlé de «mouvement sacramentel indépendant»: un indice de plus d’une étiquette adéquate qui se cherche.

Regard comparatif sur le monde anglophone

Dans un petit volume intitulé Who Are the Independent Catholics? An Introduction to the Independent and Old Catholic Churches (Berkeley, Apocryphile Press, 2006), John Plummer et un co-auteur, John R. Mabry, ont voulu répondre au besoin d’une introduction simple et pour un large public, à un moment où, selon eux, le mouvement catholique indépendant se développe aux Etats-Unis. Ils distinguent quatre types de catholiques indépendants: les libéraux, les traditionalistes, les ésotéristes et les syncrétistes. Ce qui fait une Eglise catholique, selon eux, est l’adhésion aux confessions de foi historiques (bien qu’ils reconnaissent qu’il peut en exister des interprétations variées), la pratique des sept sacrements, un clergé avec des diacres, des prêtres et des évêques, et enfin une succession apostolique ininterrompue. Les groupes catholiques indépendants répondraient à ceux qui se sentent éloignés des grandes Eglises ou rejetés par elles. Selon sa sensibilité, un public souhaitant des formes liturgiques d’inspiration catholique pourrait donc trouver chez tel ou tel prêtre indépendant la réponse à ses besoins ou la célébration d’une cérémonie. Les auteurs soulignent qu’il faut aussi savoir exercer discernement et prudence en s’adressant à des membres de clergés «catholiques indépendants», mais comme on le ferait dans n’importe quel autre cadre: l’image qui ressort est avant tout celle de personnes désireuses de servir les fidèles. L’impression donnée paraît donc différente de celle transmise par Bernard Vignot, tout en laissant le lecteur désireux d’en savoir un peu plus. Mais voyons cela de plus près.

Plummer avait écrit précédemment un autre ouvrage, The Many Paths of the Independent Sacramental Movement. A National Study of Its Liturgy, Docrtine and Leadership (Berkely, Apocryphile Press, 2005). Etude plus volumineuse et de type universitaire, elle permet, avec le récit de nombreuses visites dans des communautés indépendantes américaines, de pénétrer dans leur atmosphère, avec des développements qui mènent à vrai dire parfois assez loin du catholicisme classique. Il reconnaît que le milieu indépendant n’a pas encore beaucoup développé une réflexion théologique propre, mais, en mettant l’accent sur les groupes les plus innovateurs, notamment dans un sens gnostique ou ésotérique, il soutient qu’il contient des éléments potentiellement originaux. Comme Vignot, Plummer reconnaît que beaucoup de membres du clergé indépendant n’ont pas eu de véritable formation et ont acquis leurs connaissances aux côtés d’un mentor, prêtre ou évêque, qu’ils ont assisté. Mais cela n’a pas empêché certains d’entre eux d’avoir une action pastorale de valeur, estime-t-il. L’impression qui se dégage de son étude est celle d’une «diversité anarchique», selon sa propre expression, mais en même temps d’un espace créatif: il resterait à voir si cette évaluation est liée aux différences du contexte américain, ou au regard plutôt sympathique que Plummer porte sur la mouvance à laquelle il appartient lui-même.

0527_strange_vocation

Il existe un autre livre fascinant sur le milieu des évêques indépendants américains: celui d’Alistair Bate, A Strange Vocation. Independent Bishops Tell Their Stories (Berkeley, Apocryphile Press, 2009). Comme l’indique le titre, Alistair Bate, lui-même «évêque indépendant», a pris l’initiative de donner la parole à dix-sept évêques indépendants (la plupart aux Etats-Unis) pour leur permettre de raconter leur histoire. Le recueil n’a pas de prétention représentative: les personnages aux inclinations ésotériques y sont probablement surreprésentés, mais il est éclairant par la richesse de ces itinéraires.

L’éclectisme ressort de beaucoup de témoignages, à commencer par celui de Bate lui-même: il est élevé dans un milieu anglican irlandais, a ensuite des aspirations monastiques, fréquente une variété peu commune des groupes religieux; tout en étant évêque de l’Eglise catholique apostolique libérale, il lui arrive d’exercer un ministère dans une communauté unitarienne (des chrétiens qui n’acceptent pas le dogme de la Trinité et se signalent par des orientations très libérales) ou de donner des cours sur la spiritualité druidique et celtique. Mais il accorde à titre personnel une forte importance à la dimension sacramentelle. Il explique vivre — modestement — de son ministère en Grande-Bretagne, surtout de la célébration de funérailles. Il est peu probable que beaucoup d’évêques indépendants en France puissent dire la même chose. Quoi qu’il en soit, avec Bate et nombre de ses collègues, nous nous trouvons face à de typiques itinéraires de seekers, de chercheurs spirituels — itinéraires qui ne sont d’ailleurs probablement pas encore terminés.

Dans la même ligne de réflexion, plusieurs de ces évêques s’étaient doctrinalement éloignés des interprétations du christianisme telles qu’on les trouve dans le catholicisme romain, les Eglises orthodoxes ou l’anglicanisme traditionnel, mais ressentaient en même temps la nostalgie ou le besoin d’un cadre liturgique ou sacramentel: la voie choisie leur permet de combiner ce qui resterait sinon inconciliable. L’épiscopat indépendant permet de choisir une voie «sur une mesure», en quelque sorte.

Un autre aspect qui frappe est le nombre de ces évêques qui admettent être homosexuels et pour lesquels l’orientation sexuelle a quelques liens avec la voie choisie. L’on sait depuis longtemps que les cas d’homosexuels ne sont pas rares dans le milieu des évêques indépendants, mais aujourd’hui, surtout en contexte nord-américain, l’admettre n’est plus un obstacle dans certains milieux. Dans le contexte français, il est bien connu qu’il en existe plusieurs cas aussi, mais ils semblent généralement plus enclins à cultiver une certaine discrétion sur leurs «préférences sexuelles». Au fur et à mesure de l’évolution du statut public des homosexuels, cependant, cela va probablement changer: dans le dernier Annuaire d’Eglises et de communautés sans liens canoniques avec les Eglises orthodoxes(2009) de Bernard Vignot et Marc Béret-Allemand, on trouve une annexe de Jean Vilbas à ce sujet, sous le titre « En quête d’une pleine catholicité: catholiques indépendants et inclusivité » (texte dans lequel il admet d’ailleurs que ce thème occupe encore peu de place ouvertement dans les «petites Eglises» en France).

L’on observe à travers les témoignages recueillis par Bate une grande fluidité dans les appartenances: nombre de ces évêques passent successivement par plusieurs Eglises indépendantes, voire participent à plusieurs d’entre elles. Assez naturel dans des milieux de petits groupes, et des phénomènes semblables s’observent en Europe: chacun tend finalement à avoir «son» groupe, mais les collaborations avec d’autres évêques sont de rigueur, ne serait-ce que pour procéder à des consécrations épiscopales.

0527_anson

L’intérêt du livre de Bate est de permettre de suivre, à travers leurs propres descriptions, les itinéraires d’une variété d’évêques indépendants (également quelques femmes évêques, et au moins l’un d’eux né dans une Eglise épiscopale indépendante): des itinéraires parfois assez compliquées, dans lesquels transparaissent aussi hésitations et aspirations spirituelles.

A bien des égards, avec d’inévitables différences dans les accents en fonction des contextes culturels, le phénomène des «Eglises parallèles» ou «évêques indépendants» présente des ressemblances quel que soit l’angle d’approche choisi: les observations de Plummer ou des interlocuteurs de Bate confirment — bien que sur un ton différent — nombre d’observations de Vignot, à commencer par le fait que ces groupes trouvent des fidèles ou «clients» en bonne partie auprès d’un public qui n’a pas le sentiment de recevoir dans les paroisses de «grandes Eglises» les réponses à certaines demandes, d’ailleurs souvent plus pratiques (sacrements, bénédictions…) que théologiques. Même si, une fois de plus, il y a des exceptions.

0527_brandreth

Tout cela n’est pas vraiment nouveau, malgré des changements liés à des époques différentes: il suffit de relire ce qu’écrivait Henry R.T. Brandreth,Episcopi Vagantes and the Anglican Church(Londres. SPCK, 1961) ou Peter F. Anson, Bishops at Large (Londres, Faber and Faber, 1964), tous deux réédités récemment par Apocryphile Press et qui demeurent des lectures pleines d’intérêt sur des figures parfois pittoresques.

Les approches de Vignot, d’une part, et des auteurs-acteurs du milieu «sacramentel indépendant» anglophone que nous venons de citer, d’autre part, aboutissent cependant à des évaluations divergentes du potentiel de cette petite mouvance très fragmentée. Sans doute n’y a-t-il d’ailleurs aucun sens à vouloir donner une réponse d’ensemble. Entre une chapelle indépendante où l’on offre avant tout des services en parallèle à ceux des paroisses classiques, mais en s’efforçant de rappeler autant que possible ceux-ci, d’une part, et des groupes — plus rares — théologiquement ou liturgiquement novateurs, d’autre part, les perspectives ne sont pas les mêmes. Pour les uns et pour les autres, cependant, et pour leur perpétuation au delà de l’initiative d’un homme, pour ancrer des fidèles, se pose tôt ou tard la question soit de réussir à grandir suffisamment pour atteindre une masse critique garantissant leur pérennité, soit de trouver d’autres moyens de briser l’isolement: les tentatives occasionnelles d’organiser des ententes entre plusieurs «petites Eglises» en témoignent.

Jean-François Mayer

Bernard Vignot, Le phénomène des Eglises parallèles, Paris, Ed. du Cerf, 2010, 128 p.

Les répertoires et annuaires d’Eglises et communautés établis par Bernard Vignot et Marc Béret-Allemand peuvent être commandés chez l’auteur: 206 rue Léonard de Vinci, F-76960 Notre Dame de Bondeville.


articles récents

pixel English: Home
Articles
Interviews
Documents

Francais: Accueil
Articles
Entretiens
Documents

Print This

23 février, 2014

PELERINAGE ISLAMO-CHRETIEN DES SEPT-SAINTS DE VIEUX-MARCHE EN BRETAGNE – 27-28 JUILLET 2013

Classé dans : Non classé — andreadicaffa02 @ 23:53

Accueil | Actualité | Edito | Articles | Tourisme
Le pèlerinage des 7 dormants se termine par une réunion dans l’église avec les invités.
PELERINAGE ISLAMO-CHRETIEN DES SEPT-SAINTS DE VIEUX-MARCHE EN BRETAGNE – 27-28 JUILLET 2013
Avec les 7 martyrs mettons le cap vers le Paradis et osons le dialogue inter-religieux
Sept jeunes hommes furent condamnés à mort pour ne pas avoir voulu se soumettre aux idoles de leur temps et ils s’endormirent pour l’éternité emmurés dans une caverne avec leur petit chien. Dieu les ressuscita, plus de cent ans après. Cette histoire est fêtée par les catholiques, les chrétiens orthodoxes et les musulmans. Cette histoire des 7 saints a été étudiée par Louis Massignon.
Le Tantad, le feu des pères, est béni par l’évêque.
Le Tantad, béni par le « Pardonneur » s’enflamme d’Amour en 2012

Le feu sacré est intégré à la cérémonie catholique, en lui donnant un sens Christique. Le Feu des Pères, n’est autre que l’héritage du culte zoroastrien transmis par le peuple celte qui était le balbuciement de la recherche du Dieu unique, le Créateur de toute chose. En 2012, le père Jean-Jacques Pérennes, Dominicain au Caire, a été le « Pardonneur ». Ce prêtre Dominicain allum et béni le feu du Tantad, anticipant ainsi l’Année de la Foi, voulue par le Pape Benoît XVI, sur la place Louis Massignon du Hameau des Sept-Saints, en Vieux-Marché dans le Trégor en Bretagne. La Splendeur de Dieu va se manifester et nous n’aurons rien à faire sinon de contempler.

Dans le Motu Proprio « Porta Fidei », le pape Benoît XVI a annoncé une « Année de la foi ». Elle débutera le 11 octobre 2012, pour le cinquantième anniversaire de l’ouverture du concile Vatican II, et se conclura en la solennité du Christ Roi, le 24 novembre 2013.
Bienheureux les coeurs purs.
Un pardon millénaire en Bretagne

Le pardon breton de Vieux-Marché, a lieu chaque année, le premier dimanche qui suit le jour de la Sainte Marie Magdeleine, apôtre des apôtres. Il célèbre la résurrection de sept martyrs avec leur petit chien. Les traditions chrétiennes catholique et orthodoxe et la Sourate 18 du Coran parlent de la Résurrection finale. C’est autour de Notre-Dame-de-Miséricorde (Vierge Marie à l’Enfant) que le peuple breton célèbre les Sept Saints. Croire au Paradis est un acte de Foi.

L’Eglise construite sur un dolmen rappelle qu’en Bretagne les moines irlandais n’ont pas rejeter les traditions pré-abrahammiques. Le Pardon breton est un évènement à la fois individuel et collectif. La Miséricorde de Dieu est donnée à la communauté toute entière qui se met en marche et suis le bon Berger. Cela suscite donc mille joies, exprimées par les repas et les danses. La foi des bretons s’exprime par ces « pardons » qui sont des mini-pèlerinages festifs, qui font revivre.
Comment cette histoire est arrivée en Bretagne

L’histoire est racontée en Bretagne dans un chant moyenageux en langue bretonne, Ar Seiz sants. Ce type de chant est appelé « Gwerz », ou chant profond de Bretagne (Breizh), chanté par Yann-Fanch Kéméner ou par les frères Morvan. Plusieurs hypothèses pour l’origine de la venue de cette histoire en Bretagne. La première est celle du retour des chevaliers de Terre Sainte aprés les croisades. La deuxième par la mer : les mines d’Etain firent venir des commerçants du Maroc ou des marins grecs venant d’Ephèse ?. La troisième hypothèse : l’histoire fut transmise par le saint franc Grégoire de Tours (VIe siècle), Jacques de Voragine (XIIIe, Légende dorée) et Ibn Abbas (618, conpagnon de Mohamed, prophète de l’Islam).

Liste de lieux non-exaustive : Abrîq (haut euphrate, Arabissos (près de Tarse), Amorium (Turquie), Azeffoun (Gde Kabylie) Baysan (Célius), Béja (Tunisie) Biskra, Boghari (Autun), Le Caire, Chnini (Tataouine, Tunisie), Comores, Damas (Syrie), au Liban, en Allemagne, El Arrouch (Algérie), El Oudiane (Tunisie), Foum el Toub (Aurès, Algérie), Gandia (Valence, Espagne), Germia (Galatie-Turquie), Guidjel (Algérie), Gandia (Valence, Espagne), Hamad des Oulad Ayar, Guabala (Tunisie), Harar (Ethiopie), Istanbul, Jânan al Ward, (Cordoue), Jîruft, Kara-Khodja (Turkestan chinois), Loja de Grenade, Cap Matifou (Alger), Meïméné (Upiyan, Afghanistan), Midès (Tunisie) Najrân (Arabie), Paphos (Chypre), Perdiwar (Kurdistan), Qodjo (Gaochang-Mongolie), Rabat – Sefrou – Sidi Hazarem à Fès (Maroc), Raquîm (Amman, Jordanie), Tarse (Turquie), Tebessa (Bakrî), Tolède, Toyoq (Turkestan chinois), Tozeur (Tunisie), Vieux-Marché (Bretagne – Breizh), Wadi Mûsa (Pétra, Jordanie).
50 ans de la mort de Louis Massignon

Il y a 58 ans, Louis Massigon, orientaliste et homme de paix, aidé par sa fille linguiste, fit le rapprochement entre les 7 Dormants de la Sourate 18 de la Caverne et le chant de Gwerz : Ar seizh saint. Un an avant la guerre d’Algérie, le Trégor vit naître le pèlerinage islamo-chrétien, greffé sur le Pardon ancestral. Cette année, le 22 juillet tombe un dimanche en début de Ramadan, un Imam a organisé la prière de rupture du jeûne et offert les dattes, le lait puis la chorba. Cette année la nuit du Destin (fête musulmane) tombe dans le nuit du 14 août, nuit de la fête de l’Assomption, chez les chrétiens. Une autre occasion de vivre ensemble et distinctement des heures de veille. Confions cette nuit du Destin 2012 à Myriam, mère de Jésus. Le monde n’a-t-il pas besoin de veilleurs. Que Saint Michel archange déploie toute son armée céleste et protège tous les hommes de bonnes volonté du monde entier qui ose allé contre les logiques de guerre inspirées par satan. Rien n’est pire que la guerre.

Louis Massignon organisa pendant la guerre d’Algérie, un jeûne pour la Paix dans l’esprit des jeûnes du Mahatma Gandhi. « La non-violence et la rencontre de l’Autre » est au coeur du message des rencontres de Vieux-Marché. Lanza Del Vasto fut un pionner en matière de non-violence en France en créant la communauté de l’Arche de La Borie Noble à Roqueredonde dans l’Hérault (34). Un autre pionner est Jean Vanier qui fonda les communautés de l’Arche, avec un esprit de « vivre ensemble » en acceptant les fragilités de chacun et proclamant le respect de la Vie.

A l’époque de la guerre d’Algérie Vieux-Marché fut déjà un refuge, lieu de rencontre et de réflexion face à la cruauté de cette guerre. Le gros « bourdon » de la cathédrale d’Alger est visible dans l’Eglise de Vieux-Marché.

Des personnes athées et des agnostiques viennent à Vieux Marché car ils s’intéressent à la démarche de Louis Massignon pour « une paix sereine ». Le père Jean-Jacques Pérennes, disciple de Saint Dominique, a rendu grâce pour l’héritage spirituel et littéraire de Louis Massignon qui sert de référence aujourd’hui à l’institut du Caire, l’IDEO.
50 ans de l’indépendance de l’Algérie

Les territoires de l’Algérie était en 1958 des départements français. Une guerre civile démarra alors. Cette guerre civile revendiquait un statut égal pour tous les habitants de l’Algérie. Des conceptions politiques diverses s’affrontèrent alors. C’est l’indépendance de l’Algérie permit le rétablissement de la paix. Beaucoup d’algériens vivents en France aujourdh’ui et des mariages mixtes ont eu lieu. Confions à Saint Augustin, d’Annaba, l’avenir de la France et de l’Algérie. L’Algérie fût consacrée à La Vierge Marie, en témoigne une plaque à ND des Victoires à Paris. La France fut consacrée à la Vierge Marie par Louis XIII. Il obtint de Dieu un héritier : Louis XIV.

Alors que l’Europe se reconstruisait après la seconde guerre mondiale, la France fut cruxifiée par cette guerre en Algérie. Des attentats et des affrontement firent couler le sang tant dans les départements d’Afrique du Nord que sur le continent. Il sagissait d’une guerre civile qui devint une guerre entre deux nations. Or ces peuples qui contituaient la France à cette époque s’était battus ensemble dans les tranchées pendant la guerre 1914-18, puis lors de la guerre 39-45, ce qui a toujours donné aux soldats algériens, maliens… et à leur descendants un droit à la nationalité française par le sang-versé pour la France.

L’Algérie est indépendante depuis 1962. Beaucoup d’algériens sont habités par l’esprit de la France Libre que certains français eux-même ont oublié. Le sang des combattants durant les guerres a lié les peuples. Beaucoup de couples dit mixtes se sont unis depuis plus de 150 ans.
L’esprit de « La Caverne » aujourd’hui

Actuellement, l’histoire des sept dormants peut être un enseignement, alors que des évènements violents ont lieu dans le monde entier. Les Hommes sont confrontés à la tyrannie de la mondialisation économique qui déracinent les peuples de leurs histoires. L’Homme de Foi croit en la Résurrection des morts après le jour du Jugement dernier qui verra le retour de Jésus-Christ dans sa Gloire. Tout être humain toujours se préparer pour le départ vers la Paradis après le pèlerinage terrestre. Les hommes et femmes qui cherchent Dieu d’un cœur sincère sont incités et souvent contraints de vivre leur foi de manière souterraine, alors que le monde, lui court à sa perte. La France, l’Europe et le monde sont confrontés à de graves injustices. Les dirigeants doivent gérer la misère galoppantes. Que l’Esprit de Dieu inspire les gouvernants de France et du monde entier !
La tradition non-transmise

La modernité après la seconde guerre mondiale a suscité une rupture dans la transmission de la tradition. Les générations nouvelles sont confrontées au vertige de l’absence de racines intérieures et extérieures. Dans ce désert, seule la manne donnée par Dieu nourrira ces générations assoiffées d’Amour et de Miséricorde divine. Le Monde et ses richesses fut confié à l’Homme, objet de l’infinie tendresse de Dieu. Le fait que l’Homme ne soit plus enraciné, dans la prière, la Parole de Dieu, la liturgie, et les sacrements entraîne que Dieu ne gouverne plus les actes des hommes. Pèchés individuels ou collectifs empêche l’Homme d’agir pour le bien commun.
Al Hallaj, un mystique syrien, martyr en 922

Al-Hallaj, le grand mystique soufi, fut emprisonné neuf ans, puis il fut torturé et exécuté le 27 mars 922 à Bagdad, en l’année 309 de l’Hégire. Louis Massignon fit une étude approfondie sur ce martyr perse qui vécu une véritable Passion. Louis Massignon fit ses études au Caire en Egypte puis alla vivre en Syrie. Il devint prêtre dans une église de rite araméen. Les personnes qui nous ont précédé peuvent nous aider à réveiller nos consciences et rappeler que nous ne sommes que de passage sur cette terre et que le but ultime est le Paradis.
Des chemins d’espèrance au pays de Saint Yves

Ces rencontres interreligieuses ou interculturelles peuvent ainsi mettre en avant l’héritage commun des religions. Souvenons-nous que Saint Augustin, grand apôtre de la Liberté en Dieu et qui combattit les hérésies, était de Annaba. Vieux-Marché se trouve dans le Trégor en Bretagne, pays de Saint Yves, patron des bretons et des avocats car célèbre pour sa charité et la défense des pauvres.

A Rome, dans les catacombes de Rome au temps des persécutions, un tableau au dessus de sépultures des premières sépultures chrétienne : sept hommes attablés au Festin céleste associé avec la représentation du Bon Berger (Jésus). La symbolique du chiffre sept contient donc une espérance universelle. La perspective du Salut et du Paradis s’ouvre pour tous les Hommes par Grâce et par Miséricorde. Lorsque vous viendrez à Vieux-Marché, la tradition est de faire un voeux en buvant à la sainte fontaine, et d’espérer le meilleur pour vous et pour le monde.

En ces temps, qui sont peut-être les derniers, comment convertire les âmes sinon par la simplicité, la joie et la clarté de cette rencontre. Le feu du Tantad était cette année exceptionnel et invitait les personnes présentent à contempler la spendeur de Dieu.
Le dialogue inter-religieux

La résurrection est universelle comme le sont les symboles du feu et de l’eau. Le dialogue interreligieux n’est pas un meeting fusionnel ; c’est une rencontre de personnes de bonne volonté cherchant à affronter les défis de notre temps. Chacun garde son identité et réfléchit avec l’Autre. Différents regards sont posés sur l’actualité que vit l’Humanité.
Informations pratiques

Cette année le pèlerinage à eu lieu au début du Ramadan. L’esprit d’hospitalité des habitants de Vieux-Marché a tout prévus l’accueil et le respect de chacun.

1. Le pardon catholique : Procession de la Vierge et Tantad (feu sacré) dans le hameau, suivi de la messe et du Fest-Noz le samedi soir. Le dimanche matin messse à 10h suivie de la marche vers la source sacrée où on lira la Sourate 18 du Coran en français et psalmodié en arabe.

2. Rencontres islamo-chrétiennes par l’association »les Sources des Sept Dormants »le 21 juillet 2012, dans la salle municipale de ville de Vieux-Marché. Au programme des 50 ans – 1962-2012 :
- Disparition de Louis Massignon,
- Accords d’Evian entre l’Algérie et la France,
- Indépendance de l’Algérie,
- 2012 : Quel impact aujourd’hui ?

3. Une exposition de photographies sur le pardon des sept saints organisée par Louis-Claude Duchesne

4. Animations organisées par « Tud Ar Seiz Sant »: (Gens des sept saints) :
- Vide-grenier le samedi (3 euros le mètre),
- Jeux divers, jeux de boules,
- Balades à dos d’ânes avec l’association Méné Brait,
- Repas le samedi midi et le soir,
- Pardon à 21h puis Procession à la Vierge Marie, Tantad sur la place Massignon,
- Fest-Noz (fête de nuit), danses et chants bretons, jusqu’au bout de la nuit.
- Messe du dimanche des Sept Saints à 11h, suivie de la procession à la source bénie : Ar Stiffel.
Boire à la fontaine de l’eau et faire un voeu, en se confiant au Dieu Miséricordieux,
- Le dimanche midi, un repas « méchoui »hallal, fontaine aux sept trous (Ar Stiffel en breton)

5. Balade contée des « Moines Celtiques » à 17h. 5000 ans d’histoire à Vieux-Marché.

Pour venir à Vieux-Marché : en train ou en voiture Paris-Brest jusqu’à Plouaret-Trégor en Bretagne (22). tourner à droite vers Vieux-Marché, à l’entrée de Plouaret. Le hameau des Sept-Saints est accessible à pied de Vieux-Marché.

Gourmandise à Vieux Marché

« Les Roches des 7 saints » sont des gâteaux fabriqués M. Geoffroy Galerne, boulanger place des déportés. Le petit plus pour un pèlerinage d’un jour.
Aux environs

Aux environs de Vieux-Marché :A vol d’oiseau, on est proche de Saint-Michel-en-Grève au bord de la mer (Lokmikael-an-Traezh) ou à Saint-Efflam réputé pour la pratique du char à voile. Il est bon de visiter les château de Rosambeau et de Tonquédec. Les abbayes de la région : Abbaye Notre-Dame de Beaulieu, Abbaye de Beauport, Abbaye Notre-Dame de Bon-Repos, Abbaye Notre-Dame de Boquen, Abbaye de Bégard, Abbaye Notre-Dame de Coatmalouen, Abbaye Notre-Dame de Lanthénac, Abbaye Saint-Aubin des Bois, Abbaye de Saint-Jacut, Abbaye Saint-Magloire de Léhon.

Les documents à télécharger (au format pdf) :

- L’affiche du Pardon 2012

- Le programme des rencontres

- Les Cahiers d’Orient et d’Occident

- Ecrit de Louis Massignon sur les sept dormants

- Chant profond de Bretagne : gwerz »Ar seiz Sant »

- La méditéranée des sept Dormants

- « Notre Père » en langues dont le breton

- Basilique Saint Augustin à Annaba en Algérie

- Livre sur Ghandi

Illustrations : Place Louis Massignon au hameau des Sept-Saints en Vieux-Marché (22). L’icône des sept saints Orthodoxe. de Le dialogue dans la chapelle des sept-saints. La fontaine sacrée des 7 saints où l’on fait un voeux. Mohammed Idali, calligraphe breton d’origine marocaine, proposait d’écrire un nom ou une parole en arabe calligraphié. Le colloque islamo-chrétien. La récitation du Coran par l’Immam. Autel des moissons : Saint-Isodore, martyr et patron des cultivateurs et laboureurs. L’icône orthodoxe des 7 dormants. Bal breton le dimanche après-midi. Ballade en carriole tirée par un âne grâce à l’association Méné-Brait. La bénédiction du Tantad (feu) par le prêtre symbolisant la lumière de Dieu jaillissant dans nos ténèbres.

Vidéos : Pèlerinage Islamo-chrétien de Vieux Marché, Benoît XVI, Les rencontres d’Assise 2011, Soeur Marie Keyrouz chante « Les Béatitudes », Evangile de Saint Mathieu, Mahatma Gandhi, le mystique iraquien Al Hallaj, Michael Lonsdale conte l’histoire, Sourate 18 du Coran récitée chaque vendredi dans les mosquées.
place Louis Massignon Boire à la source des sept trous : ar Stiffel La récitation de la Sourate 18. Le Pardonneur de l’année 2012 à Vieux-Marché. place Louis Massignon Saint Isidore, patron des laboureurs, nous rappelle que le pardon se passe pendant les moissons. Dimanche après-midi : le bal breton.

Pèlerinage islamo-chrétien

Rencontres d’Assise

« La Prière de Jésus » en arabe

« Le Notre Père » en araméen

Sourate 18 du coran

Gandhi

Al Allaj

Mickael Lonsdale
En savoir plus

Louis Massignon
Jean-Jacques Pérennes
Idéo du Caire
Diwan
Le mot du Curé
Armor TV
Reportage INA-1957
L’évangile du jour
Yann Fanch Kemener
Philosophie du pèlerinage
Livres de L. Massignon
Pèlerinage Islamo-chrétien
7 dormants à Tataouine
Texte du Gwerz
Calligraphie, M. Idali
Université de Toulouse
Les Baladins de la Tradition
Spiritualité

La Caverne
Rosaire avec ND de Miséricorde
Eglise catholique d’Algérie
La Nuit du Destin
Saint François d’Assise
Saint Isidore
Saint Yves
Charles de Foucauld
Lanza del Vasto
Martin Luther King
Notre Père en langues
Pardon breton catholique
Marie Madeleine
Saint Augustin
Sainte Monique
Grégoire de Tours
Jacques de Voragine
Salman le Perse
Al-Hallâj
Ibn Abbas
Abdu’l-Bahá
Inter-religieux

Définition
Pèlerinage Inter-religieux
L’Esprit d’Assise
Abd El Jalil
Dialogue en Marche
Les Morts de la Rue
L’Arche de Jean Vanier
Fraternité d’Abraham
Chrétiens de Méditéranée
Revue « Se comprendre »
GRIC : Groupe de Recherche
Foyers Islamo-chrétiens
Amitiés Islamo-chrétiennes
L’Algérie

Algérie : le temps du dialogue
La guerre d’Algérie
Histoire-géo
Les Accords d’Evian
Service Relations avec l’Islam
L’Algérie de St Augustin
Mosquée de Paris
Les Amis de l’Algerie
Patrimoine algérien
Patrimoine rapatrié
Breizh – Bretagne

La Bretagne
Tourisme catholique
Caritas 22
Le Tro-Breizh
Provinces de France
Diocèse de Saint-Brieuc
La langue bretonne
Diwan – Breizh
Breton : langue vivante
Livres en breton
Anjela Duval
Office de Tourisme à Lannion
Commune de Vieux-Marché
Festival inter-celtique
Les bretons de Paris
Château de Rosambeau
Château de Tonquédec
A lire

Louis Massignon :
- »Les Sept Dormants d’Éphèse (Ahl al-Kahf) »Revue des Études Islamiques, Paul Geuthner, Paris, 1954 à 1963.
- »Écrits Mémorables », Ed. Robert Laffont,2009.
« Les Sept Dormants, Apocalypse de l’Islam », in Analecta Bollandiana, Bruxelles,1950.

François Jourdan :Tradition des Sept Dormants. Ed. Maisonneuve & Larose
Jacques Keryell : Louis Massignon, au coeur de notre temps. Ed. Karthala
John Tolain :
Le Saint chez le Sultan. St François d’Assise en 1219 rencontre le Sultan d’Egypte.
A écouter

Yann Fanch Kemener : Gwerz, chants profonds de Bretagne.
Aqdas Al-Mouloq : Marie (Myriam), Sourate XIX. Ed. Al Sur.

M

 

12 août, 2013

Les Semeurs d’étoiles ont 20 ans !Soutenons la noble action de toutes celles et ceux qui soutiennent la mission de Père Denis Ledogar prêtre et aumônier

Classé dans : Non classé — andreadicaffa02 @ 14:08

Madame, Monsieur,

Depuis 20 ans, grâce à votre fidèle soutien, les Semeurs d’Etoiles aident au quotidien les enfants hospitalisés et leur famille.

Nous souhaiterions, à l’occasion du 20ème anniversaire des Semeurs d’étoiles, vous inviter à partager un moment de convivialité :

le Dimanche 29 septembre 2013 à partir de 11 heures à Uberach

  • Lieu : Uberach ( à coté Pfaffenhoffen)
  • 11 h : Célébration eucharistique à la grotte par le Père Denis LEDOGAR
  • 12 h30 : Apéritif offert par les Semeurs d’Etoiles (salle des Fêtes d’Uberach)
  • 13 h00 : Petite restauration Toute l’après-midi : Après-midi festive et animations Avec la présence de Marlyse Riegenstiehl

Parking gratuit – Animations pour enfants

Pour nous permettre d’organiser au mieux cette journée, nous vous remercions de bien vouloir nous confirmer votre venue en nous retournant le  coupon (à télécharger en cliquant ici) avant le 8 septembre 2013 à :

20ans@semeursdetoiles.com ou Semeurs d’Etoiles CHU de Hautepierre – 67098 Strasbourg Cedex

Denis Ledogar, fondateur, Luc Dörr, président et l’ensemble du conseil d’administration

affiche_web

ringo15

 

Ringo est l’âne vedette de l’association Semeurs d’étoiles. Avec son maître, Jean-Charles Gress,  il s’est tant dépensé sans compter pour de nombreuses manifestations, qu’il devait figurer en bonne place sur notre site.

Vous pouvez retrouver ses nombreux exploits passés (et à venir)  sur la page que nous lui consacrons. 

Un grand merci à lui !

L’association Savoir Faire de Molsheim vient de remettre un don de soutient aux Semeurs d’étoiles de 3000 €.

Elle gère le salon « Savoir Faire » qui a eu lieu à Molsheim du 15 au 24 mars 2013 à l’hôtel de la monnaie avec plus de 50 artisans. Elle a d’ores et déjà décidé de soutenir les Semeurs pour 2014. Un grand merci à eux pour leur dynamisme et leur engagement.

La page Facebook de l’association Savoir Faire.

Les Semeurs d’étoiles ont 20 ans !Soutenons la noble action de toutes celles et ceux qui soutiennent la mission de Père Denis Ledogar prêtre et aumônier  savoirfaire1

Luc Dörr reçoit le don entouré des membres de l’association Savoir Faire

savoirfaire2

Les responsables du Lions Club Strasbourg Cathédrale viennent de remettre un don de 4 000 € à l’association Semeurs d’Etoiles ! Un grand merci à eux pour leur soutien concret qui permettra le financement de nombreux projets de l’association.

Le site du Lions Club Strasbourg Cathédrale : http://lionsclubcathedrale.blogspot.fr

IMG_1257

Nicole Martin Spittler reçoit le chèque du Lions Club Strasbourg Cathédrale

Read More →

La remise des chèques et des résultats des opérations caritatives réalisées par l’ensemble des sections du collège de Zillisheim a eu lieu le lundi 10 juin, en présence des délégués de classe et des représentants des associations bénéficiaires.

lors-de-la-cloture-des-actions-caritatives-des-eleves-du-college-des-sommes-consequentes-ont-ete-remises-a-diverses-associations-humanitaires-dr-1

© photo DNA

Henri Draxel, censeur, a ainsi accueilli le président de Terre des Hommes France (AL68), Jean-Paul Dupont, ainsi que Cyrille Dossou et Eloi Olanlo, représentants de l’association togolaise « Cité de la lumière ». A cette occasion le formidable investissement des élèves a été souligné.

Ainsi l’opération « Bol de riz » a généré un bénéfice de 3370 euros, dont une partie a été remise au chanoine Vigneron au profit des Pères Dominicains en Irak et l’autre à l’association « Semeurs d’étoiles ».

Read More →

Les aléas du calendrier et les nombreuses obligations des deux associations ont enfin permis à Koenigshoffen Demain de remettre un chèque de 1 009 € au père Denis Ledogar, au cours d’une petite rencontre en comité restreint chez Christine Hebting, présidente de l’association.

Cette somme, qui correspond aux bénéfices du marché de Noël organisé par Koenigshoffen Demain, contribuera à l’action de l’association Semeurs d’étoiles auprès des enfants malades du CHU de Strasbourg.

Denis Ledogar a notamment évoqué la nécessaire présence des parents auprès de leur enfant hospitalisé, dans des services fraîchement repeints, équipés de téléviseurs achetés par Semeurs d’étoiles, ce qui évite les locations d’appareils chères pour les parents. Ces aménagements offrent aux enfants hospitalisés en séjour souvent long un cadre plus agréable.

En 2011, les bénéfices du marché de Noël avaient permis aux Restos du cœur de financer des achats de puériculture. En 2012, l’association a choisi Semeurs d’étoiles. Cependant, pour continuer à soutenir les Restos du cœur, 425 pots de confitures fabriqués par des membres de l’association ont été remis à La Fringale, rue des Remparts.

Source DNA du 11/06/13

30 juillet, 2013

Blog litteraire de Samuel Brussell

Classé dans : Non classé — andreadicaffa02 @ 13:59

brussell-express.be

Le blog littéraire de Samuel Brussell

Inscriptions de Volterra

Posted on 26 juillet 2013 | No responses

Blog litteraire de Samuel Brussell volterra-etrusca« Il y a quelque chose de naïf et de badaud dans mon respect pour une inscription vraiment antique. Il me semble que je me mettrais à genoux pour lire avec plus de plaisir une inscription vraiment gravée par les Romains : j’y trouverais un grandiose qui, pendant huit jours, fournirait matière à mes rêveries; j’en aimerais jusqu’à la forme des lettres. Rien ne me révolte comme une inscription moderne : c’est ordinairement là que toute notre petitesse éclate hideusement par ses superlatifs. »

« Les Romains ont détruit les aimables républiques de l’Etrurie. Chez nous, dans les Gaules, ils sont venus déranger nos ancêtres. Malgré tant de griefs, mon cœur est pour les Romains. Je ne vois pas ces républiques d’Etrurie, ces usages des Gaulois qui assuraient la liberté; je vois, au contraire, dans toutes les histoires agir et vivre le peuple romain et l’on a besoin de voir pour aimer. »

stendhal-chroniquesStendhal me poursuit jusque sur les terres d’Etrurie et de Rome dans la forme d’un in octavo que je serre dans ma poche; pendant huit jours, sous un vaste ciel d’été, les pierres et les inscriptions ont enflammé mon imagination au point d’occulter la société contemporaine et ses sottises. Chaque soir, je rentrais dans mon hôtel la tête en feu, au moins autant par le soleil qui cuisait la ville à l’intérieur de ses murailles que par les pierres et les inscriptions que j’avais caressées du regard et de la main : je voulais mieux sentir ces organes du passé. J’étais sous le charme des Etrusques, que je n’opposais pas plus aux Romains que je n’aurais imaginé les païens contre les Chrétiens : j’assistais à la danse de l’histoire à travers les mouvements de civilisations. Tout ne faisait qu’un : l’incision grecque, étrusque ou latine s’ouvrait devant mes yeux comme une source naturelle de vie.

Au fond, nous cherchons la vie, simplement. Au septième jour de mon escale à Volterra, j’eus le sentiment, au son des cloches de l’office dominical, d’avoir accompagné un cycle, de m’être surpris à être au monde – la Création s’accomplit à chaque instant. J’eus envie d’aller confier ma pensée au prêtre de l’Eglise de San Lino adossée à mon hôtel, avec qui j’avais échangé quelques propos sur Volterra la veille, mais je craignais de l’ennuyer. L’hôtel était un ancien couvent de nonnes et ici commencent les inscriptions modernes promptes à exalter « l’honneur national », qui vendrait le Messie pour un ruban à la boutonnière. Il y avait les inscriptions dédiées au temps et à chaque homme, et celles éphémères qui ne flattaient qu’elles-mêmes. J’avais évoqué au libraire du musée de la Pinacothèque la plaque apposée en façade de l’hôtel Nazionale, à l’entrée de la ville.

DAnnunzio-Volterra« Dans cet hôtel/à l’automne 1909/Gabriele D’Annunzio/tira l’inspiration/pour son livre Forse che si forse che no/transcendant/dans des pages sublimes/l’éternelle beauté de Volterra/“cité de vent et de roche” ».

Je m’étais aventuré à l’intérieur de l’hôtel et l’atmosphère m’avait rappelée celle que j’avais ressentie à Turin, plusieurs années en arrière, en pénétrant dans le hall de l’hôtel Roma, en face de la gare de Porta Nuova. On sentait le sarcophage de D’annunzio dans cet hôtel de Volterra, comme l’ombre de Pavese flottait dans l’hôtel turinois aux allures de vieille Autriche. Le rouge et le noir, pensai-je, sont des couleurs voisines sur les bannières et les chemises. « Il m’est sympathique, ce D’Annunzio… m’avait dit mon libraire avec un fond de timidité dans la voix. Son aventure de Fiume avait quelque chose de fou… » Fiume était pour moi italienne : les provinces illyriennes, la baie de Kvarner, la langue istriote appartenaient aux inscriptions antiques de l’Italie. Une inscription antique se lisait sous l’inscription moderne d’un codicille administratif.

« D’Annunzio me plaît parce qu’il se foutait du monde… il aurait pu être du côté de Staline… » ajouta rêveur le gardien des lieux. Je lui confiai que deux semaines plus tôt, j’avais fait l’excursion à Gardone, au Vittoriale, au cours d’une halte sur le lac de Garde. En face du mausolée d’annunzien, les boutiques de souvenirs offraient le plus innocemment du monde divers petits objets – tasses, briquets, cendriers – à l’effigie du Commandante, du Duce ou du Che… « Toujours le rouge et le noir… » commentai-je à mon aimable lettré. « Che confusione, la rivoluzione! » s’exclama-t-il en riant de bon cœur. « Les gens veulent de l’enthousiasme… » poursuivit-il songeur. Nous en vînmes à parler du Rosso Fiorentino, un des peintres de la Renaissance qui était exposé dans le musée. Il m’avoua qu’il lisait volontiers des biographies et qu’il connaissait au sujet de cet artiste quelques anecdotes plaisantes.

« Il Rosso Fiorentino aimait beaucoup les animaux un peu sauvages, il se passionnait pour le monde du cirque. Ses amis lui offrirent un jour un petit singe et on le vit bientôt se promener partout en compagnie de ce singe. Puis on s’aperçut qu’il lui avait enseigné à aller voler des fruits et des légumes dans les vergers et les potagers des couvents, et les bonnes sœurs le prirent en grippe… » Devant l’expression d’émerveillement qu’il surprit peut-être sur mon visage, il minimisa son rôle de conteur : « Mais cette anecdote et cent autres vous la trouverez dans le Vasari… » Heureux Italiens, me dis-je, vous êtes en paix avec le passé, vous ne faîtes qu’un avec vos inscriptions antiques. J’avais senti quelque chose de malicieux dans la peinture du Rosso Fiorentino. Mon camarade eut un mot qui résumait tout l’art de ces maîtres : « Ce que l’on sent, en voyant ces tableaux, c’est l’energia. »

Je ne pus m’empêcher de provoquer l’intelligence de cet homme : « Et que dire des inscriptions à l’arrogance politique, fanion ou calicot qui crucifiaient la pierre ancienne à travers le pays? » Sa réponse me mit en paix : « Ni enthousiasme ni énergie. »

Jours d’été à Volterra

Posted on 18 juillet 2013 | No responses

300px-Roman_masksJe sais gré à Perse d’avoir poussé mes pas vers sa cité natale, Volterra. Depuis quelques jours, je goûte à un vent frais qui souffle sur la colline où la pierre, tellement naturelle dans son expression, semble surgie du règne végétal – dans ses jointures transpire une sève vive. Je sais gré au libraire de Porta Alba, à Naples, de m’avoir ouvert ses rayonnages du monde antique dans la caverne du savoir où, perché sur un escabeau devant cette tribune, j’ai dialogué avec les Anciens. Quant à trouver ici une trace du passage de mon poète latin… seul le théâtre de la ville porte son nom : Teatro Persio Flacco, orné de la devise « vis unita fortior ». Et je n’ai qu’à tendre l’oreille dans le hall pour imaginer une scène écrite par le poète. Histoires personnelles déclamées à voix haute entre les employés – la jeune actrice venue de la capitale, Pise, amie du conseiller de la Région… la semaine de congés à prendre en septembre… Et, la faute à la satire de Horace, tout ne m’inspire que tendresse et compréhension. Je parcours la ville en promenant mon regard sur les dalles et les façades et les places, tout est baigné de blancheur, une onde de fraicheur m’accompagne en tout lieu ; dans les perspectives des ruelles qui ceignent le promontoire, les percées d’ombre et de lumière offrent au temps un terrain de jeu. Sur le pas des portes et des boutiques où l’on vend encore des légumes, du fromage, du pain, devant les ateliers où l’on exerce son métier avec aiguille, colle et encre, des vieux devisent entre voisins, assis sur un rebord de fenêtre, saluant les connaissances ; des enfants jouent avec un ballon et s’interpellent avec l’énergie des premières heures passées dans ce monde. Dans une échoppe, je feuillète un ouvrage sur les mœurs des Etrusques et je comprends qu’une seule inscription sur une pierre fait vivre une civilisation ; en foulant l’herbe du terrain de l’Acropole, j’entends les voix de l’Etrurie.

Je me couche sur la mousse d’un banc de terre et, blotti à l’ombre d’une pierre, le regard perdu dans le ciel, je me libère de toute pensée pour ne plus sentir que la pulsation tiède du moment; le temps exhale un halètement de gros animal ; sous la poussière, la main caresse des viscères encore chaudes; l’ennui nous conduit avec volupté à la béatitude.

Milan, Parc du Simplon, dimanche de juillet

Posted on 8 juillet 2013 | No responses

piazza-piemonteUne nuit de juillet dans une villa du début du siècle, près de la place du Piémont, à Milan. Les moyens manquent aux héritiers qui louent deux chambres immenses où à peu près tout est négligé : la lumière tremblote sous l’abat-jour qui penche, le pommeau tournesol de la douche est descellé et laisse ruisseler un filet d’eau. L’autre hôte, un inverti encore jeune sanglé dans un vêtement noir et lustré, vit ici à l’année. Il survit dans cette maison quasi abandonnée en organisant des “prises de photos” qui mettent en valeur la Villa E. et lui donnent quelque renom dans les milieux glamour de la mode.

Aux premières lueurs du jour, en sueur, je referme la valise intacte, que désormais je n’ose même plus défaire. La chemise blanche en lin mise à sécher pendant la nuit flotte sur un cintre comme un pavillon quémandant la paix. La chaleur invite à la reddition.

sirenetteDevant l’Arche de la Paix, les cafés de la via Sempione sortent leurs tables. Le nom donné à l’arche monumentale me rappelle le sens du mot : la paix dépasse le triomphe. Silence d’un dimanche matin à peine éraillé par le passage d’un tram d’une autre ère – crachotement d’un 78 tours qui sursaute sur un socle branlant. Le parc du Simplon est une oasis avec ses arbres, ses allées et ses pièces d’eau parmi lesquels tourne un peu de fraîcheur. Etendu sur un muret de pierre, à l’ombre d’un sapin, je succombe à la paix dominicale. Des voix tout autour peu à peu se font plus vives. J’entrouvre les yeux et j’aperçois un groupe d’enfants; un homme, un prêtre, s’adresse à eux avec dans sa voix une bonté naturelle, qui fait entendre une patience infinie. L’accompagnatrice est vêtue à la scout : short, brodequins de marche, chemisette et chapeau de toile. Ils sont de toutes les races et la variété des teints, des expressions, des chevelures est belle parce que ce rassemblement n’obéit à aucun mot d’ordre, à aucun programme. Ils sont ensemble et ils brillent chacun par leur individualité; quand l’accompagnatrice ou le prêtre appellent un nom, l’enfant resplendit de son visage unique, à l’image du Créateur. Il y a une bonté d’une autre nature chez cet homme que je pressens appartenir à l’Eglise – il est totalement absorbé dans sa mission : faire sortir ces enfants et les occuper gaiement pendant un dimanche d’été.

Se préparant à une course entre les arbres avec les autres enfants de l’Oratorio San Giuseppe (j’ai demandé à l’accompagnatrice d’où ils venaient), un gamin venu d’une contrée d’orient lance dans un pur accent milanais :

« Ohè, Don, vous pouvez vous enlever du chemin? »

Le don baisse les yeux d’indulgence devant le rire de joie de l’enfant. Je me redresse à la vue de ce spectacle tout simplement évangélique. La paix doit être banale, me dis-je, loin du triomphe. Comme Milan est belle sous le soleil de plomb d’un dimanche de juillet. Et les sirènettes qui ouvrent le passage du petit pont sur le cours d’eau sont aériennes, comme nos pensées.

Catulle à Sirmione

Posted on 4 juillet 2013 | No responses

Pyramus_PompeiDans la chambre écrasée de chaleur, je lisais Ovide, feignant d’entendre ses sages conseils d’innamoramento. Aimer est un verbe et le verbe est action. Un graffiti de Pompéi dansait devant mes yeux : « Hic nihil futui. » La dévotion s’exprime jusque dans la débauche. La joie païenne est un bain de fraîcheur.

« Quand la chaleur m’étourdit, je vais à l’église ou au cinéma », m’avait dit mon hôte.

Les colonnes du scirocco m’avaient fait migrer à l’est, vers ce lac qui partageait deux antiques provinces : la Lombardie et la Vénétie. À la sortie de la gare, à Desenzano del Garda, sur la petite place qui avait une allure de carrousel, on respirait déjà un air d’orient. Les accents lombards et vénitiens ouvraient et fermaient leurs voyelles selon leur bon plaisir, voguant dans l’air comme un lâcher de ballons. Le bus longea le lac pendant une demi-heure jusqu’aux portes de la cité-presqu’île. Nous étions à Sirmione et j’eus envie de courir voir les murs de l’antique villa romaine où Catulle connut le bonheur.

Au matin, je reçus ce mot qui fit surgir devant moi un paysage de deux mille ans. On dirait que tous nos mouvements nous portent à aller à la rencontre du passé, ce vénérable géniteur.

una-scena-de-la-grande-bellezza« J’ai aimé le discours que fait Servillo à son amie radical chic, m’écrivait mon hôte depuis la métropole lombarde. Le film m’a plu, avec ses personnages un peu outranciers et l’ambiance de mélancolique indulgence dans laquelle ils baignent. C’est vrai, il ose quelques lieux communs, mais ils ne gâchent pas mon plaisir. Parce qu’ils sont sauvés par un fil d’ironie et par quelque chose d’humain. J’ai aimé cette Rome inattendue, nocturne, vide, monumentale et décadente. Un somptueux sépulcre. Même si je n’arrive pas à la voir ainsi. Rome est une ville qui ne me parle pas. Au fond elle ressemble à Milan : elle n’est que le fantôme de son passé, même si à Rome, le passé est là, qui continue à pourrir sous la lumière du soleil, tandis qu’à Milan il est mort et enseveli à jamais.

« À Rome, ils festoient encore avec les charognes de leur passé glorieux, mais ils savent profiter de la vie, à Milan on se croit évolués et cosmopolites, citoyens d’une ville nouvelle – et les seuls fantômes qui surgissent, c’est nous. Parce que nous vivons dans une ville qui a perdu son identité et que nous nous racontons des mensonges comme l’amie radical chic de Servillo. »

Catulle-LesbieAu fond, Catulle, mon cher Catulle, était terriblement présent. Rome était partout dans cette péninsule qui avait débordé sur l’Europe entière.

« Te chiavasse! » L’obscénité de l’acteur napolitain jetée au visage de la demi-mondaine romaine explose comme un fruit mûr en bouche.

Je trouvai à l’hôtel un dépliant qui reprenait les paroles d’une des poésies de Catulle :

« Avec quel plaisir, avec quelle joie je te revois, Sirmione, perle des îles et des presqu’îles, parmi toutes celles qu’accueille Neptune dans la vaste et claire étendue des mers et des lacs ! C’est à peine si j’arrive croire que j’ai quitté les champs de la Thrace et de la Bitynie, et que je puis sans crainte te revoir. »

Derrière la vitre de la réception, je distingue sur un mur de l’arrière pièce mal éclairée un portrait du duce, à côté d’un crucifix. Ici on croit à un bréviaire simple : l’ordre et l’argent. Sur l’autre rive du lac, les ruines de la république sociale de Salò : hotels, salles de jeux, promotions immobilières. Les héritiers des Chemises noires se sont convertis au dieu du commerce. Il leur faut un messie plébéien. Catulle, preux enfant de la Rome impériale, encule les pieux boutiquiers (il a chanté ce verbe.) Et le sourire tout de grâce ancillaire de la femme de chambre allège les pensées. La roche fraie avec le buisson et un dieu nouveau nous rendra à la vie et au monde.



Champs phlégréens

Posted on 26 juin 2013 | No responses

Montesanto-NapoliLa gare de Montesanto, à Naples, se trouve dans le cœur de la vieille ville, dans le quartier populaire de Montecalvario. Ici “populaire” veut simplement dire que dans ces rues, dans ces maisons, sous ce ciel, entre ces étals de poissons, de fruits et légumes, dans la sueur et les odeurs se meut un peuple en vie; à la vie, aucune revendication n’est attachée que la vie elle-même. La Cumana, tel est le nom de la ligne ferroviaire qui dessert les Champs phlégréens. Je me demandais lequel de ces deux noms – Campi flegrei, Cumana – m’avait entraîné à faire ce voyage jusqu’à Pozzuoli – Pouzolles – sur la côte phlégréenne. Et sur la route de Pozzuoli, sur la colline entre Mergellina et Fuorigrotta, à l’entrée d’un vieux tunnel romain qui porte le nom de Grottavecchia ou encore Cripta napoletana, dans le quartier de Piedigrotta, se trouve la tombe de Virgile. À Posillipo, au Pausillipe – « du grec Pausilypon : “où finissent les chagrins” », me rappelle mon vieux guide anglais dans une note à peine déchiffrable. Je n’en demandais pas tant. Je me souvins des mots de Virgile qui m’avaient frappés sur un mur à Mantoue : « Mantua me genuit, Calabri rapuere, tenet nunc Parthenope – Mantoue m’a vu naître, Les Calabrais m’ont enlevé, aujourd’hui Naples est mon fief. » D’où me venait ce sentiment que Virgile était vivant? Cet “aujourd’hui” d’il y a deux mille ans était mien : une ville de l’orient chrétien m’avait vu naître, une tribu d’occident m’avait enlevé, Naples était mon royaume. Je marchais parmi la foule, remontant la ruelle dégorgeant de vivres et de femmes qui enfantent et font vivre, et je compris qu’ici, tous étaient Epicuriens, amants de l’individualité sacrée, ceux-là mêmes qui accompagnèrent Virgile de leur amitié et de leur don pour la vie.

solfatara-pozzuoli« La Solfatara », avais-je demandé à un voyageur de la Cumana – et déjà je voyais ces cratères s’ouvrir au bord de la mer et exhaler leur fumée blanche. Les Champs phlégréens, cette terre brûlée, s’étendaient à travers toute l’étendue du golfe de Pouzzoles. Cette suburbia appartenait aux dieux de la mythologie. En descendant du train, les dieux de toutes parts s’affairaient sans s’occuper de notre présence. « La Solfatara? » Un taxi était prêt à m’y conduire. Nous grimpâmes la route depuis laquelle s’ouvrait une vue sur le golfe et je compris les cris et les gesticulations, à la sortie de la petite gare, d’un inverti qui hurlait en se contorsionnant à une grosse femme : « Salerne! Elle ose me parler de Salerne! Mais vous avez vu Pozzuoli! Mais vous avez vu cette merveille! » Et il cherchait des yeux l’approbation de quelques égarés qui s’étaient mêlés au spectacle, en y joignant un geste obscène. J’y étais allé moi-même de mes grands gestes, jouant de mon influence sur le public, comme pour dire : « Elle vient nous parler de Salerne, la pauvre dame… Mais vous avez vu notre Pozzuoli? »

La question inévitable tomba de la bouche de mon chauffeur de taxi :

« Et vous, d’où vous venez? Vous avez la parlata stretta – un accent serré. »

J’eus une illumination. Ces mots me vinrent comme soufflés par un bon ange :

« Je suis Italien de l’étranger. De l’exil. De la diaspora. »

Après les avoir prononcés, je sentis la simple vérité de ces mots – qui ne pouvait être démentie que par les apparences.

« Australia? » me lança mon camarade en me fixant d’un sourire complice dans le rétroviseur.

« No, Svizzera! » répondis-je d’un trait. « Une petite Australia! » ajoutai-je inspiré.

« Bella, la Svizzera… » murmura mon homme rêveur.

Puis il arrêta son véhicule sur une butte. Nous étions en surplomb de la Solfatara. Il alluma une cigarette et observa un silence respectueux, aspirant avec concentration une longue bouffée qu’il garda quelques secondes en bouche en s’exerçant à une mimique avant de l’expirer lentement.

JMW-Turner-Le-lac-AverneNous restâmes un moment à regarder le spectacle aux allures irréelles de cette bouche de terre béante d’où s’élevaient des nuages de fumée, comme pour nous dire que les cendres du passé étaient encore vives – qu’un monde était là, à nos pieds, qui nous parlait et nous disait ses secrets. Depuis huit jours que j’errais dans Naples et ses alentours, le temps était à l’orage. Quelques gouttes se mirent à tomber, qui nous tirèrent de notre rêverie. Mon camarade me proposa de pousser l’excursion jusqu’au lac d’Averne. La route contournait le temple de Serapis, l’ancien marché romain; l’aspect de ruines donnaient à ce lieu une plus grande réalité, une plus grande majesté, que s’il eût été reconstitué; on n’aurait nullement été étonné de voir des voitures à bras poussées par des forts faire leur entrée dans ce théâtre aux victuailles. Au milieu des colonnes mutilées, la nourriture retrouvait son lien avec le sacré, avec l’offrande. J’avais l’impression que mon chauffeur savait, sentait comme moi toutes ces choses – qu’il les vivait. Le lac d’Averne surgit sous nos yeux, eau muette au milieu d’une végétation touffue. L’orage éclata au moment où nous garâmes contre un parapet et nous vîmes un bref instant les remous des eaux battues, puis les vapeurs qui s’élevaient au moment de l’accalmie. Quelques minutes plus tard, mon chauffeur me laissait à la gare de la Cumana. La ville, les quais, les rails étaient détrempés. Quelques personnes avaient été surprises par l’averse et riaient encore de ce joyeux imprévu. J’avais le sentiment d’être allé me recueillir sur la tombe de lointains parents, que j’avais retrouvés. Et ils m’avaient parlé. Si l’avouer m’eût fait passer pour fou aux yeux des mortels, le nier eût été m’exclure du règne des vivants.

older posts »

Meta

brussell-express.be is proudly powered by WordPress and the SubtleFluxtheme.Copyright © brussell-express.be

26 juillet, 2013

Père Sosthène Marie Ledoux Ordre Servites de Marie .

Classé dans : Non classé — andreadicaffa02 @ 1:42

Il faut le reconnaître, le RP Ledoux n’a pas une écriture ample, souple et agréable. Mais il est le seul auteur en langue française, à ma connaissance, qui ait exposé, fouillé devrai-je dire, les Douleurs de la Vierge, avec autant de profondeur. Si parfois son insistance sur les souffrances peut nous agacer, force est de constater, qu’après d’autres lectures, ses écrits demeurent ceux qui nous ont le plus appris sur les Douleurs de notre Mère. Ce sont notamment ces « Fondements » qui nous font le plus méditer sur le vécu de notre Mère et entrevoir le réel abîme de ses sacrifices. Si vous voulez vraiment commencer à comprendre le vécu réel de la Vierge des Douleurs, selon l’expression hispanique, leur lecture est incontournable. Et naturellement, vous y reviendrez de temps à autre, au moins en partie selon la grâce qui vous guide, car c’est dans ces méditations que vous trouverez votre nourriture la plus substantielle

Le R.P. Sosthène-M. Ledoux OSM (Servites de Marie)

L’ordre des Servites de Marie, parfois nommés Serfs de la Vierge (en latin Ordo Servorum Beatae Virginis Mariae), en sigle : OSM ou o.s.m., est un ordre mendiant de l’Église catholique romaine, créé en Toscane (Italie) au XIIIe siècle. À la vie contemplative, ils mêlent l’apostolat sous toutes ses formes (prédication, enseignement, mission, etc.). Dans l’ordre, tous sont frères et plusieurs sont frères-prêtres. Ils sont aujourd’hui environ un millier répartis sur les cinq continents.

Père Sosthène Marie Ledoux Ordre Servites de Marie .

La plus grande partie des textes viennent du livre intitulé « La plus affligée des mères ou manuel de dévotion aux Douleurs de Marie » (1888) de R.P. S.-M. Ledoux, de l’Ordre des Servites de Marie.
C’est avec cet auteur que vous trouverez la nourriture la plus riche pour alimenter votre méditation, vos oraisons et que vous pourrez entrapercevoir l’abîme des Douleurs de notre Mère, endurées pour notre salut, avec son Fils Premier Né, le Sauveur.

La plus affligée des Mères ou Manuel de dévotion aux Douleurs de Marie

page4-img1

La plus affligée des Mères, ou Manuel de dévotion aux Douleurs de Marie, contenant plus de cinq cents méditations ou considérations d’après les saints docteurs et les écrivains ascétiques… par le R. P. S.-M. Ledoux

Approbation_300px

Exercices principaux

Pour le Premier Vendredi de chaque mois

La désolation de Marie, en Douze considérations
La désolation de Marie dans la privation de son Jésus ;
Désolation de Marie dans sa maison froide et vide de Jésus ;
Désolation de Marie, obligée de vivre au milieu d’un peuple malveillant ;
Désolation de Marie visitant les lieux sanctifiés par les souffrances de son Fils ;
Désolation de Marie en pensant à la ruine de sa nation ;
Désolation de Marie en pensant aux contradictions que devait subir la doctrine de Jésus-Christ ;
La désolation de Marie à la pensée des oppositions que devaient soulever les préceptes divins ;
Désolation de Marie à la pensée des persécutions qui attendaient les disciples de son Fils Jésus ;
Désolation de Marie à la pensée du sang de Jésus répandu inutilement pour le plus grand nombre des hommes ;
Désolation de Marie en pensant aux dissensions qui devaient désoler l’Église, épouse de son Jésus ;
– Désolation de Marie en pensant au triomphe de l’impiété et de l’erreur
;
Marie Reine des martyres.

(d’après le P.B. Troscia,
de l’Ordre des Servites de Marie)

Pour tous les jours du mois

(par le Père Ventura. Général des Théatins)

7 novembre, 2012

Son Eminence André Vingt-Trois un vrai chrétien et un homme très cohérent

Classé dans : Non classé — andreadicaffa02 @ 9:24

Plateforme libre de discussion

Le cardinal  André Vingt-Trois : le mariage gay est une «supercherie»!

« Le Figaro’ » propose un écho au discours du cardinal André Vingt-Trois, archevêque de Paris, à l’ouverture de l’Assemblee générale de la Conférence des évêques de France. L’article se trouve à cette page

Rédigé par Parlons d’orthodoxie le 3 Novembre 2012 à 20:19 | 4 commentaires | Permalien

 

Commentaires
1.Posté par Vladimir le 04/11/2012 18:19
Je redis mon regret de ne pas voir un front interreligieux uni contre ce mensonge. Tous les tenants du mariage véritable doivent s’opposer à ce dévoiement d’un concept fondamental pour notre morale et nos fondements éthiques. La position de l’AEOF (dont on attend toujours la  » déclaration sur les fondements de la conception chrétienne orthodoxe du mariage « ) est évidement proche de celle de Mgr Vingt-Trois et j’espère que nous verrons bientôt ce front commun qui permettra peut-être de faire reculer le gouvernement comme l’avait fait la mobilisation pour l’école libre en en 1984
2.Posté par Alexandre le 04/11/2012 20:05 Son Eminence André Vingt-Trois un vrai chrétien et un homme très cohérent icn_phone(depuis mobile)
En quoi les religieux devraient-ils se sentir concernés par le mariage civil ? Assez de toute cette agitation.
3.Posté par Vladimir le 04/11/2012 21:55
Réponse à Alexandre:

L’Église catholique quand elle critique le projet de loi sur le mariage homosexuel sort-elle «de son rôle» comme l’affirme David Assouline, porte-parole du Parti socialiste? Ou cherche-t-elle à «imposer» sa vision de la famille, comme le soutient Erwan Binet, le rapporteur PS du projet de loi?

Quand on le lui demande, à l’Église, ou plutôt à ses évêques réunis en assemblée plénière annuelle à Lourdes, ils pensent exactement le contraire! Ils affirment réagir à un projet de loi qui est «imposé» par le gouvernement. Et se disent dans leur rôle, non pas de ­politiciens, mais «de veilleurs et d’éveilleurs des consciences».

L’opposition dialectique et symétrique de ces deux discours pourrait ainsi donner l’impression d’un affrontement politique type. Sauf que – paradoxe pour ce gouvernement socialiste – le combat mené par les évêques et leur président, le cardinal André Vingt-Trois, est profondément… social!

Le piège vient des apparences. Dès qu’elle ouvre la bouche sur des questions d’éthique sexuelle, l’Église catholique est – a priori – taxée de rétrograde et d’antiprogressiste. Par les mêmes, du reste qui l’encensaient, il y a deux ans, quand elle grognait contre les méthodes musclées employées par le gouvernement de droite contre les Roms.

Mais c’était de l’éthique sociale qui plus est contre la droite: l’Église avait donc droit de séjour dans le champ de conscience socialiste. Pourquoi donc est-elle ici définitivement rejetée dans le camp de l’obscurantisme?
Rôle structurant du mariage entre un homme et une femme

Même les efforts menés par des évêques, de sensibilité de gauche, qui ont poussé en septembre à la rédaction d’un long texte du conseil famille et société de l’épiscopat, présidé par Mgr Jean-Luc Brunin, évêque du Havre, condamnant l’homophobie et démontrant une bienveillance face à la demande des couples homosexuels pour le mariage (qu’il récusait toutefois en proposant une voie médiane), n’ont eu aucun effet.

C’est que la question n’est pas une tactique d’habillage, c’est un sujet de fond. Le cardinal Vingt-Trois qui n’a aucun souci du qu’en-dira-t-on vise ailleurs. Et il est désormais suivi par toute l’assemblée des évêques.

Contrairement à l’impression qu’il donne, son opposition n’est pas frontale, ni d’ailleurs «morale». Il ne se bat pas sur la question de l’homosexualité en tant que telle, mais vise deux conséquences sociales du projet de loi.

L’une est symbolique, c’est le rôle structurant pour l’avenir concret de la société du mariage entre un homme et une femme. Ce n’est pas un dogme catholique mais du simple bon sens. D’où l’encouragement du cardinal donné à ses «concitoyens» d’écrire à leurs élus des «lettres personnelles» pour l’exprimer avec leurs mots.

L’autre est juridique, imparable. Elle touche le droit de l’enfant à avoir un père et une mère, reconnu par une convention internationale signée par la France en 1990.

Pragmatique, ce cardinal ne sait donc pas si ce combat est perdu d’avance. Il se souvient de l’école libre en 1984 dont le projet de loi – beaucoup plus avancé que celui sur le mariage homosexuel – avait été finalement retiré. Non par une victoire catholique ou une défaite socialiste. Le bon sens, la force de la réalité l’avaient finalement emporté.

4.Posté par Vladimir le 05/11/2012 22:35
Les religions ont mis tout leur poids contre le mariage gay

Juifs, chrétiens et musulmans ont privilégié l’analyse des conséquences sociales du mariage homosexuel, laissant de côté les argumentaires théologiques.

L’intervention des religions dans le débat sur le mariage homosexuel est appréciée par beaucoup mais violemment rejetée par des associations qui militent en faveur de ce projet. Surtout après les déclarations du cardinal Vingt-Trois – il a estimé samedi dernier à Lourdes que ce projet est fondé sur une «supercherie» -, qui ont mis le feu aux poudres et déchaîné une polémique nationale.

Jamais, pourtant, les religions n’ont souhaité constituer un «front uni» sur ce dossier. Le 13 septembre dernier, lors de la réunion de la Conférence des responsables de culte en France (CRCF), un accord tacite était apparu entre juifs, chrétiens et musulmans – les bouddhistes se situant à part – contre ce projet de loi. Mais décision avait justement été prise de ne pas s’exprimer d’une seule voix. Chacun irait à la bataille selon son calendrier et avec ses propres arguments.

Globalement, juifs, chrétiens et musulmans s’opposent à ce projet en vertu de leur foi, puisée dans la Bible ou dans le Coran. Mais il est remarquable de constater qu’elles ont toutes évité de mettre en avant ces argumentaires théologiques pour privilégier l’analyse des conséquences sociales du mariage homosexuel.

Toutes ont également cherché à ne pas en faire un sujet d’opposition politique, visant plutôt le débat sociétal. Qu’elles réclament toujours au gouvernement. Elles ont en effet été très déçues par les consultations «de façade», selon un responsable, menées à l’automne, par Christiane Taubira, ministre de la Justice.

Les catholiques, avec la prière du 15 août, rédigée par le cardinal Vingt-Trois, ont été à la pointe du combat. Ils le restent. Ils ont été suivis par les évangéliques, le 19 septembre, puis par les orthodoxes, le 2 octobre, et par la Fédération protestante de France, le 13 octobre. Le style des déclarations est différent, mais une convergence de fond a mûri. Ainsi qu’une lente montée de la mobilisation. Elle est explicite chez les catholiques, plus réservée mais active chez les orthodoxes et chez les protestants. Claude Baty, président de la Fédération protestante de France, était ainsi reçu, à ce sujet, par Jean-Marc Ayrault, vendredi dernier.
• Les juifs s’impliquent via un «essai» du grand rabbin

Le grand rabbin de France, Gilles Bernheim, a longtemps refusé toute intervention publique sur le sujet parce qu’il préparait – et privilégiait – une réflexion de fond qu’il a finalisée en échangeant avec un groupe d’experts et en publiant, le 17 octobre dernier, un «essai» très charpenté et très remarqué, qu’il a lui-même rédigé contre ce projet de loi. Son poids a été certain. Le grand rabbin est, depuis lors, saturé de demandes médiatiques.
• Les musulmans vont réitérer leur opposition ce mardi

Le Conseil français du culte musulman (CFCM) devrait adopter, ce mardi, une prise de position très argumentée qui a été longuement élaborée cet automne, en défaveur du projet de loi.
Mgr Vingt-Trois accusé de «cliver»

Les déclarations du cardinal André Vingt-Trois, samedi, à Lourdes, n’ont pas laissé les associations de défense des homosexuels indifférentes. Lundi, SOS homophobie a appelé les parlementaires «à résister aux instructions religieuses sur l’homosexualité». «Il est question de mariage civil et non de mariage religieux», a plaidé L’Inter-LGBT (Interassociative lesbienne, gay, bi et trans), regrettant que, pour André Vingt-Trois, «les familles homoparentales n’existent pas et n’ont pas lieu d’exister». Il s’agit d’une vision «étriquée et réductrice» de la famille, a estimé son porte-parole, Nicolas Gougain. Gaylib (association proche de l’UMP), a déploré «l’archaïsme dont font preuve les représentants des religions en France (qui) est très dangereux, car ils clivent, divisent et stigmatisent». L’Association des familles homoparentales a enfin dénoncé «l’incohérence et l’inconvenance» des propos de Mgr Vingt-Trois. Plusieurs associations ont lancé une manifestation de soutien à la loi le 7 novembre, jour de présentation du texte, près de l’Assemblée nationale.

article repris du site www.egliserusse.eu        blog parlons de l’ orthodoxie

14 octobre, 2012

mots-clefs recherchés jusqu’au 13 octobre 2012

Classé dans : Non classé — andreadicaffa02 @ 2:28

mois 10/2012 Tous les référants

Rang Hits % Référant
1 31 24.80 Google
2 23 18.40 Google Images
3 11 8.80 Yahoo
4 3 2.40
5 2 1.60
6 2 1.60
7 2 1.60
8 2 1.60
9 2 1.60
10 2 1.60
11 2 1.60
12 2 1.60
13 2 1.60
14 1 0.80
15 1 0.80
16 1 0.80
17 1 0.80
18 1 0.80
19 1 0.80
20 1 0.80

 

Page suivante »

mois 10/2012 tous les mots-clefs recherchés

Rang Hits % Mots-clefs Moteur de recherche
1 4 6.15 Google
2 3 4.62 Google Images
3 3 4.62 Google Images
4 3 4.62 Google
5 3 4.62 Google Images
6 2 3.08 Google
7 2 3.08 Google
8 2 3.08 Google
9 2 3.08 Google Images
10 2 3.08 Google Images
11 2 3.08 Google
12 2 3.08 Google
13 2 3.08 Google Images
14 2 3.08 Yahoo
15 2 3.08 Google Images
16 2 3.08 Google Images
17 1 1.54 Google
18 1 1.54 Google
19 1 1.54 Yahoo
20 1 1.54 Yahoo

 

Page suivante »

mois 10/2012 Tous les référants

Rang Hits % Référant
1 31 24.80 Google
2 23 18.40 Google Images
3 11 8.80 Yahoo
4 3 2.40
5 2 1.60
6 2 1.60
7 2 1.60
8 2 1.60
9 2 1.60
10 2 1.60
11 2 1.60
12 2 1.60
13 2 1.60
14 1 0.80
15 1 0.80
16 1 0.80
17 1 0.80
18 1 0.80
19 1 0.80
20 1 0.80

Page suivante »

mois 10/2012 tous les mots-clefs recherchés

Rang Hits % Mots-clefs Moteur de recherche
21 1 1.54 Google
22 1 1.54 Google Images
23 1 1.54 Google Images
24 1 1.54 Google
25 1 1.54 Google
26 1 1.54 Google
27 1 1.54 Google
28 1 1.54 Google
29 1 1.54 Google
30 1 1.54 Google
31 1 1.54 Google
32 1 1.54 Google
33 1 1.54 Google Images
34 1 1.54 Yahoo
35 1 1.54 Google
36 1 1.54 Yahoo
37 1 1.54 Yahoo
38 1 1.54 Yahoo
39 1 1.54 Yahoo
40 1 1.54 Google Images

 

mois 10/2012 Tous les référants

Rang Hits % Référant
1 31 24.80 Google
2 23 18.40 Google Images
3 11 8.80 Yahoo
4 3 2.40
5 2 1.60
6 2 1.60
7 2 1.60
8 2 1.60
9 2 1.60
10 2 1.60
11 2 1.60
12 2 1.60
13 2 1.60
14 1 0.80
15 1 0.80
16 1 0.80
17 1 0.80
18 1 0.80
19 1 0.80
20 1 0.80

Page suivante »

mois 10/2012 tous les mots-clefs recherchés

Rang Hits % Mots-clefs Moteur de recherche
41 1 1.54 Google
42 1 1.54 Yahoo
43 1 1.54 Yahoo

« Page précédente

 

 

 

25 septembre, 2012

Le Kurdistan et ses chrétiens : Entretien avec Louay Shabani, syro-antiochien d’Irak, Italie

Classé dans : Non classé — andreadicaffa02 @ 13:32

Le Kurdistan et ses chrétiens : Entretien avec Louay Shabani, syro-antiochien d’Irak, Italie

Le Kurdistan et ses chrétiens : Entretien avec Louay Shabani, syro-antiochien d'Irak, Italie mirella

« Toute ma famille est syro-antiochienne, ce qui n’a pas empêché des mariages interconfessionnaux ou mixtes. Deux de mes sœurs ont, de fait, épousé des jacobites, donc des orthodoxes, mais cela n’a entraîné aucun problème. La coutume en Orient voulant que les enfants suivent la confession du père, les équilibres familiaux sont sauvegardés par une rotation : on alterne la célébration des fêtes religieuses, pour Pâques on fréquente une église et pour Noël l’autre, bien que les enfants soient affilés à l’église syro-jacobite. En général, il ne se pose pas de gros problèmes, quelquefois seulement des difficultés peuvent surgir pour la célébration de Pâques à cause de sa date et des calendriers liturgiques différents suivis par les deux églises.

*

En ce qui concerne leur localisation, les chrétiens qui se trouvent dans l’hinterland de Mossoul, vers la région Nord, sont les plus proches des Kurdes. Et ces derniers temps, un tel voisinage n’est pas seulement géographique mais encore de nécessité : les chrétiens doivent pouvoir disposer d’une force prête à les protéger.

Comme dans tout l’Orient chrétien, chez nous aussi le culte de la Vierge Marie est très développé. Outre les temps liturgiques qui lui sont consacrés par notre rite, sous influence latine, tout le mois de mai lui est aussi consacré par la récitation du rosaire. Les sanctuaires mariaux sont toujours pleins de monde, parfois même de musulmans qui eux aussi ont une grande vénération envers Notre Dame.

Nous autres chrétiens nous constituons une minorité assez faible et nous devons nous confronter à l’islam, c’est pourquoi nous ne créons pas de tension avec les autres chrétiens. Nous avons de bons rapports avec les yezidis.

Dans la province de Mossoul, comme dans tout le pays, l’enseignement est donné en arabe, l’arabe étant la langue officielle de l’Irak, mais nous chrétiens nous parlons le soureth araméen qui se transmet de père en fils et se maintient dans la liturgie. Habituellement il y a des personnes âgées de la communauté qui donnent des leçons aux enfants. Au cours de la divine liturgie, même si elle se célèbre parfois en arabe, le moment de la consécration est toujours en syriaque-araméen. Le missel lui-même est bilingue : arabe et araméen. Le temps passant, à cause des problèmes de survie et de la globalisation, l’usage de l’araméen est un peu en train de se perdre, cette langue qui naquit à l’origine comme parlée et est devenue liturgique, se détachant un peu de celle que les chrétiens parlent à la maison, et devenant quasi-incompréhensible. C’est la raison pour laquelle, dans les célébrations liturgiques, en fonction de son inspiration du moment, le prêtre alterne les deux langues (arabe et syriaque). Dans mon village de Bartella, en semaine les messes du matin sont célébrées en syriaque parce que les personnes âgées préfèrent leur langue maternelle, la messe de fin d’après-midi est en arabe parce que fréquentée surtout par des jeunes qui étudient ou travaillent à Mossoul. Autre particularité : la messe du matin est traditionnelle, le célébrant tournant le dos aux fidèles. Au contraire le soir le prêtre célèbre face au peuple.

Les chants et les hymnes les plus beaux et les plus populaires sont ceux d’Ephrem, transmis oralement de père en fils et mis aujourd’hui seulement par écrit. Nous chantons surtout à Pâques. Il y a une grande participation populaire et beaucoup d’émotion. Par exemple un chant dit « de la Croix » raconte que la croix sur laquelle est mort Jésus a parlé et raconte les différents moments de la crucifixion. »

Mirella Galletti, Le Kurdistan et ses chrétiens : Entretien avec Louay Shabani, syro-antiochien d’Irak, Italie, 2007.

.

Vous aimerez peut-être:
Le sort des chrétiens en Irak- Problèmes et perspectives : …
Présent et devenir des chrétiens d’Irak
Conférence : Le sort des chrétiens en Irak
Publié par Sandrine Alexie à l’adresse 1:05 PM icon18_email

0 commentaires:

 

Enregistrer un commentaire

 

 

Liens vers ce message

Créer un lien

Dépêches

Jactiv
La jeunesse, plus de la moitié de la population, est née avec l’ouverture du Kurdistan mais porte un regard critique sur son fonctionnement. « L’ancienne génération n’est pas consciente des changements dans le monde, elle essaie de garder certaines
Le Figaro
Le gouvernement irakien n’a pas demandé pour le moment à Total de se retirer du gisement d’Halfaya qu’il coexploite dans le sud du pays, bien que Bagdad ait menacé de le faire en représailles à son entrée dans l’exploration pétrolière au Kurdistan,
20minutes.fr
La responsable du principal parti kurde de Turquie appelle à des discussions entre le gouvernement et les activistes kurdes pour empêcher une escalade de la violence, susceptible selon elle de contrecarrer la rédaction de la nouvelle Constitution du pays.
Nouvelles d’Arménie
Dix soldats turcs ont été tués et 70 blessés mardi au cours d’une embuscade tendue par des rebelles séparatistes kurdes contre un convoi militaire dans le sud-est de la Turquie, a-t-on appris de source sécuritaire locale. Un précédent bilan de cette
fourni par
small-logo

Related Posts Plugin for WordPress, Blogger...

Labels

2 janvier, 2012

Calendrier liturgique Ordre Servites de Marie 2011 2012 Calendario Liturgico dell’ Ordine Servi di Maria 2011 2012

Classé dans : Non classé — andreadicaffa02 @ 16:37

Nota :

Utilizzare il calendario liturgico dell’ Ordine dei Servi di Maria significa prima di tutto saper trovare in esso il nocciolo eterno ,l’ elemento di testimonianza evangelica vissuta e trasmessa da un importante e consistente schiera di santi e sante di quest’ Ordine religioso.La vita di questi Frati rappresenta per noi la fedeltà all’ intera Tradizione e questa fedeltà non significa essere fedeli all’ autorità esterna del passato ma un legame vivente con la pienezza dell’ esperienza della Chiesa Una e Universale.

Per i membri dell’ Ordine di Sant’ Andrea di Caffa utilizzare il Calendario Liturgico dell’ Ordine dei Servi di Maria non è soltanto un argomento storico o sentimentale .La Tradizione trasmessa dalla vita di numerosi Frati Servi di Maria vissuti nell’ Italia meridionale non si riduce a un’ archeologia ecclesiastica.

I membri dell’ Ordine di Sant’ Andrea di Caffa non si limitano a seguire il testo del Calendario Liturgico OSM ma lo considerano un prezioso strumento di aiuto per organizzare meglio la vita liturgica e spirituale dell’ Ordine di Sant’ Andrea di Caffa.

Quando i membri del nostro ordine hanno scelto nel 2008 di vivere la spiritualità servitana trasmessa senza interruzione dal 1233 ,essi hanno scelto di viverla nnelle circostanze dove Dio ha voluto farli vivere con l’ obbligo di ricordarsi cio’ che l’ Ordine dei Frati Servi di Maria ha sempre et dovunque manifestato attraverso il suo tesoro spirituale reso prezioso dalla vita dei Frati dell’ Ordine di Santa Maria.

Il Calendario Liturgico OSM anche quest’ anno ci indicherà le date del ritorno alla Casa del Padre dei Frati vissuti nell’ Italia meridionale . Padre Girolamo Russo,Padre Giuseppe Portesine,Padre Antonino Mautone,Padre Bonfiglio Mautone,Padre Andrea D’Andrea,Padre Raffaele Montanino,Padre Pio Casciello e tantissimi altri .

Adottare un calendario liturgico dell’ Ordine dei Frati Servi di Maria significa anche vivere l’ unità nella Fede benchè non vi siano legami canonici .Vivere quell’ Unità data alla Chiesa delle origini che è l’ opzione di ciascuno di noi e di noi tutti uniti,quella pienezza a cui noi tutti aspiriamo in ogni momento della nostra esistenza comunitaria.

La testimonianza di questi Frati Servi di Maria,vissuti nei conventi di Napoli,Palma Campania,Saviano,Alvignano,Prata Sannita,Manduria,Taranto,Siracusa ecc, ci aiuta a conservare la pienezza della Chiesa di Gesù Cristo perchè la nostra prima vocazione risiede nella crescita di ciascuno di noi in questa pienezza.

Il resto,e noi lo crediamo, ci sarà dato in abbondanza perchè la Divina Provvidenza sta agendo silenziosamente e un giorno vicino o lontano l’ Italia meridionale assistera alla rifioritura di numerosi conventi dei Servi di Maria grazie alla semina che fu fatta da questi santi frati.

Calendrier liturgique Ordre Servites de Marie 2011 2012 Calendario Liturgico dell' Ordine Servi di Maria 2011 2012 glisephotopadregirolamorussoservodimariaPadre Girolamo Maria Russo fondatore della Provincia dell’ Italia Meridionale

dell’ Ordine dei Frati Servi di Maria

 

 

 

 

 

ORDO
CELEBRANDI
OFFICIUM DIVINUM ET MISSAM
SECUNDUM
CALENDARIUM ROMANUM GENERALE
ET PROPRIUM
ORDINIS FRATRUM SERVORUM
BEATAE MARIAE VIRGINIS
PRO ANNO LITURGICO
2011 – 2012
FRATRIS
ANGELI M. RUIZ GARNICA
PRIORIS GENERALIS
IUSSU EDITUS
In copertina
Stemma dell’Ordine
da una balaustra
della chiesa di «Notre-Dame de la Défense»
in Montréal (sec. XX)
ROMAE
CURIA GENERALIS O.S.M. – S. MARCELLO AL CORSO, 5
2011
EXPLICATIO ABBREVIATIONUM
Omnia quae ad hoc Calendarium
spectant mittantur ad:
CLIOS
Servi di Maria
Viale Trenta Aprile, 6
00153 Roma (RM), Italia
e-mail: cliosm@gmail.com
A.
AC
ant.
Ap. App.
Ben.
CIC
CMBMV
Co.
Comm.
CP
Cp.
D.
Diac.
dic.
dom.
E. Epp.
Ev
hebd.
H. m.
IH
IM
Ld.
lect.
Magn.
M. Mm.
Off.
Off. lect.
om.
or.
Ord.
Pp.
P.
PE.
pf.
Pr.
pr.
ps. pss.
Psalt.
Rel.
rel.
R. RR.
Scr.
seq.
Vp.
V.
Abbas
Normae de anno liturgico et calendario
antiphona, ae
Apostolus, i
canticum Benedictus in Laudibus
Codex Iuris Canonici
Collectio Missarum de b. Maria V.
Commune Sanctorum
Communicantes in Canone Romano
Instructio de calendariis propriis
Completorium
Doctor
Diaconus
dicitur, dicuntur
dominica
Episcopus, Episcopi
evangelium
hebdomada
Hora media (i.e. Tertia, Sexta, Nona)
Institutio generalis de Liturgia Horarum
Institutio generalis Missalis Romani
Laudes matutinae
Lectio, lectiones
canticum Magnificat ad Vesperas
Martyr, Martyres
Officium
Officium lectionis
omittitur, omittuntur
oratio
Ordinarium divini Officii
Papa
Presbyter
Prex eucharistica
praefatio`
Proprium de Tempore vel Sanctorum
proprius
psalmus, psalmi
Psalterium
Religiosus, Religiosa
reliqua
responsorium, responsoria
Scriptura
sequens
Vesperae
Virgo
ABBREVIATIONS
A
AC
ant.
Ap. App.
Ben.
CIC
CMBMV
Co.
Comm.
CP
Cp.
D.
Diac.
dic.
dom.
E. Epp.
Ev
hebd.
H. m.
IH
IM
Ld.
lect.
Magn.
M. Mm.
Off.
Off. lect.
om.
or.
Ord.
Pp.
P.
PE.
pf.
Pr.
pr.
ps. pss.
Psalt.
Rel.
rel.
R. RR.
Scr.
seq.
Vp.
V.
Abbot
Norms for the liturgical year and calendar
Antiphon [s]
Apostles [s]
Benedictus or Canticle of Zecchariah at Laudsor Morning Prayer
Code of Canon Law
Collection of masses of the Blessed Virgin Mary
Common of Saints
Communicantes ( in union with the whole Church)
in the Roman Canon
Instruction on proper calendars
Compline or Night Prayer
Doctor
Deacon
is [are] said
Sundays
Bishop [s]
Gospel
Week
Daytime Prayer (Midmorning, Midday, Midafternoon)
General Instruction on the Liturgy of the Hours
General Instruction on the Roman-Missal
Lauds or Morning Prayer
Reading [s]
Magnificat or Canticle of Mary
Martyr [s]
Office
Office of Readings
is [are] omitted
prayer
Ordinary of the Office
Pope
Presbyter
Eucharistic Prayer
Preface
Proper of the Seasons or the Saints
Proper
Psalm [s]
Psalter
Religious
Remainder
Responsory, responsories
Scriptures
Sequence
Vespers or Evening Prayer
Virgin
PRO CALENDARIO ANNI LITURGICI
2011 – 2012
Celebrationes mobiles
I Adventus. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 27
Sanctae Familiae . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
Epiphania Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 6
- ubi in dominicam transfertur. . . . . . . . . . . . . . . . . . 8
Baptisma Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8
- ubi Epiphania Domini in dominicam
transfertur . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Dies Cinerum . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22
Dominica Resurrectionis . . . . . . . . . . . . . . . . . . . . . . . 8
Ascensio Domini . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
- ubi in dominicam transfertur . . . . . . . . . . . . . . . . 20
Dominica Pentecostes . . . . . . . . . . . . . . . . . . . . . . . . 27
Ss.mae Trinitatis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 3
Ss.mi Corporis et Sanguinis Christi . . . . . . . . . . . . 7
- ubi in dominicam transfertur . . . . . . . . . . . . . . . . 10
Ss.mi Cordis Iesu . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15
D.N.I.C. universorum Regis. . . . . . . . . . . . . . . . . . 25
nov.
dec.
ian.
ian.
ian.
ian.
febr.
apr.
maii
maii
maii
iunii
iunii
iunii
iunii
nov.
Iuxta traditum morem, hae celebrationes mobiles
fidelibus annuntiari possunt in sollemnitate Epiphaniae,
intra Missarum sollemnia, post Evangelium.
De lectionario adhibendo
Lectionarium dominicale-festivum: cyclus B.
Lectionarium feriale «per annum»: prima lectio sumi-
tur e serie II.
VI
VII
DE CALENDARIO 2011 – 2012 DE CALENDARIO 2011 – 2012
Tempus «per annum» Anno 2012 tempus «per annum» complectitur 34 heb- Curent igitur illi, ad quos spectat liturgiam conven-
domadas, quarum 7 celebrantur ante Quadragesimam, a tualem ordinare, ut celebratio horum festorum huic
die 9 vel 10 ianuarii, feria II vel III post festum Baptismatis Ordini inseratur. Omnes autem meminerint in Missae
Domini, usque ad diem 21 februarii, feriam III ante Cineres. celebratione:
Post Pentecosten tempus «per annum» resumitur ab a) in sollemnitatibus semper Gloria et Credo dicenda esse;
hebdomada VIII, die 28 maii, feria II post dominicam b) in festis Gloria tantum dicendum esse;
Pentecostes. c) in memoriis Gloria et Credo non esse dicenda. Atta-
men Gloria et Credo dici possunt si Missa cum peculiari
sollemnitate celebretur.
De diebus festis huic Calendario adiciendis Quibus Calendarium Ordinis adhibendum sit
Secundum Instructionem «De Calendariis particula- Instructio de qua supra diximus praecepti ut Calenda-
ribus atque Officiorum et Missarum Propriis recogno- rium religiosum adhibeant:
scendis» a S. Congregatione pro Cultu Divino die 24 a) fratres Ordinis;
iunii 1970 evulgatam, sodales familiarum religiosarum b) moniales et sorores eiusdem Ordinis;
cum Ecclesia locali iunguntur in celebrandis: c) sodales OSSM aggregati in communi viventes et vota sim-
a) sollemnitate Patroni principalis oppidi vel civitatis; plica emittentes.
b) festo Patroni principalis dioecesis, regionis aut provin-
ciae, nationis vel amplioris territorii;
c) festo anniversarii Dedicationis ecclesiae cathedralis.
Praeterea in omnibus ecclesiis et oratoriis celebran-
dae sunt:
a) sollemnitas anniversarii Dedicationis (si templum con-
secratum sit);
b) sollemnitas Tituli;
c) memoria Sancti vel Beati (in Martyrologio vel eius
Appendice inscripti) cuius corpus in ecclesia vel oratorio
asservatur.
Quibus omnibus vehementer suadetur ut hanc nor-
mam studiose observent, quippe eam quae unitatem
totius Servorum familiae valde foveat et dum sensu art.
309 novarum Constitutionum O. N. mire consentiat.
TABULA DIERUM LITURGICORUM
TABULA DIERUM LITURGICORUM
secundum ordinem praecedentiae disposita
(AC, 59)
I
1. Triduum paschale Passionis et Resurrectionis Domini.
2. Nativitas Domini, Epiphania, Ascensio et Pente-
costes.
Dominicae Adventus, Quadragesimae et Paschae.
Feria IV Cinerum.
Feriae Hebdomadae sanctae, a feria II ad feriam V
inclusive.
Dies infra octavam Paschae.
3. Sollemnitates Domini, Beatae Mariae Virginis et
Sanctorum in Calendario generali inscriptae. Com-
memoratio omnium fidelium defunctorum.
4. Sollemnitates propriae, nempe:
a) Sollemnitas patroni principalis loci seu oppidi
aut civitatis.(a)
b) Sollemnitas Dedicationis et anniversarii Dedica-
tionis ecclesiae propriae.
c) Sollemnitas Tituli ecclesiae propriae.
d) Sollemnitas aut Tituli, aut Fundatoris, aut Patroni
principalis Ordinis seu Congregationis.
(a) Celebratio peragenda etiam a Religiosis.
IX
II
5. Festa Domini in Calendario generali inscripta.
6. Dominicae temporis Nativitatis et dominicae «per
annum».
7. Festa Beatae Mariae Virginis et Sanctorum Calendarii
generalis.
8. Festa propria, nempe:
a) Festum Patroni principalis dioecesis.1(a)
b) Festum anniversarii Dedicationis ecclesiae cathe-
dralis.(a)
c) Festum Patroni principalis regionis aut provinciae,
nationis, amplioris territorii.(a)
d) Festum Tituli, Fundatoris, Patroni principalis
Ordinis seu Congregationis et provinciae religiosae,
salvis praescriptis sub n. 4 d.
e) Alia festa alicui ecclesiae propria.
f ) Alia festa inscripta in Calendario cuiusque dioe-
cesis vel Ordinis seu Congregationis.
9. Feriae Adventus a die 17 ad 24 decembris inclusive.
Dies infra octavam Nativitatis.
Feriae Quadragesimae.
1 Rationibus pastoralibus suadentibus, fieri potest sollemnitas (CP, 8, 9).
(a) Celebratio peragenda etiam a Religiosis.
X
TABULA DIERUM LITURGICORUM
III
10. Memoriae obligatoriae Calendarii generalis.
11. Memoriae obligatoriae propriae, nempe:
a) Memoriae Patroni secundarii loci, dioecesis,
regionis aut provinciae, nationis, amplioris territorii,
Ordinis seu Congregationis et provinciae religiosae.
b) Aliae memoriae obligatoriae alicui ecclesiae
propriae.
c) Aliae memoriae obligatoriae inscriptae in Ca-
lendario cuiusque dioecesis, vel Ordinis seu Congre-
gationis.(b)
12. Memoriae ad libitum, 2 quae tamen, modo quidem
peculiari in Institutionibus de Missa et de Officio
descripto, fieri possunt etiam diebus de quibus sub
n. 9. Hac eadem ratione, ut memoriae ad libitum
celebrari possunt memoriae obligatoriae, quae acci-
dentaliter occurrunt in feriis Quadragesimae.
13. Feriae Adventus usque ad diem 16 decembris
inclusive.
Feriae temporis Nativitatis a die 2 ianuarii ad sab-
batum post Epiphaniam.
Feriae temporis paschalis a feria II post octavam
Paschae ad sabbatum ante Pentecosten inclusive.
Feriae per annum.
(b) In qualibet ecclesia vel oratorio, celebranda est memoria Sancti vel Beati (in
Martyrologio vel eius appendice inscripti) cuius corpus ibidem asservatur (CP, 11).
2 Memoria propria praeferenda est memoriae generali non obligatoriae (CP, 23 c).
DE ANNO LITURGICO
ET DE CALENDARIO
Occurrentia celebrationum liturgicarum
Si eodem die plures celebrationes occurrunt, fit de
ea quae in tabula dierum liturgicorum, supra relata,
superiorem obtinet locum (AC, 60).
Si quodam anno sollemnitas impediatur, ad proxi-
miorem diem transferatur qui liber sit a diebus sub nn.
1-8 in tabula praecedentiae recensitis (AC, 60).
Attamen si sollemnitas a dominica Adventus vel
Quadragesimae vel Paschae impediatur, sabbato praece-
denti anticipatur (AC, 5). Si sabbato impediatur, tran-
sferatur ad proximiorem diem liberum, secundum nor-
mam generalem. Si vero agatur de occurrentia in domi-
nica in Palmis aut in dominica Risurrectionis, transfer-
tur ad primum diem liberum, post dominicam in octa-
va Paschae (Congr. pro Cultu Divino, 22 apr. 1990, in
Notitiae 26 [1990] 160).
Reliquae celebrationes impeditae eo anno omit-
tuntur (AC, 60).
Si vero eodem die celebrandae sint Vesperae Officii
occurrentis et I Vesperae diei sequentis, praevalent
Vesperae celebrationis quae in tabula dierum liturgico-
rum superiorem obtinet locum; in casu autem paritatis,
Vesperae diei currentis (AC, 61).
«Celebratio externa»
Ad bonum pastorale fidelium procurandum, in
dominicis “per annum”, licet eas celebrationes agere,
quae infra hebdomadam occurrunt, quaeque ipsorum
XII
XIII
DE CELEBRATIONE EUCHARISTICA DE CELEBRATIONE EUCHARISTICA
fidelium pietati sint acceptae, dummodo hae in tabu- cum plena participatione omnium sodalium com-
la praecedentiae ipsi dominicae praeponantur. De his munitatis sive religiosorum sive canonicorum. In iis
celebrationibus dici possunt omnes Missae, quae con- proinde munus suum exerceant singuli iuxta ordinem
currente populo celebrantur (AC, 58). vel ministerium receptum.
Expedit ideo ut omnes sacerdotes qui pro utilita-
te pastorali fidelium singulariter celebrare non tenen-
tur, in iis, quantum fieri potest, concelebrent. Omnes
insuper ad eam communitatem pertinentes sacerdo-
tes, qui officio in bonum pastorale fidelium singulari-
ter celebrandi tenentur, Missam quoque conventua-
lem aut “Communitatis” eadem die concelebrare pos-
sunt (IM, 114).
DE CELEBRATIONE EUCHARISTICA
De diversis formis Missam celebrandi
De Missa cui praeest Episcopus
In Ecclesia particulari primus locus tribuatur Missae
cui praeest Episcopus a suo presbyterio et ministris
circumdatus et in qua plebs sancta Dei plene et actuo-
se participat. Ibi enim habetur praecipua manifestatio
Ecclesiae (Missale Romanum, Institutio generalis [seq.
IM], 112).
De Missa paroeciali
Magni etiam habeatur Missa quae cum aliqua com-
munitate, praesertim vero paroeciali, celebratur, utpote
quae Ecclesiam universalem repraesentet tempore et loco
statutis, praecipue in celebratione dominicali (IM, 113).
De Missa conventuali vel communitatis
Inter Missas quae ab aliquibus communitatibus
celebrantur, peculiarem locum obtinet Missa conven-
tualis, quae pars est Officii cotidiani, aut Missa, quae
“Communitatis” dicitur. Et quamvis hae Missae nul-
lam specialem formam celebrationis prae se ferant,
maxime tamen decet eas cum cantu fieri, praecipue
De Missis concelebratis
Per Eucharistiae concelebrationem unitas sacrificii
et sacerdotii opportune manifestatur, atque quoties
fideles actuose participant, unitas populi Dei singula-
ri modo apparet, praesertim si praeest Episcopus.
Concelebratio insuper fraterna presbyterorum vin-
cula significat et firmat, quia vi communis sacrae ordi-
nationis et missionis presbyteri omnes inter se intima
fraternitate nectuntur.
Quare, nisi utilitas fidelium (quae sedula pastorali
sollicitudine semper consideranda est) hoc impediat, et
integra manente cuique sacerdoti facultate Missam sin-
gularem celebrandi, praestat sacerdotes illo praeclaro
modo Eucharistiam celebrare tum in communitatibus
sacerdotum tum in coetibus qui statutis temporibus
congregantur aliisque similibus adiunctis. Qui in com-
muni vivunt vel eidem ecclesiae deserviunt, peregrinos
sacerdotes ad concelebrationem suam libenti animo
XIV
XV
DE CELEBRATIONE EUCHARISTICA TABULA PRO MISSIS RITUALIBUS
invitent. Hinc superiores faciliorem reddant, immo Ad formularium autem Missae eligendum, princi-
foveant concelebrationem, quoties necessitas pastoralis pium generale servetur, iuxta quod «praecedentia sem-
vel alia rationabilis causa aliud non exigit (Instr. Eucha- per danda est celebrationi quae est de praecepto servan-
risticum mysterium, 47). da, independenter a gradu liturgico duarum celebratio-
num occurrentium» (Congr. pro Cultu Divino, Notitiae
20 [1984] 603).
Eadem ratione, in celebrandis Vesperis cum populo,
derogari potest normae generali, ita ut Vesperae concor-
dent cum Missa vespertina quae celebratur (Ibidem).
De Missa pro populo
Parochus, post captam paroeciae possessionem,
obligatione tenetur singulis diebus dominicis atque
festis in sua dioecesi de praecepto Missam pro populo
sibi commisso applicandi; qui vero ab hac celebratione
legitime impediatur, iisdem diebus per alium aut aliis
diebus per se ipse applicet.
Parochus, qui plurium paroeciarum curam habet,
diebus de quibus supra, unam tantum Missam pro uni-
verso sibi commisso populo applicare tenetur (CIC,
can. 534).
N.B. Haec obligatio in hoc Ordine per crucem ©
in margine appositam indicatur.
De Missa festiva
vespere diei praecedentis celebranda
Praecepto Missae festivae participandae satisfieri
potest, iuxta praescriptum CIC, can. 1284 § 1, Mis-
sam participando «vel ipso die festo vel vespere diei
praecedentis».
Proinde Missa vespertina diei qui diem festum de
praecepto praecedit ordinanda erit cum omnibus ele-
mentis quae in Missa diei festi praecipiuntur (homilia,
oratio fidelium) aut commendantur (amplior populi
participatio per cantum, etc.: IM, 115-116).
TABULA PRO MISSIS RITUALIBUS,
PRO VARIIS NECESSITATIBUS,
VOTIVIS ET DEFUNCTORUM
Sigla
V1 = Missae rituales (IM, 330).
Missae pro variis necessitatibus et votivae, de mandato
vel licentia Ordinarii loci, occurrente graviore necessi-
tate vel utilitate pastorali (IM, 332).
V2 = Missae pro variis necessitatibus et votivae de iudicio
rectoris ecclesiae vel ipsius celebrantis, si vera necessitas
vel utilitas pastoralis id postulet (IM, 333).
V3 = Missae pro variis necessitatibus et votivae pro pietate fide-
lium eligendae a sacerdote celebrante (IM, 329 b et c).
D1 = Missa exsequialis (IM, 336).
D2 = Missae post acceptum mortis nuntium, in ultima
sepultura defuncti et in primo anniversario (IM, 381).
D3 = Missa «cotidiana» (IM, 337). Quando prohibentur D1
et D2, etiam D3 evidenter prohibetur.
+ = permittuntur
– = prohibentur
XVI
TABULA PRO MISSIS RITUALIBUS
1. Sollemnitates de praecepto
2. Dominicae Adventus, Quadra-
gesimae et Paschae
Triduum paschale et Feria V
Hebd. S.
Sollemnitates non de praecepto
Comm. omnium fidelium
defunctorum
Feria IV Cinerum, Feriae II, III,
IV Hebd. S
Dies infra octavam Paschae
3.
4.
5.
6.
7.
8.
Dominicae temporis Nativitatis
et «per annum»
Festa
9.
Feriae Adventus a 17 ad
24 decembris
10. Dies infra octavam Nativitatis
11. Feriae Quadragesimae
12. Memoriae obligatoriae
13. Feriae Adventus usque ad
16 decembris
14. Feriae temporis Nativitatis a
2 ianuarii
15. Feriae temporis paschalis
16. Feriae «per annum»
V1–
D1–
V1–
D1–
V1–
D1–
V1–
D1+
V1 –
D1+
V1–
D1+
V1+ / V2–
D1+ / D2–
V1+ / V2–
D1+ / D2–
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2–
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+
D1+ / D2+
V1+ / V2+ / V3+
D1+ / D2+ / D3+
DE CELEBRATIONE EUCHARISTICA
XVII
De Missa eligenda
(IM, 352-355. 363)
1. In sollemnitatibus: iuxta calendarium ecclesiae in
qua celebratur.
2. In dominicis, in feriis Adventus, Nativitatis, Quadra-
gesimae et Paschae, in festis et memoriis obligatoriis:
a) si Missa celebratur cum populo, sacerdos sequa-
tur calendarium ecclesiae in qua celebrat;
b) si Missa celebratur sine populo, sacerdos sequi
potest aut calendarium ecclesiae aut calendarium
proprium.
3. In memoriis obligatoriis de S. Maria in sabbato: dici
potest, pro qualitate temporis liturgici, vel una ex sex
Missis, quae in Communi B.M.V. Missalis romani
proponuntur (1-3, Tempore per annum; 4, Tempo-
re Adventus; 5, Tempore Nativitatis; 6, Tempore
paschali), vel una ex decem Missis, quae in Proprio
Missarum O.S.M. inveniuntur (1, Tempore Adven-
tus; 2, Tempore Nativitatis; 3, Tempore Quadrage-
simae; 4, Tempore paschali; 5-10, Tempore per
annum), vel una ex 46 Missis, quae in Collectione
Missarum B. Mariae Virginis proponuntur.
4. In memoriis ad libitum:
a) In feriis Adventus a die 17 ad 24 decembris, infra
octavam Nativitatis et in feriis Quadragesimae,
exceptis feriis IV Cinerum et Hebdomadae Sanctae,
XVIII
DE CELEBRATIONE EUCHARISTICA
sacerdos dicit Missam de die liturgico occurrente;
de memoria autem in calendario generali eo die
forte inscripta sumere potest collectam, dummodo
non occurrat feria IV Cinerum aut feria Hebdo-
madae Sanctae.
b) In feriis Adventus ante diem 17 decembris, in
feriis temporis Nativitatis et Paschae, sacerdos eli-
gere potest aut Missam de feria, aut Missam de
Sancto, vel de uno e Sanctis quorum fiat memoria,
aut Missam de aliquo Sancto eo die in Martyro-
logio inscripto.
5. In feriis «per annum», seligi potest:
a) aut una ex 34 Missis dominicarum «per annum»;
in ea tamen orationes (vel collecta tantum) sumi
possunt ex alia dominica «per annum» vel ex ora-
tionibus ad diversa;
b) aut Missa de aliquo Sancto eo die in Martyrolo-
gio inscripto;
c) aut Missa ad diversa vel votiva;
d) aut quaevis Missa defunctorum; Missa tamen
cotidiana tunc solummodo dici potest si pro defun-
ctis applicanda est.
Notanda:
Si celebrat cum populo, sacerdos imprimis bono spi-
rituali fidelium studebit, et cavebit ne iis suam pro-
pensionem imponat. Curabit praecipue ne frequen-
tius et sine sufficienti causa lectiones omittatsingulis
DE CELEBRATIONE EUCHARISTICA
XIX
diebus assignatas in lectionario feriali: Ecclesia enim
cupit ut ditior mensa verbi Dei paretur fidelibus.
Ob eandem causam moderate sumet Missas defunc-
torum: quaelibet enim Missa tam pro vivis quam pro
defunctis offertur, et in omni Prece eucharistica memo-
ria defunctorum habetur. Ubi autem fidelibus cordi
sunt memoriae ad libitum Beatae Mariae Virginis vel
Sanctorum, una saltem Missa de his celebretur, ut sati-
sfiat legitimae eorum pietati.
DE LITURGIA HORARUM
DE LITURGIA HORARUM
De Liturgiae Horarum obligatione
Episcopi et presbyteri, aliique ministri sacri, qui
mandatum ab Ecclesia acceperunt Liturgiam Horarum
celebrandi, integrum eius cursum cotidie persolvant,
Horarum veritate, quantum fieri potest, servata.
Debitum in primis momentum tribuant Horis,
quae huiusmodi Liturgiae sunt veluti cardo, id est
Laudibus matutinis et Vesperis, caveantque ne has
Horas omittant, nisi gravi de causa.
Officium quoque lectionis, quod est potissimum
celebratio liturgica verbi Dei, fideliter peragant; ita,
munus peculiari ratione sibi proprium, verbum Dei in
seipsos recipiendi, cotidie adimplent, quo perfectiores
fiant Domini discipuli et profundius sapiant investiga-
biles divitias Christi.
Quo melius totum diem sanctificent, cordi insuper
ipsis erit recitatio Horae mediae et Completorii, quo
ante cubitum integrum Opus Dei perficiant seseque
Deo commendent (IH, 29).
Communitates religiosae Liturgiae Horarum non
adscrictae, earumque singuli sodales, Horas celebrent
ad normam iuris sui particularis, salvo praescripto
circa eos qui Ordinem sacrum acceperunt.
Communitates vero choro adstrictae integrum cur-
sum Horarum cotidie in choro persolvant; extra cho-
rum autem sodales Horas recitent ad normam iuris sui
particularis, salvis semper iis quae respiciunt eos qui
Ordinem sacrum acceperunt (IH, 31 b).
XXI
De celebratione communi Liturgiae Horarum
in Ordine nostro
Omnibus fratribus communitatum Servorum
Beatae Mariae Virginis Liturgia Horarum, secundum
Constitutiones, forma typica orandi exsistit: «Ogni
giorno ci riuniamo tutti per la Lode del Signore con
la celebrazione della Liturgia delle Ore, secondo il
modo e l’orario stabiliti comunitariamente» (art. 49).
Cum novae Constitutiones vigere coeperint (6 apri-
lis 1969), ex consulto S. Congregationis pro Religiosis
et Institutis saecularibus (31 maii 1969) quae Ordini-
bus qui Mendicantes nuncupantur facultatem concedit
Divinum Officium «in communi» recitandi, si hoc a
Capitulo Generali uniuscuiusque Ordinis statuatur (cf.
Acta O.S.M., 29, 1969, p. 25-26), in nostris communi-
tatibus Officium non amplius celebratur «in choro»,
sed «in communi». Praeterea, ad mentem Constitutio-
num, si fieri potest, Officium una cum populo est cele-
brandum (cf. art. 24).
De memoriis quae celebratione plena privantur
(IH, 237-239; IM, 355 a)
Memoriae quae diebus a 17 ad 31 decembris et
feriis Quadragesimae occurrunt (exclusis feria IV
Cinerum et Hebdomada Sancta), hoc modo celebrari
possunt:
XXII
DE LITURGIA HORARUM
1. In OFFICIO LECTIONIS, post lectionem e Patribus
in Proprio de Tempore cum eius responsorio, addi
potest lectio hagiografica propria cum eius respon-
sorio et oratione de Sancto.
2. Ad LAUDES MATUTINAS et VESPERAS, post oratio-
nem, omissa conclusione, addi possunt antiphona
et oratio de Sancto.
3. Ad MISSAM dici potest collecta de Sancto.
TEMPUS ADVENTUS
Tempus Adventus duplicem habet indolem: est enim tem-
pus praeparationis ad sollemnia Nativitatis, in quibus
primus Dei Filii adventus ad homines recolitur, ac simul
tempus quo per hanc recordationem mentes diriguntur ad
exspectationem secundi Christi adventus in fine tempo-
rum. His duabus rationibus, tempus Adventus se praebet
ut tempus devotae ac iucundae exspectationis (AC, 39).
In Officio Divino, incipitur vol. I Liturgiae Horarum
In Missa, incipitur Lectionarium festivum, cyclo B.
Quaedam animadvertenda pro Tempore Adventus:
1. Organum aliaque musica instrumenta adhibeantur, et altare
floribus ornetur ea moderatione, quae indoli huius temporis
conveniat, quin tamen plenam laetitiam Nativitatis Domini prae-
veniat (Caeremoniale Episcoporum, 236). Eadem moderatio serve-
tur in celebratione Matrimonii (Ordo Matrimonii, 30).
2. In celebratione Matrimonii, sive intra Missam sive extra Missam,
benedictio nuptialis semper impertienda est. Moneantur tamen
sponsi ut rationem habeant peculiaris naturae huius temporis
liturgici (Ordo Matrimonii, 32).
Pro Officio et Missa usque ad diem 16 decembris:
1. Non permittuntur Missae ad diversa vel votivae aut cotidianae
defunctorum, nisi utilitas pastoralis id requirat (IM, 376, 381).
Permittuntur tamen Missae de memoriis his diebus occurrentibus,
aut de Sanctis his diebus in Martyrologio inscriptis (IM, 355 a-b).
2. In Off.:
a) ad Invit. ant. Regem;
b) ad Off. lect. Ld. Vp. hymni pr., qui un I parte Ord. huius tem-
poris exstant;
c) ad H. m. et Cp. hymni in eodem Ord. positi.
NOVEMBER 2011
NOVEMBER 2011
26. Viol. Sabb.
I VESPERAE dom. I Adventus – Cp. post I Vp. dom.
Incipitur vol. I Liturgiae Horarum.
27. Viol. DOM. I ADVENTUS (hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. I Adv.
E LECTIONARIO FESTIVO, hoc anno legitur cyclus B.
L 1 Is 63, 16b-17. 19b; 64, 2b-7;
Ps 79, 2ac et 3b. 15-16. 18-19.
L 2 1 Cor 1, 3-9.
Ev Mc 13, 33-37.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE dom. I Adventus – Cp. post II Vp. dom.
ANNIVERSARIA
2005. Innsbruck. Fr. Lukas M. Huber, presb., a. 63, r. 43.
28. Viol. Feria II hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 2, 1-5; Ps 121, 1-2. 3-4a. (4b-5. 6-7.) 8-9.
Ev Mt 8, 5-11.
ANNIVERSARIA
1974. Montevideo. Fr. Giovanni M. Gonzo, presb., a. 60, r. 41.
3
29. Viol. Feria III hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 11, 1-10; Ps 71, 2. 7-8. 12-13. 17.
Ev Lc 10, 21-24.
ANNIVERSARIA
1985. Poschiavo. Fr. Giuseppe M. Ferin, presb., a. 77, r. 59.
30. Rub. Feria IV. S. ANDREAE AP., festum. – Ad H. m.
ant. de temp. et pss. feriæ IV, hebd. I.
De ea.
© MISSA pr., Gloria, lect. pr., pf. App.
L 1 Rom 10, 9-18; Ps 18, 2-3. 4-5.
Ev Mt 4, 18-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
Langegg. Fr. Ignaz M. Millik, presb., a. 91, r. 72.
Saviano. Fr. Girolamo M. Russo, presb., a. 85, r. 67.
Montréal. Fr. Armand M. Gaudreau, presb., a. 65, r. 43.
Gelsenkirchen-Buer. Fr. Gabriel M. Kurzenhäuser, presb.,
a. 62, r. 38.
2010. Viareggio. Fr. Luigi M. De Vittorio, presb., a. 80, r. 63.
1968.
1970.
1992.
2001.
DECEMBER 2011
DECEMBER 2011
1. Viol. Feria V hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 26, 1-6; Ps 117, 1 et 8-9. 19-21. 25-27a.
Ev Mt 7, 21. 24-27.
ANNIVERSARIA
1976. El Paso. Fr. Tarcisio M. Bressan, a. 62, r. 43.
2001. México. Fr. Giovannangelo M. Gasperini Tomasel, presb.,
a. 85, r. 64.
2. Viol. Feria VI hebd. I Adv. (I Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 29, 17-24; Ps 26, 1. 4. 13-14.
Ev Mt 9, 27-31.
1962.
1973.
1983.
2000.
ANNIVERSARIA
Kötschach. Fr. Alfons M. Veith, presb., a. 81, r. 62.
Denia. Fr. Antonio M. Caballero, presb., a. 54, r. 16.
Ironton. Fr. Hugh M. Bryers, presb., a. 84, r. 63.
Ronzano. Fr. Graziano M. Bartolini, presb., a. 63, r. 45.
3. Alb. Sabb. hebd. I Adv. (I Psalt.).
S. Francisci Xavier P., memoria.
MISSA memoriae, pf. I Adv. vel de sancto.
L 1 Is 30, 19-21. 23-26; Ps 146, 1-2. 3-4. 5-6.
Ev Mt 9, 35 – 10, 1. 6-8.
5
I VESPERAE dom. II Adventus – Cp. post I Vp. dom.
1979.
1982.
2004.
2008.
ANNIVERSARIA
Vicenza. Fr. Pietro M. Baroni, a. 64, r. 31.
Pietralba. Fr. Isidoro M. Todero, a. 81, r. 51.
Fullerton. Fr. Peregrine M. Graffius, presb., a. 73, r. 51.
Innsbruck. Fr. Franz M. Brunner, presb., a. 77, r. 48.
4. Viol. DOM. II ADVENTUS (hebd. II Psalt.).
De ea.
© MISSA pr., Credo, pf. I Adv.
L 1 Is 40, 1-5. 9-11; Ps 84, 9ab-10. 11-12. 13-14.
L 2 2 Petr 3, 8-14.
Ev Mc 1, 1-8.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Ioannis Damasceni P.D. memoria omittitur.
II VESPERAE dom. II Adventus – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Poschiavo. Fr. Anselmo M. Zordan, presb., a. 77, r. 58.
1986. Chicago. Fr. Joakim M. Martorano, presb., a. 49, r. 29.
5. Viol. Feria II hebd. II Adv. (II Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 35, 1-10; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 5, 17-26.
ANNIVERSARIA
1978. Isola Vicentina. Fr. Costantino M. Meneghello, presb., a. 85,
r. 64.
6
7
TEMPUS ADVENTUS DECEMBER 2011
1985. Castellerio. Fr. Lorenzo M. Plotzer, presb., a. 83, r. 36. 8. Alb. Feria V. IN CONCEPTIONE IMMACULATA
1986. Bolzano. Fr. Alberto M. Dalla Valle, presb., a. 75, r. 57. B. MARIAE V., sollemnitas.
2007. Reggio Emilia. Fr. Giuseppe M. Benassi, presb., a. 76, r. 60. Ad H. m. ant. pr. cum psalmodia complementari.
6. Viol. Feria III hebd. II Adv. (II Psalt.).
De ea. Vel:
Alb. S. Nicolai E.
MISSA feriae vel memoriae, pf. I Adv. vel de sancto.
L 1 Is 40, 1-11; Ps 95, 1-2. 3 et 10ac. 11-12. 13.
Ev Mt 18, 12-14.
ANNIVERSARIA
1972. Pistoia. Fr. Giustino M. Vitali, presb., a. 86, r. 69.
1999. Avellaneda. Fr. Adolfo Norberto M. Carrizo, presb., a. 41,
r. 13.
7. Alb. Feria IV hebd. II Adv. (II Psalt.).
S. Ambrosii E. D., memoria.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Gen 3, 9-15. 20; Ps 97, 1. 2-3ab. 3bc-4.
L 2 Eph 1, 3-6. 11-12.
Ev Lc 1, 26-38.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
In Statibus Foederatis Americae (U.S.A.) et in Insulis
Philippinis:
Sollemnitas IMMACULATAE CONCEPTIONIS B.
MARIAE V. celebratur quoque ut Patronae principalis
totius Nationis.
MISSA memoriae, pf. I Adv. vel de sancto.
L 1 Is 40, 25-31; Ps 102, 1-2. 3-4. 8 et 10.
Ev Mt 11, 28-30.
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1973. Viareggio. Fr. Innocenzo M. Rovetti, presb., a. 80, r. 62.
1983. Fullerton. Fr. Bonfilius M. Paré, presb., a. 81, r. 62.
1986. Verona. Fr. Luigi M. Trolio, presb., a. 66, r. 48.
ANNIVERSARIA
1999. Roma. Fr. Raffaele M. Preite, presb., a. 76, r. 59.
2006. Prestwich. Fr. Michael M. Rogers, presb., a. 80, r. 63.
9. Viol. Feria VI hebd. II Adv. (II Psalt.).
De ea. Vel:
Alb. S. Ioannis Didaci Cuauhtlatoatzin.
MISSA feriae vel memoriae, pf. I Adv. vel de sancto.
L 1 Is 48, 17-19; Ps 1, 1-2. 3. 4 et 6.
Ev Mt 11, 16-19.
8
TEMPUS ADVENTUS
ANNIVERSARIA
1985. Budapest. Fr. Manettus M. Sehr, a. 75, r. 50.
1989. Vicenza. Fr. Innocenzo M. Bernardi, presb., a. 75, r. 56.
10. Alb. Sabb. hebd. II Adv. (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae, Temp. Adv., pf. B. Mariae V. vel II
Adv.
L 1 Sir 48, 1-4. 9-11; Ps 79, 2ac et 3b. 15-16. 18-19.
Ev Mt 17, 10-13.
Vel:
Una e missis CMBMV Temp. Adv., praesertim form.
n. 1: Beata Maria Virgo excelsa Filia Israel.
B. Hieronymi de Sancto Angelo in Vado presb. O.N.
memoria omittitur.
I VESPERAE dom. III Adventus – Cp. post I Vp. dom.
Hodie ad Vp. et cras (dom. Gaudete), organa aliaque ins-
trumenta pulsari possunt.
ANNIVERSARIA
2006. Vicenza. Fr. Luciano M. Castellan, presb., a. 78, r. 61.
DECEMBER 2011
9
Prohibentur aliae celebrationes, excepta exsequiali.
S. Damasi I Pp. memoria omittitur.
II VESPERAE dom. III Adventus – Cp. post II Vp. dom.
1963.
1988.
2006.
2008.
ANNIVERSARIA
Vicenza. Fr. Giacinto M. Striolo, presb., a. 65, r. 47.
Montréal. Fr. Gérard M. Léveillé, presb., a. 74, r. 53.
Francavilla al Mare. Fr. Alessio M. Rotili, presb., a. 94, r. 78.
Senigallia. Fr. Luigi M. Poli, presb., a. 82, r. 62.
12. Viol. Feria II hebd. III Adv. (III Psalt.).
De ea. Vel:
Alb. B. Mariae Virg. de Guadalupe.
MISSA feriae vel memoriae, pf. I Adv. vel de B. Maria
Virg.
L 1 Num 24, 2-7. 15-17a; Ps 24, 4bc-5ab. 6-7bc. 8-9.
Ev Mt 21, 23-27.
Vel (in Missa B. Mariae Virg. de Guadalupe)
E Lectionario Sanctorum:
L 1 Is 7, 10-14; 8, 10c; Ps 66, 2-3. 5. 7-8.
Ev Lc 1, 39-48.
11. Viol. vel Ros. DOM. III ADVENTUS (hebd. III Psalt.). In Mexico:
De ea.
© MISSA pr., Credo, pf. I Adv. 12. Alb. Feria II. B. MARIAE VIRGINIS DE GUADALUPE,
REIPUBLICAE MEXICANAE PATRONAE PRINCI-
PALIS, sollemnitas.
Ad. H. m. ant. pr. cum psalmodia complementari.
L 1 Is 61, 1-2a. 10-11; Ps Lc 1, 46-48. 49-50. 53-54.
L 2 1 Thes 5, 16-24.
Ev Io 1, 6-8. 19-28.
11. I VESPERAE seq. – Cp. post I Vp. dom.
10
TEMPUS ADVENTUS
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 7, 10-14; 8, 10c vel Sir 24, 23-31; Ps 66, 2-3. 5.
7-8.
L 2 Gal 4, 4-7.
Ev Lc 1, 39-48.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, neque Missa exsequialis.
II VESPERAE soll. – Cp. post. II Vp. dom.
In aliis Americae Nationibus:
12. Alb. Feria II. B. MARIAE VIRGINIS DE GUADALUPE,
TOTIUS AMERICAE PATRONAE ATQUE REGINAE,
festum.
Ad H. m. ant. et pss. feria II hebd. III.
MISSA pr., Gloria, pf. pr.
L 1 Is 7, 10-14; 8, 10c; Ps 66, 2-3. 5. 7-8.
Ev Lc 1, 39-48.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
1975.
1980.
2000.
2004.
ANNIVERSARIA
Ancona. Fr. Mariano M. Santinelli, a. 88, r. 61.
Vicenza. Fr. Antonino M. Balasso, a. 71, r. 24.
Chicago. Fr. Jerome M. Hurley, presb., a. 86, r. 68.
São Paulo. Fr. Francesco M. Carnimeo, presb., a. 71, r. 54.
13. Rub. Feria III hebd. III Adv. (III Psalt.).
S. Luciae V. M., memoria.
DECEMBER 2011
11
MISSA memoriae, pf. I Adv. vel de sancta.
L 1 Soph 3, 1-2. 9-13; Ps 33, 2-3. 6-7. 17-18. 19 et 23.
Ev Mt 21, 28-32.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore Compassio-
niste Serve di Maria, hanc diem, qua anno 1921 Beata
Maria Magdalena Starace (1845-1921), Congegra-
tionis Fundatrix, in pace obdormivit, tamquam Diem
Congregationis celebrat. Anno 1893 die 1 novembris
Congregatio Ordini nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
beatae Virgini reddant et pro bono atque incremento
Instituti ferventes adhibeant preces.
ANNIVERSARIA
1967. Breganze. Fr. Manetto M. Salbego, presb., a. 73, r. 53.
1969. Avellaneda. Fr. Celso M. Milanesio, presb., a. 77, r. 60.
1970. Firenze. Fr. Saverio M. Pucci, presb., a. 57, r. 37.
14. Alb. Feria IV hebd. III Adv. (III Psalt.).
S. Ioannis a Cruce P. D., memoria.
Missa memoriae, pf. I Adv. vel de sancto.
L 1 Is 45, 6b-8. 18. 21b-25; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 7, 19-23.
15. Viol. Feria V hebd. III Adv. (III Psalt.).
De ea. Vel:
Alb. B. Bonaventurae de Pistorio, presbyteri O.N.
12
TEMPUS ADVENTUS
MISSA feriae vel memoriae, pf. I Adv. vel de beato.
L 1 Is 54, 1-10; Ps 29, 2 et 4. 5-6. 11-12a et 13b.
Ev Lc 7, 24-30.
ANNIVERSARIA
1980. Roma. Fr. Corrado M. Berti, presb., a. 69, r. 52.
1985. Detroit. Fr. Joseph M. Srill, presb., a. 85, r. 65.
1988. Avellaneda. Fr. Reginaldo M. Chies, presb., a. 66, r. 46.
16. Viol. Feria VI hebd. III Adv. (III Psalt.).
De ea.
MISSA feriae, pf. I Adv.
L 1 Is 56, 1-3a. 6-8; Ps 66, 2-3. 5. 7-8.
Ev Io 5, 33-36.
A die 17 ad diem 24 decembris:
1. Admittuntur solummodo memoriae Sanctorum in calen-
dario generali inscriptae, celebrandae modo peculiari pp.
XXI-XXII indicato.
2. Missae ad diversa et votivae permittuntur solummodo
ob graviorem aliquam necessitatem vel pastoralem utilita-
tem (IM, 332). Missae cotidianae defunctorum non admit-
tuntur (IM, 337).
3. Pro Liturgia Horarum:
a) partes habentur propriae in altera sectione Ordinarii
temporis Adventus;
b) antiphonae propriae proponuntur pro psalmis ferialibus
Laudum et Vesperarum;
c) partes exstant in Proprio quae dici debent diebus men-
sis ipsis assignatis, omissis iis quae feriis hebdomadae III
Adventus tribuuntur.
DECEMBER 2011
13
ANNIVERSARIA
1990. Roma. Fr. Tarcisio M. Giallatini, presb., a. 79, r. 62.
2000. Todi. Fr. Riccardo M. Rossi, a. 90, r. 71.
17. Viol. Sabb. hebd. III Adv. (III Psalt.).
De eo.
MISSA pr., pf. II Adv.
Omissis lectionibus feriis hebd. III Adv. assignatis, sumun-
tur lectiones diebus mensis tributis.
L 1 Gen 49, 2. 8-10; Ps 71, 2. 3-4ab. 7-8. 17.
Ev Mt 1, 1-17.
I VESPERAE dom. IV Adventus – Cp. post I Vp. dom.
ANNIVERSARIA
1975. Todi. Fr. Agostino M. Fagiolo, presb., a. 84, r. 66.
18. Viol. DOM. IV ADVENTUS (hebd. IV Psalt.).
De ea.
© MISSA pr., Credo, pf. II Adv.
L 1 2 Sam 7, 1-5. 8b-12. 14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
L 2 Rom 16, 25-27.
Ev Lc 1, 26-38.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. IV Adventus – Cp. post II Vp. dom.
19. Viol. Feria II hebd. IV Adv. (IV Psalt.).
De ea.
14
TEMPUS ADVENTUS
MISSA pr., pf. II Adv.
L 1 Iudic 13, 2-7. 24-25a; Ps 70, 3-4a. 5-6ab. 16-17.
Ev Lc 1, 5-25.
ANNIVERSARIA
1961. Belen. Fr. Jack M. McLennan, presb., a. 68, r. 41.
2001. Empageni. Fr. Robert M. Kucera, presb., a. 73, r. 54.
20. Viol. Feria III hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Is 7, 10-14; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 1, 26-38.
ANNIVERSARIA
1973. Lienz. Fr. Agnell M. Neurauter, presb., a. 73, r. 53.
1977. Verona. Fr. Ferdinando M. Maroso, presb., a. 82, r. 63.
1989. Pesaro. Fr. Luca M. Simbeni, presb., a. 76, r. 57.
21. Viol. Feria IV hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Cant 2, 8-14 vel Soph 3, 14-18a;
Ps 32, 2-3. 11-12. 20-21.
Ev Lc 1, 39-45.
Fieri potest memoria S. Petri Canisii P. D., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
1968. Marina di Massa. Fr. Gioacchino M. Calabresi, presb.,
a. 69, r. 42.
DECEMBER 2011
15
1979. Malo. Fr. Ignazio M. Faggin, presb., a. 56, r. 37.
1984. Roma. Fr. Luigi M. Benedetti, a. 87, r. 57.
22. Viol. Feria V hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 1 Sam 1, 24-28; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Lc 1, 46-56.
ANNIVERSARIA
1963. Roma. Fr. Lorenzo M. Ferri, presb., a. 75, r. 59.
1990. Chicago. Fr. John M. Mullane, presb., a. 78, r. 60.
2000. Firenze. Fr. Siro M. Edoni, presb., a. 81, r. 60.
23. Viol. Feria VI hebd. IV Adv. (IV Psalt.).
De ea.
MISSA pr., pf. II Adv.
L 1 Mal 3, 1-4. 23-24; Ps 24, 4bc-5ab. 8-9. 10 et 14.
Ev Lc 1, 57-66.
Fieri potest memoria S. Ioannis de Kety P., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
1986. Firenze. Fr. Luigi M. Mazzei, a. 76, r. 57.
1994. Roma. Fr. Giuseppe M. Besutti, presb., a. 75, r. 57.
2005. Conegliano. Fr. Romano M. Primon, presb., a. 90, r. 72.
24. Viol. Sabb. hebd. IV Adv. (IV Psalt.).
De eo.
16
TEMPUS ADVENTUS
MISSA MATUTINA feriae, pf. II Adv.
L 1 2 Sam 7, 1-5. 8b-12. 14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
Ev Lc 1, 67-79.
Prohibentur aliae celebrationes necnon Missa exsequialis.
Post Nonam explicit tempus Adventus.
ANNIVERSARIA
1989. Vicenza. Fr. Nazareno M. Griffante, presb., a. 66, r. 49.
2004. Bologna. Fr. Pacifico M. Branchesi, presb., a. 68, r. 51.
2005. Vicenza. Fr. Carlo M. Berti, presb., a. 86, r. 66.
TEMPUS NATIVITATIS
Post annuam mysterii paschalis celebrationem, nihil
antiquius habet Ecclesia quam memoriam Nativitatis
Domini et primarum eius manifestationum recolere:
quod fit tempore Nativitatis (AC, 32).
DECEMBER 2011
IN NATIVITATE DOMINI, sollemnitas cum oct.
24. Alb. Sabbato, vespere. – MISSA VIGILIAE pr., Gloria,
Credo, pf. (et Comm.) pr. (noctem sacratissimam).
L 1 Is 62, 1-5; Ps 88, 4-5. 16-17. 27 et 29.
L 2 Act 13, 16-17. 22-25.
Ev Mt 1, 1-25 vel 1, 18-25.
In Missis vigiliae et diei, ad verba symboli Et incarnatus est,
etc. genua flectunt (IM, 137).
In eiusdem Missis adhibeatur PE cum praefatione variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
In nocte Nat. Domini, ante Missam convenit ut sollemnis
vigilia celebretur per Off. lect. (IH, 215, 98, 73).
Cp. ab iis qui huic vigiliae intersunt non dicitur (IH, 215).
25. Alb. Dominica. Officium proprium.
© MISSA pr. Gloria, Credo, pf. (et Comm.) pr.
18
TEMPUS NATIVITATIS
In nocte:
L 1 Is 9, 1-6; Ps 95, 1-2a. 2b-3. 11-12. 13.
L 2 Tit 2, 11-14.
Ev Lc 2, 1-14.
In aurora:
L 1 Is 62, 11-12; Ps 96, 1 et 6. 11-12.
L 2 Tit 3, 4-7.
Ev Lc 2, 15-20.
In die:
L 1 Is 52, 7-10; Ps 97, 1. 2-3ab. 3cd-4. 5-6.
L 2 Hebr 1, 1-6.
Ev Io 1, 1-18 vel 1, 1-5. 9-14.
Hodie: 1. Omnes sacerdotes tres Missas celebrare vel conce-
lebrare possunt, dummodo hae suo tempore celebrentur.
Qui unam tantum Missam celebrat, eam sumat que respon-
det horae diei. Sacerdos hodie ter celebrans potest tres elee-
mosynas percipere (CIC, 951 § 1).
2. Prohibentur omnes aliae celebrationes necnon Missae
defunctorum, etiam exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1976. Vicenza. Fr. Giuseppe M. De Tomasi, a. 63, r. 44.
1978. Reggio Emilia. Fr. Luigi M. Dondini, presb., a. 68, r. 50.
2001. Chicago. Fr. Nicholas M. Norusis, presb., a. 86, r. 65.
26. Rub. Feria II. S. STEPHANI, PROTOMART., fes-
tum. – Ad H. m. ant. pr. et pss. feriae II hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
DECEMBER 2011
19
L 1 Act 6, 8-10; 7, 54-59; Ps 30, 3cd-4. 6 et 8ab. 16bc
et 17.
Ev Mt 10, 17-22.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 26 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1989. Montréal. Fr. Luc M. Lapalme, presb., a. 52, r. 33.
2004. Viareggio. Fr. Camillo M. Menchini, presb., a. 88, r. 71.
2005. Fullerton. Fr. Philip M. Eikmeyer, a. 84, r. 58.
27. Alb. Feria III. S. IOANNIS AP. ET EVANG., festum.
– Ad H. m. ant. pr. et pss. feriae III hebd. I.
MISSA pr., Gloria, lect. pr., pf. (et Comm.) Nat.
L 1 1 Io 1, 1-4; Ps 96, 1-2. 5-6. 11-12.
Ev Io 20, 2-8.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 27 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1965. Dundee. Fr. Peregrine M. Baldwin, presb., a. 61, r. 43.
1966. Plasencia. Fr. Férenc M. Németh, a. 42, r. 3.
2008. Kersal. Fr. John M. Knowles, a. 91, r. 66.
28. Rub. Feria IV. SS. INNOCENTIUM MART., festum.
– Ad H. m. ant. de temp. et pss. feriae IV hebd. I.
20
TEMPUS NATIVITATIS
MISSA pr., Gloria, lect. pr., pf. (et Comm.) Nat.
L 1 1 Io 1, 5 – 2, 2; Ps 123, 2-3. 4-5. 7b-8.
Ev Mt 2, 13-18.
Prohibentur Missae defunctorum, excepta exsequiali.
Vp. Nat., ut diebus 25 et 28 dec. – Cp. dom. (post I
vel II Vp.)
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore dell’Addo-
lorata Serve di Maria di Pisa, hanc diem, qua anno
1895 septem primae sorores in unum convenientes
fundamenta Instituti iecerunt, tamquam Diem
Congregationis celebrat. Anno 1916 die 1 novembris
Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae cum in liturgi-
cis tum in privatis orationibus dignas Deo et glorio-
sae Virgini grates referant et pro bono atque incre-
mento Congregationis fraternas effundant preces.
1981.
2001.
2001.
2010.
ANNIVERSARIA
Quilmes. Fr. Alessandro M. Belló, presb., a. 66, r. 47.
Acton Vale. Fr. Robert M. Desloges, presb., a. 77, r. 55.
Montréal. Fr. André M. Carrier, presb., a. 61, r. 40.
Reggio Emilia. Fr. Emidio M. Iotti, presb., a. 78, r. 61.
29. Alb. Feria V. De V DIE INFRA OCT. NAT. – Off.
ut diebus 25 et 29 dec. – Ad H. m. ant. de temp. et
pss. feriae V hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
L 1 1 Io 2, 3-11; Ps 95, 1-2a. 2b-3. 5b-6.
Ev Lc 2, 22-35.
DECEMBER 2011
21
Prohibentur Missae defunctorum, excepta exsequiali aut
in primo anniversario (IM, 381).
Fieri potest memoria S. Thomae Becket E.M., ut supra
pp. XXI-XXII notatur.
Vp. Nat., ut diebus 25 et 29 dec. – Cp. dom. (post I
vel II Vp).
ANNIVERSARIA
1965. Withier. Fr. Policarpo M. Campo, presb., a. 48, r. 30.
1967. Santiago del Chile. Fr. Sergio M. Furegon, presb., a. 32,
r. 12.
1983. Napoli. Fr. Cirillo M. Perucatti, presb., a. 66, r. 42.
1984. Medellín. Fr. Angelo M. Mancini, presb., a. 68, r. 52.
1996. Montréal. Fr. Luc M. Lévesque, presb., a. 65, r. 46.
2003. Vicenza. Fr. Mariano M. Martinello, presb., a. 59, r. 41.
2004. Montréal. Fr. Bertrand M. Saint-Laurent, presb., a. 83,
r. 63.
30. Alb. Feria VI. S. FAMILIAE IESU, MARIAE ET
IOSEPH, festum. – Ad H. m. ant. pr. et pss. feriae
VI hebd. I.
MISSA pr., Gloria, Credo, pf. (et Comm.) Nat.
L 1 Sir 3, 3-7. 14-17a (gr. 2-6. 12-14);
Ps 127, 1-2. 3. 4-5.
L 2 Col 3, 12-21.
Ev Lc 2, 22-40 vel 2, 22. 39-40.
Vel:
L 1 Gen 15, 1-6; 21, 1-3; Ps 104, 1b-2. 3-4. 5-6. 8-9.
L 2 Hebr 11, 8. 11-12. 17-19.
Ev Lc 2, 22-40 vel 2, 22. 39-40.
Prohibentur Missae defunctorum, excepta exsequiali.
22
TEMPUS NATIVITATIS
ANNIVERSARIA
1968. Hillside. Fr. Philip M. Philbin, presb., a. 60, r. 39.
2001. Piedimonte Matese. Fr. Luigi M. Mercolino, presb., a. 79,
r. 60.
31. Alb. Sabbato. De VII DIE INFRA OCT. NAT. –
Off. ut diebus 25 et 31 dec. – Ad H. m. ant. de
temp. et pss. sabbati hebd. I.
MISSA pr., Gloria, pf. (et Comm.) Nat.
L 1 1 Io 2, 18-21; Ps 95, 1-2. 11-12. 13.
Ev Io 1, 1-18.
Prohibentur Missae defunctorum, excepta exsequiali aut
in primo anniversario (IM, 381).
Fieri potest memoria S. Silvestri I Pp., ut supra pp. XXI-
XXII notatur (non autem ad Vp.).
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1989. Calumet Park. Fr. Lawrence M. Biskner, presb., a. 61, r. 38.
2001. México. Fr. Faustino M. Faustini, presb., a. 72, r. 55.
2004. Montefiascone (Viterbo). Fr. Salvatore M. Preite, presb.,
a. 84, r. 67.
Valde commendatur ut in omnibus ecclesiis
Servorum Familiae hac nocte qua fit transitus ad
annum 2012 SOLLEMNIS VIGILIA celebretur.
ANNO DOMINI 2012
Lectionarium festivum B
Lectionarium feriale II
IANUARIUS 2012
1. Alb. Dominica. In octava Nativitatis Domini.
SOLLEMNITAS SANCTAE DEI GENETRICIS
MARIAE. – Ad H. m. ant. pr. cum psalmodia com-
plementari.
© MISSA pr., Gloria, Credo, pf. I B. Mariae V. Et te in
Maternitate. In canone rom. Comm. Nat.
L 1 Num 6, 22-27; Ps 66, 2-3. 5. 6 et 8.
L 2 Gal 4, 4-7.
Ev Lc 2, 16-21.
Adhibeatur PE cum praefatione variabili.
DIES PRO PACE
Ubi peculiares fiunt celebrationes pro die paci foven-
dae dicato, dici potest, de iudicio Ordinarii loci, Missa
pro pace, secundum schema a Sancta Sede singulis
annis propositum et themati celebrationis respondens.
Non permittuntur aliae celebrationes neque Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
24
TEMPUS NATIVITATIS
In feriis temporis natalicii usque ad diem 7 ianuarii:
a) In Officio: Ant. ad invitatorium, hymni, antiphona ad
Horam mediam sumuntur e Proprio de Tempore, respec-
tive ante vel post Epiphaniam.
b) Quoad Missam: Non permittuntur Missae ad diversa,
votivae aut cotidianae defunctorum (IM, 381), nisi necessi-
tas vel utilitas pastoralis id requirat (IM, 376). Permittuntur
tamen Missae de memoriis forte occurrentibus, aut de
Sanctis his diebus in Martyrologio inscriptis (IM, 355b).
ANNIVERSARIA
1962. Buer. Fr. Augustine M. Daly, presb., a. 40, r. 11.
1978. Budrio. Fr. Prospero M. Tubertini, presb., a. 78, r. 56.
2. Alb. Feria II temp. Nat. (hebd. II Psalt.).
Ss. Basilii Magni et Gregorii Nazianzeni, Epp. D.,
memoria.
MISSA memoriae, pf. Nat.
L 1 1 Io 2, 22-28; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 1, 19-28.
ANNIVERSARIA
1966. San Pierre. Fr. Sostene M. Doherty, presb., a. 66, r. 45.
2009. Roma. Fr. Paolo M. Erthler, presb., a. 67, r. 50.
IANUARIUS 2012
De Ss. Nomine:
L 1 Phil 2, 1-11; Ps 8, 4-5. 6-7. 8-9.
Ev Lc 2, 21-24.
4. Alb. Feria IV temp. Nat. (hebd. II Psalt.)
De ea.
MISSA pr., pf. Nat.
L 1 1 Io 3, 7-10; Ps 97, 1. 7-8. 9.
Ev Io 1, 35-42.
ANNIVERSARIA
1962. Perugia. Fr. Sostegno M. Dal Magro, a. 57, r. 32.
1982. Heidelberg. Fr. Francesco M. Trevisol, presb., a. 72, r. 52.
2004. Torino. Fr. Giovenale M. Zorniotti, presb., a. 75, r. 56.
COMMODITATIS CAUSA DUPLEX INTEGRA
SERIES DIERUM 5-9 IANUARII PROPONITUR
PROUT SOLLEMNITAS EPIPHANIAE DIE 6
IANUARII AUT PRIMA DOMINICA POST OCTA-
VAM NATIVITATIS CELEBRATUR.
Ubi sollemnitas Epiphaniae die dominica celebratur:
3. Alb. Feria III temp. Nat. (hebd. II Psalt.)
De ea. Vel:
Alb. Ss.mi Nominis Iesu.
MISSA pr., pf. Nat.
L 1 1 Io 2, 29 – 3, 6; Ps 97, 1. 3cd-4. 5-6.
Ev Io 1, 29-34.
25
5. Alb. Feria V temp. Nat. (hebd. II Psalt.).
De ea.
MISSA feriae, pf. Nat.
L 1 1 Io 3, 11-21; Ps 99, 2. 3. 4. 5.
Ev Io 1, 43-51.
26
TEMPUS NATIVITATIS
ANNIVERSARIA
1975. Alessandria. Fr. Anselmo M. Péaquin, presb., a. 71, r. 46.
1980. Maria Waldrast. Fr. Adolfo M. Pojer, presb., a. 69, r. 51.
1983. Verona. Fr. Celio M. Marchesan, presb., a. 57, r. 38.
6. Alb. Feria VI temp. Nat. (hebd. II Psalt.).
De ea.
MISSA feriae, pf. Nat.
L 1 1 Io 5, 5-13; Ps 147, 12-13. 14-15. 19-20.
Ev Mc 1, 7-11 vel Lc 3, 23-38 vel 3, 23. 31-34. 36. 38.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus African Servite
Sisters (Swaziland), hanc diem, qua anno 1935 sep-
tem primae sorores religionis vota nuncuparunt,
tamquam Diem Congregationis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperum necnon Sacrificii eucharisti-
ci Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
ANNIVERSARIA
1963. Udine. Fr. Giovannangelo M. Duso, a. 75, r. 51.
7. Alb. Sabb. temp. Nat. (hebd. II Psalt.).
De eo. Vel:
Alb. S. Raimundi de Penyafort P. Vel:
Alb. De S. Maria in sabb.
MISSA feriae vel memoriae, pf. Nat. vel de sancto, vel MISSA
B. Mariae V., temp. Nat., pf. Nat.
IANUARIUS 2012
27
L 1 1 Io 5, 14-21; Ps 149, 1-2. 3-4. 5 et 6a et 9b.
Ev Io 2, 1-11.
Vel:
Una e missis CMBMV Temp. Nat. praesertim form. n. 6:
Beata Maria Virgo, in Epiphania Domini.
I VESPERAE seq. soll. – Cp. post. I Vp. dom.
ANNIVERSARIA
1993. Genova. Fr. Gabriele M. Marchesini, presb., a. 58, r. 38.
2003. Maddaloni (Caserta). Fr. Bonfiglio M. Mautone, presb.,
a. 81, r. 63.
8. Alb. Dominica II post Nativitatem.
IN EPIPHANIA DOMINI, sollemnitas.
Omnia ut infra, die 6 januarii, pp. 29-30.
II VESPERAE soll. – Cp. post II Vp. dom.
1992.
2000.
2008.
2009.
ANNIVERSARIA
Arco. Fr. Mauro M. Todde, presb., a. 57, r. 37.
Chicago. Fr. Francis M. Martin, presb., a. 82, r. 59.
Negrar. Fr. Mario M. Masini, presb., a. 80, r. 63.
Vicenza. Fr. Raffaele M. Borotto, presb., a. 82, r. 63.
TRIDUUM
S. ANTONII MARIÆ PUCCI
Diebus 9-10-11 ianuarii… (cfr. p. 32)
28
29
TEMPUS NATIVITATIS IANUARIUS 2012
9. Alb. Feria II. IN BAPTISMATE DOMINI, festum. – Ad ANNIVERSARIA
H. m. ant. pr. et pss. feriae II hebd. III Psalt. 1975. Alessandria. Fr. Anselmo M. Péaquin, presb., a. 71, r. 46.
1980. Maria Waldrast. Fr. Adolfo M. Pojer, presb., a. 69, r. 51.
1983. Verona. Fr. Celio M. Marchesan, presb., a. 57, r. 38.
MISSA pr., Gloria, pf. pr.
L 1 Is 42, 1-4. 6-7 vel Act 10, 34-38;
Ps 28, 1a et 2. 3ac-4. 3b et 9b-10.
Ev Mc 1, 7-11.
Vel:
L 1 Is 55, 1-11 vel. 1 Io 5, 1-9; Ps Is 12, 2-3. 4bcd. 5-6.
Ev Mc 1, 7-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE festi. – Cp. post II Vp. dom.
Post Completorium explicit Tempus Nativitatis.
1979.
1984.
1989.
1996.
ANNIVERSARIA
Detroit. Fr. Paul M. Onderbeke, presb., a. 58, r. 37.
Ciudad Juárez. Fr. Lorenzo M. Maggion, presb., a. 65,
r. 44.
Vicenza. Fr. Mario M. Dal Vecchio, presb., a. 66, r. 47.
Negrar. Fr. Patrizio M. Antonutti, presb., a. 83, r. 61.
Ubi sollemnitas Epiphaniae die 6 ianuarii celebratur:
5. Alb. Feria V temp. Nat. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Nat.
L 1 1 Io 3, 11-21; Ps 99, 2. 3. 4. 5.
Ev Io 1, 43-51.
IN EPIPHANIA DOMINI, sollemnitas.
5. Alb. Feria V temp. Nat., vespere –
© MISSA vespertina soll., Gloria, Credo, pf. (et Comm.) pr.
Lectiones sumuntur e Missa in die sollemnitatis.
I VESPERAE Epiphaniae – Cp. post I Vp. dom.
6. Alb. Feria VI. IN
prium.
DIE SOLLEMNITATIS.
– Off. pro-
© MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Is 60, 1-6; Ps 71, 2. 7-8. 10-11. 12-13.
L 2 Eph 3, 2-3a. 5-6.
Ev Mt 2, 1-12.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequialis.
In Missa huius diei, post evangelium, annuntiantur festa
mobilia iuxta formulam Pontificalis Romani: cf. p. III
huius calendarii.
Feriis temporis natalicii post Epiphaniam in Liturgia
Horarum habentur hymni proprii; item in Missa habetur
collecta propria.
II VESPERAE Epiphaniae – Cp. post II Vp. dom.
30
TEMPUS NATIVITATIS
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus African Servite
Sisters (Swaziland), hanc diem, qua anno 1935 sep-
tem primae sorores religionis vota nuncuparunt,
tamquam Diem Congregationis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperum necnon Sacrificii eucharisti-
ci Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
ANNIVERSARIA
1963. Udine. Fr. Giovannangelo M. Duso, a. 75, r. 51.
7. Alb. Sabb. post Epiphaniam (hebd. II Psalt.).
De eo. Vel:
Alb. S. Raymundi de Penyafort P. Vel:
Alb. De S. Maria in sabb.
MISSA feriae vel memoriae, pf. Epiph. vel Nat. vel de
sancto, vel MISSA B. Mariae V., Temp. Nat., pf. Epiph.
vel Nat.
L 1 1 Io 3, 22 – 4, 6; Ps 2, 7-8. 10-11.
Ev Mt 4, 12-17. 23-25.
Vel:
Una e missis CMBMV Temp. Nat., praesertim form.
n. 6: Beata Maria Virgo, in Epiphania Domini.
I VESPERAE seq. – Cp. post. 1 Vp. dom.
IANUARIUS 2012
31
ANNIVERSARIA
1993. Genova. Fr. Gabriele M. Marchesini, presb., a. 58, r. 38.
2003. Maddaloni (Caserta). Fr. Bonfiglio M. Mautone, presb.,
a. 81, r. 63.
8. Alb. Dom. III post Nat. IN BAPTISMATE DOMINI,
festum. – Ad H. m. ant. pr. et pss. dom. hebd. III Psalt.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 42, 1-4. 6-7; Ps 28, 1a et 2. 3ac-4. 3b et 9b-10.
L 2 Act 10, 34-38.
Ev Mc 1, 7-11.
Vel:
L 1 Is 55, 1-11; Ps Is 12, 2-3. 4bcd. 5-6.
L 2 1 Io 5, 1-9.
Ev Mc 1, 7-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE festi. – Cp. post II Vp. dom.
Post Completorium explicit Tempus Nativitatis.
1992.
2000.
2008.
2009.
ANNIVERSARIA
Arco. Fr. Mauro M. Todde, presb., a. 57, r. 37.
Chicago. Fr. Francis M. Martin, presb., a. 82, r. 59.
Negrar. Fr. Mario M. Masini, presb., a. 80, r. 63.
Vicenza. Fr. Raffaele M. Borotto, presb., a. 82, r. 63.
32
TEMPUS NATIVITATIS
TRIDUUM
S. ANTONII MARIÆ PUCCI
Diebus 9-10-11 ianuarii in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut
fratres omnesque sodales ad festum S. Antonii
Mariæ Pucci celebrandum apte disponantur. Ad
hoc opportune adhibebitur subsidium cui est
titulus In lode di sant’Antonio Maria Pucci vel In praise of saint
Anthony Pucci vel À la louange de saint Antoine-Marie Pucci vel
En honor de san Antonio María Pucci.
TEMPUS PER ANNUM
ante Quadragesimam
Tempore per annum non celebratur peculiaris my-
sterii Christi aspectus: sed potius ipsum mysterium
Christi in sua plenitudine recolitur, praesertim
diebus dominicis (AC, 43).
Pro Officio divino sumitur vol. III Liturgiae Horarum.
In Missa, Lectionarium feriale, Anno II.
IANUARIUS 2012
9. Vir. Feria II hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 1, 1-8; Ps 115, 12-13. 14-17. 18-19.
Ev Mc 1, 14-20.
In Missis votivis et in Missis B. Mariae V. in sabbato, adhiberi
potest color sive proprius Missae, sive diei, sive temporis.
1979.
1984.
1989.
1996.
ANNIVERSARIA
Detroit. Fr. Paul M. Onderbeke, presb., a. 58, r. 37.
Ciudad Juárez. Fr. Lorenzo M. Maggion, presb., a. 65,
r. 44.
Vicenza. Fr. Mario M. Dal Vecchio, presb., a. 66, r. 47.
Negrar. Fr. Patrizio M. Antonutti, presb., a. 83, r. 61.
34
TEMPUS PER ANNUM
10. Vir. Feria III hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 1, 9-20; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Mc 1, 21b-28.
ANNIVERSARIA
1983. Tirano. Fr. Mansueto M. Malva, presb., a. 63, r. 44.
1998. Cochabamba. Fr. Sergio M. Mesaglio Venuti, presb., a. 76,
r. 58.
11. Vir. Feria IV hebd. I per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 3, 1-10. 19-20; Ps 39, 2 et 5. 7-8a. 8b-9. 10.
Ev Mc 1, 29-39.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Addolorata (Nocera), hanc diem, qua anno 1900
Maria Consilia a Spiritu Sancto (1845-1900),
Congregationis Fundatrix, in Domino quievit, tam-
quam Diem Congregationis festive commemorat.
Anno 1880 die 15 octobris Congregatio Ordini
nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo
reddant et pro bono atque incremento Instituti fer-
ventes adhibeant preces.
IANUARIUS 2012
1980.
1980.
1985.
1997.
1999.
35
ANNIVERSARIA
Arco. Fr. Giorgio M. Posenato, presb., a. 61, r. 42.
Montréal. Fr. Amédée M. Lavigueur, presb., a. 83, r. 48.
Mezökövesd. Fr. Cyprian M. Kovács, presb., a. 69, r. 49.
Siracusa. Fr. Eugenio M. Pantano, presb., a. 72, r. 53.
Wheeling. Fr. Frank M. Calkins, presb., a. 92, r. 73.
12. Alb. Feria V. S. ANTONII MARIAE PUCCI, PRES-
BYTERI O. N., festum. – Ad H. m. ant. et pss. feriae
V, hebd. I.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 Ez 34, 11-16. 31; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Io 10, 11-16.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1963. Dublin. Fr. Conleth M. Doherty, presb., a. 35, r. 10.
2000. Dundee. Fr. Anselm M. Richardson, presb., a. 78, r. 57.
13. Vir. Feria VI hebd. I per annum (I Psalt.).
De ea. Vel:
Alb. S. Hilarii E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 8, 4-7. 10-22a; Ps 88, 16-17, 18-19.
Ev Mc 2, 1-12.
ANNIVERSARIA
1976. Todi. Fr. Adriano M. Lucchetti, a. 83, r. 48.
2009. Guadalajara. Fr. Valerio M. Maccagnan, presb., a. 81, r. 63.
36
TEMPUS PER ANNUM
14. Alb. Sabb. hebd. I per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae, quae vel e Missali Romano vel e
Proprio Missarum O. N. vel e CMBMV Temp. per
annum sumi potest.
L 1 1 Sam 9, 1-4. 17-19; 10, 1a; Ps 20, 2-3. 4-5. 6-7.
Ev Mc 2, 13-17.
Vel:
Una e missis CMBMV Temp. Quadr., praesertim
form. n. 10: Sancta Maria, discipula Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
1978.
1981.
1992.
2009.
ANNIVERSARIA
Bruxelles. Fr. Alexis M. Vanderstraeten, presb., a. 82, r. 55.
Follina. Fr. Pietro M. Belia, presb., a. 65, r. 46.
Massa. Fr. Antonio M. Montà, presb., a. 73, r. 52.
Saviano. Fr. Fedele M. Ciarcià, presb., a. 96, r. 80.
15. Vir. DOM. II PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Sam 3, 3b-10. 19; Ps 39, 2 et 4ab. 7-8a. 8b-9. 10.
L 2 1 Cor 6, 13c-15a. 17-20.
Ev Io 1, 35-42.
Prohibentur Missae defunctorum, excepta exsequiali.
B. Iacobi de Villa, Eleemosynarii nuncupati, memoria
omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
IANUARIUS 2012
37
ANNIVERSARIA
1973. Reggio Emilia. Fr. Paolo M. Bagnacani, presb., a. 47, r. 30.
1979. Vicenza. Fr. Mariano M. Tognetti, presb., a. 57, r. 39.
16. Vir. Feria II hebd. II per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 15, 16-23; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mc 2, 18-22.
ANNIVERSARIA
1964. Ronzano. Fr. Anacleto M. Brasa, presb., a. 74, r. 57.
1990. Napoli. Fr. Angelo M. Di Giuseppe, presb., a. 66, r. 49.
1995. Anaheim. Fr. Gregory M. O’Brien, presb., a. 79, r. 60.
17. Alb. Feria III hebd. II per annum (II Psalt.).
S. Antonii A., memoria.
MISSA memoriae.
L 1 1 Sam 16, 1-13; Ps 88, 20. 21-22. 27-28.
Ev Mc 2, 23-28.
PRO UNITATE CHRISTIANORUM
A die 18 ad diem 25 ianuarii fit octiduum supplica-
tionum pro unitate christianorum.
ANNIVERSARIA
1964. Vicenza. Fr. Gabriele M. Giacomozzi, presb., a. 54, r. 37.
1975. Hillside. Fr. Luigi M. Giambastiani, presb., a. 89, r. 73.
2003. Civita Castellana (Viterbo). Fr. Pietro M. Tollo, presb.,
a. 83, r. 66.
38
TEMPUS PER ANNUM
18. Vir. Feria IV hebd. II per annum (II Psalt.).
De ea.
IANUARIUS 2012
L 1 1 Sam 24, 3-21; Ps 56, 2. 3-4. 6 et 11.
Ev Mc 3, 13-19.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Sam 17, 32-33. 37. 40-51; Ps 143, 1. 2. 9-10.
Ev Mc 3, 1-6.
1991.
1992.
1996.
2002.
ANNIVERSARIA
Irún. Fr. Raffaele M. Trotti, presb., a. 71, r. 52.
Vicenza. Fr. Graziano M. Bandiera, a. 53, r. 36.
Plasencia. Fr. Julio M. Muñoz Prieto, a. 76, r. 38.
Nyíregyháza. Fr. Elek M. Póka, presb., a. 87, r. 69.
19. Vir. Feria V hebd. II per annum (II Psalt.).
De ea.
39
1979.
1989.
1999.
2005.
2010.
ANNIVERSARIA
Montecchio Precalcino. Fr. Pietro M. Berton, a. 79, r. 57.
Begbroke. Fr. Vincent M. Naughton, presb., a. 80, r. 59.
Quilmes. Fr. Buenaventura M. Signori, a. 81, r. 62.
Reggio Emilia. Fr. Francesco M. Moioli, presb., a. 63, r. 42.
Cochabamba. Fr. Lorenzo M. Santinon Bianco, diac.,
a. 85, r. 51.
21. Rub. Sabb. hebd. II per annum (II Psalt.).
S. Agnetis V. M., memoria.
Ad Laudes ant. propriae cum psalmis dom. hebd. I.
MISSA ad libitum (cf. p. XVIII). MISSA memoriae.
L 1 1 Sam 18, 6-9; 19, 1-7; Ps 55, 2-3. 9-10ab. 10c-11. L 1 2 Sam 1, 1-4. 11-12. 19. 23-27; Ps 79, 2-3. 5-7.
12-13. Ev Mc 3, 20-21.
Ev Mc 3, 7-12.
ANNIVERSARIA
1995. Livorno. Fr. Giacomo Filippo M. Tognocchi, presb., a. 93,
r. 74.
2000. Hall. Fr. Narzissus M. Obermeier, presb., a. 89, r. 67.
20. Vir. Feria VI hebd. II per annum (II Psalt.).
De ea. Vel:
Rub. S. Fabiani Pp. M. Vel:
Rub. S. Sebastiani M.
MISSA ad libitum (cf. p. XVIII).
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1975. Udine. Fr. Martino M. Dario, a. 65, r. 34.
1984. Ciudad de México. Fr. Silvestro M. Caron, presb., a. 68,
r. 49.
1987. Regensburg. Fr. Wolfgang M. Riser, presb., a. 50, r. 30.
22. Vir. DOM III PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ion 3, 1-5. 10; Ps 24, 4bc-5ab. 6-7bc. 8-9.
40
TEMPUS PER ANNUM
L 2 1 Cor 7, 29-31.
Ev Mc 1, 14-20.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Vincentii Diac. M. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1994. Napoli. Fr. Pio M. D’Alessandro, presb., a. 80, r. 63
2007. Plasencia. Fr. Joaquín M. Cruz Hierro, presb., a. 68, r. 50.
23. Vir. Feria II hebd. III per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 5, 1-7. 10; Ps 88, 20. 21-22. 25-26.
Ev Mc 3, 22-30.
ANNIVERSARIA
1979. Vicenza. Fr. Luigi M. Alba, presb., a. 85, r. 69.
24. Alb. Feria III hebd. III per annum (III Psalt.).
S. Francisci de Sales E. D., memoria.
MISSA memoriae.
L 1 2 Sam 6, 12b-15. 17-19; Ps 23, 7. 8. 9. 10.
Ev Mc 3, 31-35.
ANNIVERSARIA
1965. Chicago. Fr. Martin M. White, presb., a. 61, r. 40.
1972. Vicenza. Fr. Antonino M. Basso, presb., a. 77, r. 57.
1985. Denia. Fr. Giacinto M. Triulzi, presb., a. 71, r. 55.
IANUARIUS 2012
41
25. Alb. Feria IV. IN CONVERSIONE S. PAULI AP.,
festum. – Ad H. m. ant. pr. et pss. feriae IV hebd. III.
MISSA pr., Gloria, lect. pr., PE cum pf. App.
L 1 Act 22, 3-16 vel Act 9, 1-22; Ps 116, 1. 2.
Ev Mc 16, 15-18.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
2008. Vicenza. Fr. Angelico M. Sgarbossa, presb., a. 85, r. 66.
26. Alb. Feria V hebd. III per annum (III Psalt.).
Ss. Timothei et Titi E., memoria.
MISSA memoriae, lect. pr.
L 1 2 Tim 1, 1-8 vel Tit 1, 1-5; Ps 95, 1-2a. 2b-3. 7-8a. 10.
Ev Lc 10, 1-9.
ANNIVERSARIA
1965. Viareggio. Fr. Vittorino M. Benvenuti, a. 66, r. 42.
1970. Caxambu. Fr. Giacomo Filippo M. Mattioli, presb., a. 82,
r. 66.
27. Vir. Feria VI hebd. III per annum (III Psalt.).
De ea. Vel:
Alb. S. Angelae Merici V.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 11, 1-4a. 5-10a. 13-17;
Ps 50, 3-4. 5-6a. 6bc-7. 10-11.
Ev Mc 4, 26-34.
42
TEMPUS PER ANNUM
1965.
1977.
1978.
1982.
1989.
ANNIVERSARIA
Vicenza. Fr. Biagio M. Frattin, a. 80, r. 53.
Saint-Ortaire. Fr. Vincent M. Bansard, presb., a. 72, r. 48.
Roma. Fr. Daniele M. Santoro, a. 26, r. 4 mensium.
Verona. Fr. Adriano M. Agosteo, presb., a. 65, r. 46.
Calumet Park. Fr. Norberto M. Balasso, presb., a. 66, r. 46.
28. Alb. Sabb. hebd. III per annum (III Psalt.).
S. Thomae de Aquino P. D., memoria.
IANUARIUS 2012
43
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1986. Mouila (Gabon). Fr. Robert M. Berthelet, presb., a. 56,
r. 35.
2002. Vicenza. Fr. Igino M. Urbani, presb., a. 82, r. 65.
30. Vir. Feria II hebd. IV per annum (IV Psalt.).
De ea.
MISSA memoriae. MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 12, 1-7a. 10-17; Ps 50, 12-13. 14-15. 16-17. L 1 2 Sam 15, 13-14. 30; 16, 5-13a; Ps 3, 2-3. 4-5. 6-7.
Ev Mc 4, 35-41. Ev Mc 5, 1-20.
I VESPERAE dom. – Cp. post I Vp. dom.
1975.
1978.
1980.
1990.
1996.
2001.
ANNIVERSARIA
Garbagnate. Fr. Gabriele M. Crespi, presb., a. 55, r. 21.
Hochzirl. Fr. Stanislaus M. Faschinger, a. 74, r. 40.
Bologna. Fr. Domenico M. Nascetti, presb., a. 73, r. 55.
Bologna. Fr. Amadio M. Brighetti, presb., a. 82, r. 65.
Mestre. Fr. Eugenio M. Zucco, a. 67, r. 47.
Vicenza. Fr. Giocondo M. Todescato, presb., a. 87, r. 68.
29. Vir. DOM. IV PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Deut 18, 15-20; Ps 94, 1-2. 6-7. 8-9.
L 2 1 Cor 7, 32-35.
Ev Mc 1, 21-28.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1974. Follina. Fr. Felice M. Brazzale, presb., a. 46, r. 28.
1995. Firenze. Fr. Angiolo M. Attanasio, a. 70, r. 23.
2011. Firenze. Fr. Terenzio M. Biondi, presb., a. 89, r. 71.
31. Alb. Feria III hebd. IV per annum (IV Psalt.).
S. Ioannis Bosco P., memoria.
MISSA memoriae.
L 1 2 Sam 18, 9-10. 14b. 24-25a. 30-19,3; Ps 85, 1-2.
3-4. 5-6.
Ev Mc 5, 21-43.
ANNIVERSARIA
1965. La Plata. Fr. Giuseppe M. Giuriato, presb., a. 47, r. 29.
2007. Trieste. Fr. Giorgio M. Trivellin, presb., a. 75, r. 58.
2010. Sondrio. Fr. Camillo M. De Piaz, presb., a. 91, r. 74.
FEBRUARIUS 2012
FEBRUARIUS 2012
1. Vir. Feria IV hebd. IV per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Sam 24, 2. 9-17; Ps 31, 1-2. 5. 6. 7.
Ev Mc 6, 1-6.
45
VESPERAE de festo.
Cras: Fieri poterit benedictio gutturis, cum candelis
eadem die (3 febr.) benedictis (exstinctis), secundum for-
mulam Rit. Rom. et adhibitis verbis: «Per intercessionem
sancti Blasii, Episcopi et Martyris, liberet te Deus a malo gut-
turis et a quolibet alio malo. In nomine Patris, et Filii, et
Spiritus Sancti. Amen».
Cras: 1) Candelae benedici possunt cum processione vel
introitu sollemni, ut in Missali. Ecclesiam vel presbyte-
rium ingrediendo canitur ant. ad introitum, quam statim
sequitur Gloria, collecta, etc.
2) Initio fideles in manibus tenent candelas, quae acce-
duntur dum canitur ant. Ecce Dominus.
3) In processione sacerdos casulam vel pluviale induit.
DIES INSTITUTI
Institutum saeculare cui est titulus Regnum Mariae,
hodie Diem Instituti festive celebrat. Anno 1976 die
23 novembris Institutum Ordini nostro aggregatum est.
Fratres et sorores totius Ordinis pro bono atque incre-
mento Instituti Dominum et beatam Virginem enixe
exorent.
ANNIVERSARIA 1968.
1968. Reggio Emilia. Fr. Benedetto M. Marconi, presb., a. 80, 1978.
r. 64. 1984.
1994. Negrar. Fr. Amadio M. Gasperini, a. 85, r. 61. 1987.
2001. Napoli. Fr. Andrea M. D’Andrea, presb., a. 79, r. 59.
2007. Firenze. Fr. Nicolò M. Manzi, presb., a. 86, r. 58.
2. Alb. Feria V. IN PRAESENTATIONE DOMINI, 3. Alb. Feria VI hebd. IV per annum (IV Psalt.).
festum. – Ad H. m. ant. et pss. feriae V hebd. IV. B. Ioachimi Senensis religiosi O.N., memoria
ANNIVERSARIA
Roma. Fr. Lorenzo M. Lucatelli, presb., a. 69, r. 46.
Budapest. Fr. Gellért M. Lepkó, presb., a. 65, r. 42.
Carrara. Fr. Giulio M. Moretti, a. 69, r. 52.
Bognor Regis. Fr. Bernard M. O’Hanlon, presb., a. 75, r. 57.
MISSA pr., Gloria, lect. pr., pf. pr. MISSA memoriae.
L 1 Mal 3, 1-4 vel Hebr 2, 14-18; Ps 23, 7. 8. 9. 10. L 1 Sir 47, 2-13 (gr. 2-11); Ps 17, 31. 47 et 50. 51.
Ev Lc 2, 22-40 vel 2, 22-32. Ev Mc 6, 14-29.
Adhibeatur PE cum praefatione variabili. Ss. Blasii E. M. et Ansgarii E. memoria omittitur.
Prohibentur Missae defunctorum, excepta exsequiali.
46
47
TEMPUS PER ANNUM FEBRUARIUS 2012
ANNIVERSARIA ANNIVERSARIA
1995. Ottawa. Fr. Grégoire M. Saint-Germain, presb., a. 74, 1992. Firenze. Fr. Dionisio M. Gaspari, a. 75, r. 53.
r. 55. 1997. Reggio Emilia. Fr. Bernardo M. Tomassetti, a. 63, r. 42.
2011. Cochabamba. Fr. Giuseppe M. Sartori, presb., a. 65, r. 48.
4. Alb. Sabb. hebd. IV per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 1 Reg 3, 4-13; Ps 118, 9. 10. 11. 12. 13. 14.
Ev Mc 6, 30-34.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 7: Sancta Maria in Praesentatione Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
2003. Montréal. Fr. Antoine M. Dupuis, presb., a. 73, r. 55.
2007. Chicago. Fr. James M. Dore, presb., a. 74, r. 54.
5. Vir. DOM. V PER ANNUM (Hebd. I Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Iob 7, 1-4. 6-7; Ps 146, 1-2. 3-4. 5-6.
L 2 1 Cor 9, 16-19. 22-23.
Ev Mc 1, 29-39.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Agathae V. M. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
6. Rub. Feria II hebd. V per annum (I Psalt).
Ss. Pauli Miki et soc. Mm., memoria.
MISSA memoriae.
L 1 1 Reg 8, 1-7. 9-13; Ps 131, 6-7. 8-10.
Ev Mc 6, 53-56.
1975.
1982.
1983.
1984.
1992.
2004.
2005.
ANNIVERSARIA
Siena. Fr. Giovanni M. Rossi, a. 69, r. 27.
Firenze. Fr. Raffaele M. Paoletti, a. 66, r. 43.
Albuquerque. Fr. Paul M. Theado, presb., a. 70, r. 46.
Albuquerque. Fr. Edward M. Calkins, presb., a. 88, r. 66.
Milano. Fr. David M. Turoldo, presb., a. 75, r. 56.
Negrar. Fr. Stefano M. Praticelli, presb., a. 78, r. 59.
Roma. Fr. Ignacio M. Calabuig Adán, presb., a. 73, r. 53.
7. Vir. Feria III hebd. V per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 8, 22-23. 27-30; Ps 83, 3. 4. 5 et 10. 11.
Ev Mc 7, 1-13.
ANNIVERSARIA
1961. Kainbach. Fr. Ildephons M. Panzner, presb., a. 81, r. 60.
1978. Vicenza. Fr. Angelico M. Nicolodi, presb., a. 71, r. 48.
48
TEMPUS PER ANNUM
8. Vir. Feria IV hebd. V per annum (I Psalt.).
De ea. Vel:
Alb. S. Hieronymi Emiliani Rel. Vel:
Alb. S. Iosephinae Bakhita V.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 10, 1-10; Ps 36, 5-6. 30-31. 39-40.
Ev Mc 7, 14-23.
ANNIVERSARIA
1982. Brockville. Fr. Léo M. Joanisse, presb., a. 71, r. 50.
1999. Pesaro. Fr. Antonio M. Musatti, diac., a. 78, r. 60.
9. Vir. Feria V hebd. V per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 11, 4-13; Ps 105, 3-4. 35-36. 37 et 40.
Ev Mc 7, 24-30.
ANNIVERSARIA
1979. Firenze. Fr. Carlo M. Dal Prá, presb., a. 63, r. 44.
1995. Johannesburg. Fr. Benedict M. Carden, presb., a. 35, r. 8.
2011. Vicenza. Fr. Giovanni M. Travaglia, presb., a. 56, r. 36.
10. Alb. Feria VI hebd. V per annum (I Psalt.).
S. Scholasticae V., memoria.
MISSA memoriae.
L 1 1 Reg 11, 29-32; 12, 19; Ps 80, 10-11ab. 12-13. 14-15.
Ev Mc 7, 31-37.
FEBRUARIUS 2012
49
ANNIVERSARIA
1978. Montréal. Fr. Alessandro M. Carmignani, presb., a. 56,
r. 37.
1979. Siteki. Fr. Laszló M. Orbán a. 75, r. 48.
2001. Richard’s Bay. Fr. Sibusiso Paulus M. Mngomezulu, presb.,
a. 43, r. 20.
11. Alb. Sabb. hebd. V per annum (I Psalt.).
De S. Maria in sabb., memoria. Vel:
Alb. B. Mariae Virginis de Lourdes.
MISSA alterius utrius memoriae.
L 1 1 Reg 12, 26-32; 13, 33-34; Ps 105, 6-7a. 19-20.
21-22.
Ev Mc 8, 1-10.
Vel, in Missa de B. Mariae Virgine de Lourdes,
E Lectionario Sanctorum:
L 1 Is 66, 10-14c; Ps Iudt 13, 18bcde. 19.
Ev Io 2, 1-11.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 44: Beata Maria Virgo, salus infirmorum.
I VESPERAE dom. – Cp. post I Vp. dom.
1964.
1968.
1984.
1989.
1998.
ANNIVERSARIA
Portland. Fr. Alfonse M. Cortney, presb., a. 79, r. 58.
Firenze. Fr. Giovanni M. Fecondi, presb., a. 61, r. 42.
Madrid. Fr. Felice M. Maletto, presb., a. 89, r. 68.
Rio de Janeiro. Fr. Egidio M. Bernardi, presb., a. 62, r. 43.
Firenze. Fr. Paolo M. Michelucci, diac., a. 80, r. 27.
50
TEMPUS PER ANNUM
12. Vir. DOM. VI PER ANNUM (Hebd. II Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Lev 13, 1-2. 44-46; Ps 31, 1-2. 5. 11.
L 2 1 Cor 10, 31 – 11, 1.
Ev Mc 1, 40-45.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dom. – Cp. post II Vp. dom.
ANNIVERSARIA
1987. Roma. Fr. Emerico M. Gagliarducci, presb., a. 71, r. 55.
1988. Nigel. Fr. Urbano M. Cavedon, presb., a. 55, r. 36.
13. Vir. Feria II hebd. VI per annum (II Psalt.).
De ea.
FEBRUARIUS 2012
51
TRIDUUM
SEPTEM SANCTORUM PATRUM FUNDATORUM O. N.
Diebus 14-15-16 februarii in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut fra-
tres omnesque sodales ad sollemnitatem Sancto-
rum Septem Patrum Fundatorum O. N. cele-
brandam apte disponantur. Ad hoc opportune
adhibebitur subsidium cui est titulus In lode dei nostri sette Primi
Padri vel In praise of our seven First Fathers vel À la louange de nos
sept Premiers Pères vel En honor de los siete primeros Padres.
14. Alb. Feria III hebd. VI per annum (II Psalt.).
Ss. Cyrilli, monachi, et Methodii E., memoria.
MISSA memoriae.
L 1 Iac 1, 12-18; Ps 93, 12-13a. 14-15. 18-19.
Ev Mc 8, 14-21.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 1, 1-11; Ps 118, 67. 68. 71. 72. 75. 76.
Ev Mc 8, 11-13.
1993.
1995.
1998.
1999.
ANNIVERSARIA
Milano. Fr. Domenico M. Polo, presb., a. 81, r. 64.
Scottsdale. Fr. Anthony M. Petraglia, presb., a. 58, r. 37.
Johannesburg. Fr. Patrick M. Nolan, presb., a. 95, r. 71.
Dublin. Fr. Francis M. Mallon, a. 66, r. 34.
In Europa:
14. Alb. Feria III. SS. CYRILLI M. ET METHODII E.,
Europae Patron., festum. – Ad H. m. ant. et pss. feriae III
hebd. II.
MISSA festi, Gloria, pf. Ss. Pastorum.
L 1 Act 13, 46-49; Ps 116, 1. 2.
Ev Lc 1O, 1-9.
Adhibeatur PE cum praefatione variabili.
Hodie prohibentur Missae defunctorum, excepta exsequiali.
52
TEMPUS PER ANNUM
ANNIVERSARIA
1985. Saviano. Fr. Giuseppe M. Portesine, presb., a. 81, r. 49.
1986. Marina di Carrara. Fr. Carlo M. Pianini, presb., a. 72,
r. 54.
1987. Budapest. Fr. Jeromos M. Sebestién, presb., a. 74, r. 54.
CCC
ANNUS AB OBITU SORORIS ANGELAE CAVALLETTI
PROFESSAE TERTII ORDINIS SERVORUM MARIAE
15. Vir. Feria IV hebd. VI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 1, 19-27; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Mc 8, 22-26.
ANNIVERSARIA
1972. Innsbruck. Fr. Richard M. Riccabona, presb., a. 61, r. 40.
1973. Ancona. Fr. Luigi M. Bulgarelli, a. 55, r. 35.
16. Vir. Feria V hebd. VI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 2, 1-9; Ps 33, 2-3. 4-5. 6-7.
Ev Mc 8, 27-33.
I VESPERAE seq. soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1970. Siracusa. Fr. Gioacchino M. Romano, a. 60, r. 30.
1978. Piedimonte Matese. Fr. Felice M. Cavallaro, presb., a. 64,
r. 46.
Anno 1712, die 16 februarii, in urbe Ferraria (Italia), obiit soror
Angela Cavalletti, tertii Ordinis Servorum Mariae professa, insi-
gnis pietate et vitae integritate. Cum gravibus morbis esset affec-
ta, multos per annos forti animo acerbissimos toleravit dolores,
donec placido ac sereno vultu in Domino requievit.
Il 16 febbraio 1712, morì a Ferrara suor Angela Cavalletti, Serva
di Maria, insigne per pietà e integrità di vita. Colpita da gravi
malattie, sopportò con animo forte acerbi dolori per molti anni,
fino a quando si addormentò serenamente nel Signore.
On 16 February 1712, Sister Angela Cavalletti, Servant of Mary,
known for her piety and integrity of life, died at Ferrara (Italy).
Struck by serious illness, she bore bitter pain with a strong spirit
for many years, until dying serenely in the Lord.
54
TEMPUS PER ANNUM
17. Alb. Feria VI. SS. SEPTEM PATRUM FUNDATO-
RUM O.N., sollemnitas. – Ad H. m. ant. pr. cum
psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Sir 44, 1-2. 10-15; Ps 36, 3-4. 11 et 18. 39-40.
L 2 Eph 4, 1-6. 15-16.
Ev Io 17, 20-24.
Vel:
L 1 Is 2, 2-5; Ps 23, 1-2. 3-4. 5-6.
L 2 Act 2, 42. 44-48.
Ev Mt 20, 25-28.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
DIES MISSIONIS
Missio in regione Aysén (Chilia) in Praefecturam apo-
stolicam anno 1940, die 17 februarii, erecta hanc
diem tanquam Diem Missionis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Liturgiae Horarum necnon Sacrificii eucharistici
Dominum enixe exorent pro bono atque incremento
Missionis.
ANNIVERSARIA
2001. Manila. Fr. Tarcisio M. Roffi, presb., a. 65, r. 47.
2011. Negrar. Fr. Aurelio M. Chini, presb., a. 86, r. 67.
FEBRUARIUS 2012
55
18. Alb. Sabb. hebd. VI per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iac 3, 1-10; Ps 11, 2-3. 4-5. 7-8.
Ev Mc 9, 2-13.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 24: Beata Virgo Maria, sedes Sapientiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Manzini. Fr. Gerardo M. Galandi, presb., a. 64, r. 47.
1976. Lucca. Fr. Sostegno M. Kieffer, presb., a. 71, r. 49.
1999. Montréal. Fr. Alexis M. Brault, presb., a. 80, r. 63.
Ubi celebratio externa sollemnitatis Ss. Septem Patrum
Fundatorum O.N. (17 febr.), ob rationes pastorales, trans-
fertur in hanc dominicam, omnes Missae, quae concurrente
populo celebrantur, dici possunt de Ss. Septem Patribus.
19. Vir. DOM. VII PER ANNUM (Hebd. III Psalt).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 43, 18-19. 21-22. 24b-25; Ps 40, 2-3. 4-5. 13-14.
L 2 2 Cor 1, 18-22.
Ev Mc 2, 1-12.
56
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
B. Elisabeti Picenardi V. memoria omittitur.
II VESPERAE dom. – Cp. post II Vp. dom.
20. Vir. Feria II hebd. VII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 3, 13-18; Ps 18, 8. 9. 10. 15.
Ev Mc 9, 14-29.
21. Vir. Feria III hebd. VII per annum (III Psalt.).
De ea. Vel:
Alb. S. Petri Damiani E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Iac 4, 1-10; Ps 54, 7-8. 9-10a. 10b-11a. 23.
Ev Mc 9, 30-37.
ANNIVERSARIA
1984. Pietralba. Fr. Bonfilius M. Spitaler, presb., a. 78, r. 49.
2003. Torino. Fr. Vincenzo M. Capella, presb., a. 77, r. 61.
2005. Genova. Fr. Giulio M. De Martini, a. 80, r. 51.
TEMPUS QUADRAGESIMAE
Tempus Quadragesimae ordinatur ad praeparationem
celebrationis Paschae: liturgia enim quadragesimalis
tam catechumenos, per diversos initiationis christia-
nae gradus, quam fideles memoriam Baptismi recolen-
tes et paenitentiam agentes, componit ad celebrandum
paschale mysterium (AC, 27).
Intermittitur tempus per annum; reposito vol. III, assumi-
tur vol. II Liturgiae Horarum.
Tempore Quadragesimae:
1. In omnibus Officiis, tam de Tempore quam de Sanctis, in
principio Horarum, omittitur Alleluia.
2. In omnibus Missis et Officiis, si reperiatur, Alleluia omittitur.
3. In sollemnitatibus et festis, necnon in peculiaribus celebra-
tionibus, dicitur Te Deum et Gloria in excelsis.
4. Altare floribus ornari prohibetur; sonus autem organi alio-
rumque instrumentorum permittitur tantum ad cantum sus-
tentandum. Excipiuntur tamen dominica Laetare (IV Quadr.)
atque sollemnitates et festa (Caer. Ep. n. 252).
5. In celebratione Matrimonii, sive intra Missam sive extra
Missam, benedictio nuptialis semper impertienda est. Monean-
tur tamen sponsi ut rationem habeant peculiaris naturae huius
temporis liturgici (Ordo Matrimonii, 32).
Feria IV Cinerum:
1. Ieiunium cum abstinentia.
58
TEMPUS QUADRAGESIMAE
2. Ad Missam, post evangelium et homiliam, benedicuntur et
imponuntur cineres, facti de ramis olivarum vel aliarum arbo-
rum anno praecedente benedictis. Actus paenitentialis omittitur.
3. Benedictio et impositio cinerum fieri potest etiam sine
Missa quo in casu opportune praemittitur liturgia verbi, adhi-
bendo cantum ad introitum, collectam et lectiones cum suis
cantibus ut in Missa; post homiliam cineres benedicuntur et
imponuntur et celebratio oratione universali clauditur.
FEBRUARIUS 2012
22. Viol. Feria IV. CINERUM (hebd. IV Psalt.).
De ea.
– Ad Ld. dici possunt pss. et canticum feriae VI
hebd. III (ob indolem paenitentialem).
MISSA pr., pf. Quadr.
L 1 Ioel 2, 12-18; Ps 50, 3-4. 5-6a. 12-13. 14 et 17.
L 2 2 Cor 5, 20 – 6, 2.
Ev Mt 6, 1-6. 16-18.
Dies ieiunii et abstinentiae.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
Cathedrae S. Petri Ap. festum omittitur.
ANNIVERSARIA
1980. Innsbruck. Fr. Rudolf M. Hofer, a. 74, r. 48.
1984. Portland. Fr. Leonard M. Mazurk, presb., a. 64, r. 44.
2000. Udine. Fr. Federico M. Caldognetto, presb., a. 65, r. 48.
23. Viol. Feria V post Cineres (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Deut 30, 15-20; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 9, 22-25.
Fieri potest memoria S. Polycarpi E.M., ut pp. XXI-XXII
notatur.
ANNIVERSARIA
2002. Gratzen – Nové Hrady. Fr. Vittorio M. Antollovich, presb.,
a. 76, r. 55.
60
TEMPUS QUADRAGESIMAE
FEBRUARIUS 2012
61
MISSA pr., pf. Quadr. L 2 1 Petr 3, 18-22.
Ev Mc 1, 12-15.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes neque Missa exsequialis.
L 1 Is 58, 1-9a; Ps 50, 3-4. 5-6a. 18-19. II VESPERAE dom. I Quadr. – Cp. post II Vp. dom.
Ev Mt 9, 14-15.
24. Viol. Feria VI post Cineres (hebd. IV Psalt.).
De ea.
1961.
1970.
1993.
1995.
ANNIVERSARIA
Chicago. Fr. Bonaventure M. Maguire, presb., a. 83, r. 66.
Langegg. Fr. Bonaventura M. Grogger, a. 81, r. 49.
Salford. Fr. Bernard M. Deegan, presb., a. 65, r. 43.
Monte Senario. Fr. Celestino M. Marsili, a. 91, r. 25.
25. Viol. Sabb. post Cineres (hebd. IV Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Is 58, 9b-14; Ps 85, 1-2. 3-4. 5-6.
Ev Lc 5, 27-32.
I VESPERAE dom. I Quadr. – Cp. post I Vp. dom.
ANNIVERSARIA
1970. Saluzzo. Fr. Bonaventura M. Piras, presb., a. 91, r. 74.
1998. Matola. Fr. David M. Vaquer Cirujeda, presb., a. 51, r. 33.
2001. Negrar. Fr. Giuseppe M. Trentin, presb., a. 74, r. 57.
26. Viol. DOM. I IN QUADRAGESIMA (Hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Gen 9, 8-15; Ps 24, 4bc-5ab. 6-7bc. 8-9.
ANNIVERSARIA
2008. Firenze. Fr. Carlo M. Rocchi, presb., a. 91, r. 74.
27. Viol. Feria II post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Lev 19, 1-2. 11-18; Ps 18, 8. 9. 10. 15.
Ev Mt 25, 31-46.
ANNIVERSARIA
1976. Dunaszeg. Fr. Pius M. Thun, presb., a. 61, r. 45.
1997. Plasencia. Fr. Luis M. González Arellano, a. 57, r. 36.
2011. Ancona. Fr. Giancarlo M. Gregori, presb., a. 81, r. 59.
28. Viol. Feria III post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Is 55, 10-11; Ps 33, 4-5. 6-7. 16-17. 18-19.
Ev Mt 6, 7-15.
ANNIVERSARIA
1966. Torino. Fr. Bartolomeo M. Botta, presb., a. 57, r. 38.
1984. Ciudad Juárez. Fr. Bernardo M. Cabral Lamas, a. 72,
r. 25.
62
TEMPUS QUADRAGESIMAE
1999. Vicenza. Fr. Giacinto M. Evarelli, presb., a. 86, r. 69.
2004. Gelsenkirchen-Buer. Fr. Amideus M. Wickers, presb., a. 87,
r. 60.
2008. Siteki. Fr. Aaron M. Ginindza, presb., a. 54, r. 31.
29. Viol. Feria IV post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ion 3, 1-10; Ps 50, 3-4. 12-13. 18-19.
Ev Lc 11, 29-32.
MARTIUS 2012
1. Viol. Feria V post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Est 4, 17 n. p-r. aa-bb. gg-hh; (Vulg. 14, 1. 3-5. 12-14);
Ps 137, 1-2a. 2bc-3. 7c-8.
Ev Mt 7, 7-12.
ANNIVERSARIA
1976. Roma. Fr. Mario M. Pomponi, a. 41, r. 23.
2004. Lemont. Fr. Mark M. Dennehy, a. 85, r. 66.
2. Viol. Feria VI post dom. I Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ez 18, 21-28; Ps 129, 1-2. 3-4ab. 4c-6. 7-8.
Ev Mt 5, 20-26.
1964.
1981.
1983.
1986.
2006.
2009.
ANNIVERSARIA
Volders. Fr. Romedius M. Hackl, presb., a. 64, r. 46.
Milano. Fr. Giacinto M. Castello, presb., a. 56, r. 38.
Oak Park. Fr. John M. Boland, presb., a. 69, r. 50.
Rivoli. Fr. Anselmo M. Arneodo, presb., a. 58, r. 36.
Chicago. Fr. John M. Dowd, presb., a. 63, r. 43.
Mylapore. Fr. John Kennedy M. Anthonysamy, a. 22, nov.
9 mensis.
3. Viol. Sabb. post dom. I Quadr. (hebd. I Psalt.).
De eo.
64
TEMPUS QUADRAGESIMAE
MISSA pr., pf. Quadr.
L 1 Deut 26, 16-19; Ps 118, 1-2. 4-5. 7-8.
Ev Mt 5, 43-48.
I VESPERAE dom. II Quadr. – Cp. post I Vp. dom.
1968.
1973.
1980.
1992.
1999.
2007.
ANNIVERSARIA
Udine. Fr. Virginio M. Sabbadin, presb., a. 52, r. 33.
Roma. Fr. Paolo M. Poscolieri, presb., a. 59, r. 42.
Berwyn. Fr. Paul M. Sullivan, a. 78, r. 39.
Milano. Fr. Bernardino M. De Tomasi, presb., a. 82, r. 64.
Budapest. Fr. Bonajunkta M. Váry, presb., a. 86, r. 65.
Bologna. Fr. Attilio M. Repele, presb., a. 67, r. 49.
4. Viol. DOM. II IN QUADRAGESIMA (Hebd. II
Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Gen 22, 1-2. 9a. 10-13. 15-18; Ps 115, 10 et 15.
16-17. 18-19.
L 2 Rom 8, 31b-34.
Ev Mc 9, 2-10.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequialis.
S. Casimiri memoria omittitur.
II VESPERAE dom. II Quadr. – Cp. post II Vp. dom.
ANNIVERSARIA
1977. Pesaro. Fr. Edoardo M. Goffo, presb., a. 48, r. 30.
1982. Figline Valdarno. Fr. Giuseppe M. Venturi, a. 84, r. 53.
MARTIUS 2012
65
1992. Chicago. Fr. Daniel M. O’Malley, presb., a. 70, r. 50.
1994. Sondrio. Fr. Eugenio M. Mottes, a. 73, r. 54.
1996. Negrar. Fr. Pellegrino M. Schirato, presb., a. 82, r. 66.
5. Viol. Feria II post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Dan 9, 4b-10; Ps 78, 8. 9. 11 et 13.
Ev Lc 6, 36-38.
ANNIVERSARIA
1976. Foligno. Fr. Paolino M. Righi, a. 90, r. 62.
1987. Winnipeg. Fr. Ignatius M. O’Sullivan, presb., a. 97, r. 80.
6. Viol. Feria III post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Is 1, 10. 16-20; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mt 23, 1-12.
ANNIVERSARIA
2007. Fullerton. Fr. Jude M. Herlihy, presb., a. 76, r. 56.
2008. Todi. Fr. Emilio M. Bianchi, presb., a. 90, r. 74.
7. Viol. Feria IV post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 18, 18-20; Ps 30, 5-6. 14. 15-16.
Ev Mt 20, 17-28.
66
TEMPUS QUADRAGESIMAE
Fieri potest memoria Ss. Perpetuae et Felicitatis Mm., ut
pp. XXI-XXII notatur.
ANNIVERSARIA
1981. Firenze. Fr. Bonaventura M. Quieti, a. 84, r. 59.
1993. Negrar. Fr. Filippo M. De Pretto, a. 76, r. 56.
8. Viol. Feria V post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 17, 5-10; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 16, 19-31.
Fieri potest memoria S. Ioannis a Deo Rel., ut pp. XXI-XXII
notatur.
1972.
1986.
2001.
2008.
ANNIVERSARIA
Wien. Fr. Basil M. Wartbichler, presb., a. 87, r. 68.
Torino. Fr. Alessandro M. Baglione, presb., a. 76, r. 56.
Chicago. Fr. Walter M. Brennan, presb., a. 65, r. 45.
Celaya. Fr. José Francisco M. Pérez Macías, a. 65, r. 5.
9. Viol. Feria VI post dom. II Quadr. (hebd. II Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Gen 37, 3-4. 12-13a. 17b-28; Ps 104, 16-17. 18-19.
20-21.
Ev Mt 21, 33-43. 45-46.
Fieri potest memoria S. Franciscae Romanae Rel., ut pp.
XXI-XXII notatur.
MARTIUS 2012
1976.
1981.
1988.
1990.
67
ANNIVERSARIA
Melk. Fr. Cherubin M. Haas, presb., a. 75, r. 58.
Verona. Fr. Alberto M. Toniolo, presb., a. 78, r. 59.
Chicago. Fr. Raymond M. Coughlin, presb., a. 81, r. 62.
Santiago de Chile. Fr. Roberto M. Zanoni, a. 77, r. 53.
10. Viol. Sabb. post dom. II Quadr. (hebd. II Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Mic 7, 14-15. 18-20; Ps 102, 1-2. 3-4. 9-10. 11-12.
Ev Lc 15, 1-3. 11-32.
I VESPERAE dom. III Quadr. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Albuquerque. Fr. Luigi M. Flores, presb., a. 52, r. 26.
1991. Roma. Fr. Marco M. Aldrovandi, presb., a. 64, r. 44.
11. Viol. DOM. III IN QUADRAGESIMA (Hebd. III
Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 Ex 20, 1-17 vel 20, 1-3. 7-8. 12-17; Ps 18, 8. 9. 10. 11.
L 2 1 Cor 1, 22-25.
Ev Io 2, 13-25.
Adhibeatur PE cum praefatione variabili.
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
68
TEMPUS QUADRAGESIMAE
L 1 Ex 17, 1-7; Ps 94, 1-2. 6-7. 8-9.
L 2 Rom 5, 1-2. 5-8.
Ev Io 4, 5-42.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. III Quadr. – Cp. post II Vp. dom.
ANNIVERSARIA
1970. Vicenza. Fr. Gabriele M. Cola, presb., a. 55, r. 37.
2008. Firenze. Fr. Tarcisio M. Caterini, presb., a. 84, r. 67.
12. Viol. Feria II post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 2 Reg 5, 1-15a; Ps 41, 2. 3; 42, 3. 4.
Ev Lc 4, 24-30.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium Samaritana,
hac ratione:
L 1 Ex 17, 1-7; Ps 94, 1-2. 6-7. 8-9.
Ev Io 4, 5-42.
Et dicitur praef. dom. Evangelio respondens.
1975.
1984.
2001.
2004.
ANNIVERSARIA
Vicenza. Fr. Stefano M. Soliman, a. 65, r. 43.
San Diego. Fr. Alexis M. Gauthier, presb., a. 58, r. 37.
Nola. Fr. Pio M. Casciello, presb., a. 66, r. 45.
Taurano (Avellino). Fr. Giovanni M. Colello, presb., a. 74,
r. 51.
13. Viol. Feria III post dom. III Quadr. (hebd. III Psalt.).
De ea.
MARTIUS 2012
69
MISSA pr., pf. Quadr.
L 1 Dan 3, 25. 34-43; Ps 24, 4bc-5ab. 6-7bc. 8-9.
Ev Mt 18, 21-35.
ANNIVERSARIA
1972. Stegi. Fr. Luigi M. Ruggeri, presb., a. 64, r. 47.
1995. Chicago. Fr. Bonaventure M. Verwiel, presb., a. 84, r. 64.
14. Viol. Feria IV post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Deut 4, 1. 5-9; Ps 147, 12-13. 15-16. 19-20.
Ev Mt 5, 17-19.
1974.
1994.
2000.
2005.
ANNIVERSARIA
Roma. Fr. György M. Szücs, a. 65, r. 43.
Anaheim. Fr. Alexis M. Olguín, a. 81, r. 60.
Anaheim. Fr. Mel M. Corcoran, presb., a. 82, r. 63.
Turvo. Fr. Giovanni M. Palmieri, presb., a. 86, r. 67.
15. Viol. Feria V post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ier 7, 23-28; Ps 94, 1-2. 6-7. 8-9.
Ev Lc 11, 14-23.
1979.
1983.
1994.
2003.
2007.
ANNIVERSARIA
Venezia. Fr. Bonfiglio M. Rizzardini, a. 69, r. 50.
Firenze. Fr. Basilio M. Meoni, presb., a. 68, r. 51.
Torino. Fr. Carlo M. Zanetta, presb., a. 75, r. 59.
Magog. Fr. Raphaël M. De Luca, a. 88, r. 65.
Peralta. Fr. Albert M. Gallegos, presb., a. 70, r. 49.
70
TEMPUS QUADRAGESIMAE
16. Viol. Feria VI post dom. III Quadr. (hebd. III Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Os 14, 2-10; Ps 80, 6c-8a. 8bc-9. 10-11ab. 14 et 17.
Ev Mc 12, 28b-34.
DIES ORDINIS SAECULARIS SERVORUM SANCTAE MARIAE
(OSSM)
Die 16 martii 1424, Summus Pontifex Martinus V,
bulla Sedis apostolicae, Regulam Tertii Ordinis Servo-
rum Mariae omnibus servandam sodalibus Consortii
seu Societatis, tum appellabatur coetus laicorum qui
propositum profitebantur Servorum spiritualitatem
servandi in statu laicali. Nostris temporibus sodalium
laicorum coetui datus est titulus Ordo Saecularis Servo-
rum sanctae Mariae.
Omnes Servi et Servae sanctae Mariae Dominum bea-
tamque Virginem exorent pro perseverantia et spirita-
li profectu Ordinis Saecularis.
ANNIVERSARIA
1993. Chicago. Fr. Anselm M. Dennehy, presb., a. 73, r. 52.
17. Viol. Sabb. post dom. III Quadr. (hebd. III Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Os 6, 1-6; Ps 50, 3-4. 18-19. 20-21ab.
Ev Lc 18, 9-14.
Fieri potest memoria S. Patricii E., ut pp. XXI-XXII notatur.
MARTIUS 2012
71
I VESPERAE dom. IV Quadr. – Cp. post I Vp. dom.
Hodie ad Vp. et crastino die (dom. Laetare) organa aliaque
instrumenta pulsari possunt.
In Hibernia:
16. I VESPERAE seq. – Cp. post I Vp. dom.
17. Alb. Sabb. S. PATRICII E., HIBERNIAE PATRONI
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, Credo, lect. pr., pf. pr.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1985. Portland. Fr. Augustine M. Holloway, presb., a. 75, r. 51.
2001. Ottawa. Fr. Daniel M. Cruickshank, presb., a. 52, r. 32.
18. Viol. vel Ros. DOM. IV IN QUADRAGESIMA
(Hebd. IV Psalt.).
De ea.
© MISSA pr., Credo, pf. Quadr.
L 1 2 Chron 36, 14-16. 19-23; Ps 136, 1-2. 3. 4-5. 6.
L 2 Eph 2, 4-10.
Ev Io 3, 14-21.
Adhibeatur PE cum praefatione variabili.
72
TEMPUS QUADRAGESIMAE
MARTIUS 2012
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
L 1 1Sam 16, 1b. 6-7. 10-13a; Ps 22, 1-3a. 3b-4. 5. 6.
L 2 Eph 5, 8-14.
Ev Io 9, 1-41 vel brevior 1. 6-9. 13-17. 34-38.
Prohibentur aliae celebrationes necnon Missa exsequialis.
S. Cyrilii Hierosolymitani E.D. memoria omittitur.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Addolorata (Chioggia), hanc diem qua anno 1873, p.
Aemilius Venturini (1842-1905), e Congregatione
Oratorii, una cum matre Elisa Sambo (1816-1897),
Instituti iecit fundamenta, tamquam Diem Congrega-
tionis celebrat. Anno 1918 die 12 februarii Congre-
gatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deo gratias agant et pro bono atque incremen-
to Instituti fraternas effundant preces.
II VESPERAE dom. IV Quadr. – Cp. post II Vp. dom.
19. Alb. Feria II. S. IOSEPH, SPONSI B. MARIAE V.
ET COMPATRONI O. N., sollemnitas. – Ad H. m.
ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, Credo, pf. pr. Et te in sollemnitate.
L 1 2 Sam 7, 4-5a. 12-14a. 16; Ps 88, 2-3. 4-5. 27 et 29.
L 2 Rom 4, 13. 16-18. 22.
Ev Mt 1, 16. 18-21. 24a vel Lc 2, 41-51a.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, item prohibentur
Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
73
1962.
1969.
1975.
1977.
1987.
1988.
ANNIVERSARIA
Alessandria. Fr. Giuseppe M. Olivero, presb., a. 75, r. 59.
London. Fr. Joseph M. Tucker, presb., a. 70, r. 52.
Vicenza. Fr. Pellegrino M. Contessa, presb., a. 88, r. 68.
Torino. Fr. Alessio M. Cattilino, presb., a. 60, r. 29.
Valencia. Fr. Miguel M. Martínez Escribano, a. 66, r. 31.
Puerto Aysén. Fr. Marcello M. Frasson, presb., a. 61, r. 43.
20. Viol. Feria III post dom. IV Quadr. (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
In Belgio, in Canada et in Provincia Tirolensi:
Sollemnitas S. JOSEPH celebratur quoque ut Patroni prin-
cipalis totius Nationis.
L 1 Ez 47, 1-9. 12; Ps 45, 2-3. 5-6. 8-9.
Ev Io 5, 1-16.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium caeco nato,
hac ratione:
74
TEMPUS QUADRAGESIMAE
L 1 Mic 7, 7-9; Ps 26, 1. 7-8a. 8b-9abc. 13-14.
Ev Io 9, 1-41.
Et dicitur praef. dom. Evangelio respondens.
MARTIUS 2012
75
1973. Rochester. Fr. Jérôme M. De Pencier, presb., a. 86, r. 69.
1992. La Ferté Macé. Fr. Joseph M. Lefebvre, presb., a. 86, r. 45.
ANNIVERSARIA 23. Viol. Feria VI post dom. IV Quadr. (hebd. IV Psalt.).
Denver. Fr. Stanislao M. Giambastiani, presb., a. 78, De ea.
r. 62.
Milano. Fr. Giuliano M. Cossettini, presb., a. 60, r. 37.
Siteki. Fr. Bonifaz M. Schneider, a. 84, r. 60.
Vicenza. Fr. Pietro M. Sella, presb., a. 83, r. 63.
Negrar. Fr. Ildebrando M. Pellanda, a. 86, r. 68.
21. Viol. Feria IV post dom. IV Quadr. (hebd. IV Psalt.). ANNIVERSARIA
De ea. 1981. Bognor Regis. Fr. Anselm M. Hislop, presb., a. 88, r. 67.
1998. Dinazzano. Fr. Alberto M. Morini, presb., a. 75, r. 57.
1966.
1975.
1984.
1984.
2005.
MISSA pr., pf. Quadr.
L 1 Is 49, 8-15; Ps 144, 8-9. 13cd-14. 17-18.
Ev Io 5, 17-30.
ANNIVERSARIA
1986. São José dos Campos. Fr. Dionisio M. Testi, presb., a. 70,
r. 54.
2009. Firenze. Fr. Giuliano M. Geppetti, presb., a. 83, r. 66.
22. Viol. Feria V post dom. IV Quadr. (hebd. IV Psalt.).
De ea.
MISSA pr., pf. Quadr.
L 1 Ex 32, 7-14; Ps 105, 19-20. 21-22. 23.
Ev Io 5, 31-47.
ANNIVERSARIA
1961. Ladysmith. Fr. Philip M. Lewis, presb., a. 72, r. 52.
MISSA pr., pf. Quadr.
L 1 Sap 2, 1a. 12-22; Ps 33, 17-18. 19-20. 21 et 23.
Ev Io 7, 1-2. 10. 25-30.
Fieri potest memoria S. Turibii de Mogrovejo E., ut pp.
XXI-XXII notatur.
24. Viol. Sabb. post dom. IV Quadr. (hebd. IV Psalt.).
De eo.
MISSA pr., pf. Quadr.
L 1 Ier 11, 18-20; Ps 7, 2-3. 9bc-10. 11-12.
Ev Io 7, 40-53.
I VESPERAE dom. V Quadr. – Cp. post I Vp. dom.
Usus cooperiendi cruces et imagines per ecclesiam servari
potest, de iudicio Conferentiae Episcoporum. Cruces vela-
tae manent usque ad expletam celebrationem Passionis
Domini, feria VI Hebdomadae Sanctae, imagines vero
usque ad initium Vigiliae paschalis.
ANNIVERSARIA
1974. Ladysmith. Fr. Charles M. Feeney, presb., a. 84, r. 65.
76
TEMPUS QUADRAGESIMAE
25. Viol. DOM. V IN QUADRAGESIMA (Hebd. I Psalt.).
De ea.
© MISSA pr., Credo, pf. I Pass.
L 1 Ier 31, 31-34; Ps 50, 3-4. 12-13. 14-15.
L 2 Hebr 5, 7-9.
Ev Io 12, 20-33.
MARTIUS 2012
1966.
1968.
1975.
1982.
1993.
2003.
77
ANNIVERSARIA
Innsbruck. Fr. Pius M. Kreuzer, presb., a. 53, r. 35.
Arezzo. Fr. Manetto M. Caiani, presb., a. 62, r. 43.
San Francisco. Fr. Andrew M. Colletti, presb., a. 50, r. 30.
Vicenza. Fr. Ignazio M. Faccin, presb., a. 83, r. 65.
Dublin. Fr. Joseph M. Madden, presb., a. 63, r. 42.
Ubombo. Fr. Thomas M. Carroll, presb., a. 78, r. 52.
Adhibeatur PE cum praefatione variabili.
Adhiberi possunt, loco praecedentium, lectiones cycli A;
quo in casu dicitur etiam praefatio propria.
L 1 Ez 37, 12-14; Ps 129, 1-2. 3-4ab. 4c-6. 7-8.
L 2 Rom 8, 8-11.
Ev Io 11, 1-45 vel brevior 3-7. 17. 20-27. 33b-45.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. V Quadr. – Cp. post II Vp. dom.
DIES INSTITUTI
Institutum saeculare cui est titulus Servite Secular
Institute, a fratre Gerard M. Corr (†2000) et Joan
Bartlett (†2002), pia iuvene, fundatum et die 25 mar-
tii 1979 ab Apostolica Sede probatum, hodiernam
diem, qua anno 1964 die 28 maii Ordini nostro est
aggregatum, tamquam Diem Instituti festive celebrat.
Omnes fratres et sorores Servorum Ordinis cum in
matutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini gratias
referant et pro bono et incremento Instituti enixe
supplicent.
26. Alb. Feria II. IN ANNUNCIATIONE DOMINI,
sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 7, 10-14; 8, 10; Ps 39, 7-8a. 8b-9. 10. 11.
L 2 Hebr 10, 4-10.
Ev Lc 1, 26-38.
Ad verba symboli Et incarnatus … factus est genuflecten-
dum est, uno genu si recitentur, utroque si canantur (IM,
137).
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes necnon Missa exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
1975.
1979.
1980.
2001.
2003.
2005.
ANNIVERSARIA
London. Fr. Alexis M. Halle, a. 91, r. 65.
Montréal. Fr. Ignazio M. Patriarchi, presb., a. 86, r. 70.
Albuquerque. Fr. Gabriel M. Reisdorff, presb., a. 69, r. 44.
Verona. Fr. Flaviano M. Tabbia, presb., a. 77, r. 60.
Hochrum. Fr. Othmar M. Reitz, presb., a. 86, r. 48.
Monte Senario. Fr. Antonio M. Monaco, a. 79, r. 53.
78
TEMPUS QUADRAGESIMAE
27. Viol. Feria III post dom. V Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. I Pass.
L 1 Num 21, 4-9; Ps 101, 2-3. 16-18. 19-21.
Ev Io 8, 21-30.
In feria opportuniore huius hebdomadae, ad catechesim
baptismalem fovendam, legi potest Evangelium de Lazaro,
hac ratione:
L 1 2 Reg 4, 18b-21. 32-37; Ps 16, 1. 6-7. 8b et 15.
Ev Io 11, 1-45.
Et dicitur praef. dom. Evangelio respondens.
ANNIVERSARIA
1996. Saint-Jean sur Richelieu. Fr. Laurent M. Lussier, presb.,
a. 78, r. 58.
28. Viol. Feria IV post dom. V Quadr. (hebd. I Psalt.).
De ea.
MISSA pr., pf. I Pass.
L 1 Dan 3, 14-20. 91-92. 95; Ps Dan 3, 52. 53. 54. 55. 56.
Ev Io 8, 31-42.
ANNIVERSARIA
1987. Milano. Fr. Basilio M. Cecchin, presb., a. 75, r. 57.
1993. Negrar. Fr. Amadio M. Serafini, a. 75, r. 55.
29. Viol. Feria V post dom. V Quadr. (hebd. I Psalt.).
De ea.
MARTIUS 2012
79
MISSA pr., pf. I Pass.
L 1 Gen 17, 3-9; Ps 104, 4-5. 6-7. 8-9.
Ev Io 8, 51-59.
ANNIVERSARIA
1983. Udine. Fr. Giustino M. Gugole, presb., a. 86, r. 67.
1985. Santiago de Chile. Fr. Eduardo M. Ulriksen Mendía,
a. 33, r. 7.
C C
ANNUS A SUSCEPTO OPERE REPARATIONIS MARIANAE ANNUS AB ADVENTU IN REGIONEM CANADENSEM
IN CONGREGATIONE SERVARUM MARIAE «RIPARATRICI» SERVORUM SANCTAE MARIAE
Hodie (die 29 martii) recolitur centesimus dies anniversarius suscepti ope- Anno 1912, die 29 martii, pervenerunt in urbem Montréal (Canada)
ris reparationis marianae a Congregatione Servarum Mariae a Vidor primi fratres Servi Mariae a Provincia Tusciae: fr. Ildephonsus M.
(Tarvisium). Opus reparationis institutum est anno 1895 a M. Dolores Francesconi (+1952), fr. Angelicus M. Barsi (+1949), fr. Aurelius M.
Inglese (+1928), pia iuvene quae anno 1912 in Congregationem ingressa est. Prosperi (+1971), quibus commissa est cura parroeciae vulgo nuncu-
Opus a Romanis Pontificibus Leone III (+1903), Pio X (+1914), Benedicto patae «Notre-Dame de la Défense» (Madonna della Difesa). Fratres
XV (+1922) approvatum, in conpluribus regionibus est diffusum. Servi Mariae manserunt in illa parroecia usque ad annum 2002.
Oggi (29 marzo) riccorre il primo centenario dell’assunzione dell’opera di Il 29 marzo 1912, provenienti dalla Provincia toscana, giunsero a
riparazione mariana da parte della Congregazione delle Serve di Maria di Montréal (Canada) i primi fratri Servi di Maria, provenienti dalla pro-
Vidor (Treviso). L’opera di riparazione era stata istituita nel 1895 da M. vincia Toscana: fra Ildefonso M. Francesconi (+1952), fra Angelico
Dolores Inglese (+1928); essa entrò a far parte della Congregazione delle M. Barsi (+1949) e fra Aurelio M. Prosperi (+1971). Ad essi fu affi-
Serve di Maria «Riparatrici» nel 1912. L’opera fu approvata dai Sommi data la parrocchia della Madonna della Difesa, nella quale i Servi di
Pontefici Leone XIII (+1903), Pio X (+1914) e Benedetto XV (+1922), e Maria rimasero fino all’anno 2002.
si diffuse in molti paesi.
Today (29 March) is the first centenary of the Congregation of the Sister On 29 March, 1912, the first friar Servants of Mary, coming from the
Servants of Mary of Vidor (Treviso) taking up the work of Marian repara- Tuscan Province, arrived in Montréal (Canada): fra Ildefonso M.
tion. The work of reparation was begun in 1895 by M. Dolores Inglese Francesconi (+1952), fra Angelico M. Barsi (+1949) and fra Aurelio
(+1928) who entered the Congregation of the Sister Servants of Mary M. Prosperi (+1971). The parish of «Notre-Dame de la Défense»
«Riparatrici» in 1912. The work was approved by Popes Leo XIII (+1903), (Madonna della Difesa) was entrusted to them and the Servants of
Pius X (+1914) and Benedict XV (+1922), and spread to many countries. Mary remained there until 2002.
82
TEMPUS QUADRAGESIMAE
30. Rub. vel Alb. Feria VI post dom. V Quadr. B. MARIAE
VIRGINIS IUXTA CRUCEM, festum. – Ad H. m.
ant. et pss. feriae VI hebd. I.
MISSA pr., Gloria, sequentia ad libitum, lect. pr., pf. pr.
L 1 Rom 8, 31b-39 vel Gen 22, 1-2. 6. 9-13. 15-18;
Ps 17, 2-3. 5-7. 19-20.
Ev Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1989. Chicago. Fr. James M. Doyle, presb., a. 78, r. 58.
31. Viol. Sabb. post dom. V Quadr. (hebd. I Psalt.).
De eo.
MISSA pr., pf. I Pass.
L 1 Ez 37, 21-28; Ps Ier 31, 10. 11-12ab. 13.
Ev Io 11, 45-56.
ANNIVERSARIA
1970. London. Fr. Cyril M. Tucker, presb., a. 67, r. 48.
1977. Düsseldorf. Fr. Martin M. Rose, presb., a. 67, r. 42.
HEBDOMADA SANCTA
Notanda pro Hebdomada sancta
Ritus Hebdomadae sanctae, idest benedictio et processio palma-
rum, repositio Ss.mi Sacramenti post Missam in Cena Domini,
Actio liturgica feriae VI in Passione Domini et Vigilia paschalis,
celebrari possunt in omnibus ecclesiis et oratoriis publicis et
semipublicis. Expedit tamen ut in ecclesiis quae non sunt paroe-
ciales et in oratoriis celebrentur tantummodo si digne peragi
possunt, idest cum congruo numero ministrorum, cum facul-
tate exsequendi saltem aliquas partes cum cantu, et cum suffi-
cienti frequentia fidelium. Secus, expedit ut huiusmodi celebra-
tiones in ecclesiis tantum paroecialibus aliisque ecclesiis maiori-
bus persolvantur. Expedit quoque ut de hac re normae pecu-
liares a competenti auctoritate ecclesiastica tradantur.
Notanda pro dominica in palmis de Passione Domini
1. In Officio divino, ad benedictionem et processionem pal-
marum, et in omnibus Missis huius dominicae adhibentur
sacrae vestes coloris rubri.
2. In omnibus Missis huius dominicae fit memoria ingressus
Domini in Ierusalem, et quidem per processionem vel introi-
tum sollemnem ante Missam principalem, per introitum sim-
plicem ante alias Missas. Introitus tamen sollemnis, non vero
processio, iterari potest ante unam alteramve Missam, quae
cum magno populi concursu celebrari solet.
3. Expedit processionem haberi ab ecclesia minore, vel alio
loco apto, ad ecclesiam in qua Missa celebrabitur. In proces-
sione sacerdos induit casulam vel pluviale.
84
TEMPUS QUADRAGESIMAE
4. Post processionem vel introitum sollemnem, omittuntur
signum crucis et actus paenitentialis vel aspersio aquae bene-
dictae initio Missae, et dicitur statim collecta. Missa deinde
prosequitur more solito.
5. Solam autem benedictionem palmarum, absque subse-
quenti processione et Missa celebrare non licet.
6. Historia Passionis Domini legitur absque luminaribus et
absque incenso sine salutatione et signatione libri. Legitur
autem a diacono vel, ipso deficiente, a sacerdote. Legi potest
etiam a laicis lectoribus, parte Christi, si fieri potest, sacerdoti
reservata. Diaconi, non autem alii, ante lectionem Passionis,
dicunt Munda cor meum, petunt benedictionem sacerdotis, ut
alias ante Evangelium. In fine dicitur: Verbum Domini, sed
osculum libri omittitur.
MARTIUS 2012
31. Rub. Sabb.
I VESPERAE dom. in palmis. – Cp. post I Vp. dom.
APRILIS 2012
APRILIS 2012
1. Rub. DOMINICA IN PALMIS DE PASSIONE
DOMINI (Hebd. II Psalt.).
De ea.
Ante processionem:
Ev Mc 11, 1-10.
© MISSA pr., Credo, pf. pr.
L 1 Is 50, 4-7; Ps 21, 8-9. 17-18a. 19-20. 23-24.
L 2 Phil 2, 6-11.
Ev Mc 14, 1 – 15, 47 vel 15, 1-39.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
87
Prohibentur aliae celebrationes, excepta Missa exsequialis.
S. Francisci de Paola Er. memoria omittitur.
1986.
1993.
1997.
2005.
ANNIVERSARIA
Nagyszakácsi. Fr. Alois M. Németh, presb., a. 73, r. 52.
Siracusa. Fr. Angelo M. Pantano, presb., a. 72, r. 53.
Bologna. Fr. Aldo M. Sartoni, a. 84, r. 47.
Città del Vaticano. Pp. Ioannes Paulus II, a. 84, p. 26.
3. Viol. FERIA III HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 49, 1-6; Ps 70, 1-2. 3-4a. 5-6ab. 15 et 17.
Ev Io 13, 21-33. 36-38.
II VESPERAE dom. in palmis. – Cp. post II Vp. dom. Prohibentur aliae celebrationes, excepta Missa exsequialis.
Crastina die anniversarium recurret piae mortis Ioannis ANNIVERSARIA
Pauli Pp. II (2005). 1967. Bologna. Fr. Pellegrino M. Quarenghi, presb., a. 57, r. 39.
ANNIVERSARIA
1967. Napoli. Fr. Tommaso M. Bartolomei, presb., a. 77, r. 61.
2005. Chicago. Fr. Bernard M. Barnes, presb., a. 84, r. 63.
2. Viol. FERIA II HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 42, 1-7; Ps 26, 1. 2. 3. 13-14.
Ev Io 12, 1-11.
4. Viol. FERIA IV HEBDOMADAE SANCTAE
(II Psalt.).
De ea.
MISSA pr., pf. II Pass.
L 1 Is 50, 4-9a; Ps 68, 8-10. 21bcd-22. 31 et 33-34.
Ev Mt 26, 14-25.
Prohibentur aliae celebrationes, excepta Missa exsequialis.
S. Isidori E.D. memoria omittitur.
88
TEMPUS QUADRAGESIMAE
5. Viol. FERIA V HEBDOMADAE SANCTAE
(II Psalt.).
De ea. – Ad. Off. lect. dici potest ps. 68 Salvum me
fac, Deus (e feria VI hebd. III) cum suis ant., cum de
Passione Domini loquatur.
Advertenda.
1. Hodie permittuntur tantum Missa chrismatis et Missa
in Cena Domini, secundum ea quae infra dicentur. Prohi-
bentur Missae exsequiales.
2. Missa chrismatis, quam episcopus cum suo presbyterio
concelebrat, et in qua olea sacra benedicuntur, est velut
manifestatio communionis presbyterorum cum proprio
episcopo.
Ad hanc vero Missam congregantur et in ea concelebrant
presbyteri, quippe in conficiendo chrismate testes et coope-
ratores sui Episcopi, cuius sacri muneris in populo Dei exs-
truendo, sanctificando et regendo sunt participes, sicque
nitide manifestatur unitas sacerdotii et sacrificii Christi in
Ecclesia perseverantis.
Quo melius autem significetur unitas presbyteri, adsint e
diversis regionibus dioecesis presbyteri concelebrantes.
Qui vero forte non concelebrant, in hac Missa chrismatis
sub utraque specie communicare possunt.
3. Missa chrismatis celebratur cum vestibus coloris albi
atque in ea dic. Gloria et pf. pr.
L 1 Is 61, 1-3a. 6a. 8b-9; Ps 88, 21-22. 25 et 27.
L 2 Apoc 1, 5-8.
Ev Lc 4, 16-21.
APRILIS 2012
89
4. Sumantur et ad ecclesias dioecesis deferantur nova olea
benedicta; vetera comburantur vel in lampadem SS.
Sacramenti iniciantur.
5. Infirmis hodie Communio quamvis diei hora deferri
potest. Ceteri fideles communicare possunt tantum ad
Missam chrismatis et ad Missam in Cena Domini. Qui
mane communicaverunt, iterum SS. Eucharistiam ad
Missam vespertinam sumere possunt.
6. In triduo paschali prohibentur omnes aliae celebra-
tiones necnon Missae defunctorum, etiam exsequiales.
APRILIS 2012
TRIDUUM PASCHALE
Cum humanae redemptionis et perfectae Dei glorifica-
tionis opus adimpleverit Christus praecipue per suum
paschale mysterium, quo mortem nostram moriendo
destruxit et vitam resurgendo reparavit, sacrum
paschale triduum Passionis et Resurrectionis Domini
uti totius anni liturgici culmen effulget (AC, 18).
APRILIS 2012
5. Alb. FERIA V HEBDOMADAE SANCTAE. –
Vespere MISSA (Alb.) vespertina IN CENA DOMINI pr.,
Gloria, pf. Euch., in Canone romano Comm., Hanc
igitur et Qui pridie pr.
L 1 Ex 12, 1-8. 11-14; Ps 115, 12-13. 15-16bc. 17-18.
L 2 1 Cor 11, 23-26.
Ev Io 13, 1-15.
Adhibeatur PE cum praefatione variabili.
91
horis matutinis, sed tantummodo pro fidelibus qui nullo
modo Missam vespertinam participare valent. Caveatur
tamen ne huiusmodi celebrationes in bonum privatorum
fiant et ne praeiudicio sint Missae vespertinae principali.
3. Sacerdotes qui in Missa chrismatis aut ad utilitatem
fidelium iam celebraverint, denuo concelebrare valent in
Missa vespertina.
Item fideles qui in Missa chrismatis iam communicave-
rint, iterum communicare possunt in Missa in Cena
Domini.
4. Tabernaculum vacuum sit; pro communione cleri et
populi hodie et crastina die particulae consecrentur in hac
Missa.
5. Dum cantatur Gloria pulsantur campanae, eoque
expleto, silent usque ad Vigiliam paschalem, nisi Confe-
rentia Episcoporum vel Episcopus dioecesis, pro opportu-
nitate, aliud statuerit.
Animadvertenda. 6. Expleta celebratione huius diei, altare privatim denuda-
tur et auferuntur, si fieri potest, cruces ab ecclesia. Expedit
ut cruces, quae forte in ecclesia remanent, velentur, nisi
iam velatae sint ex praescripto Conferentiae Episcoporum.
1. Missa in Cena Domini celebranda est vespere, hora 7. Moneantur fideles, ut per congruum noctis tempus,
magis opportuna, cum plena participatione totius com- secundum locorum et rerum adiuncta, adorationem pera-
munitatis localis, sacerdotibus et ministris officium suum gant coram Ss.mo Sacramento asservato, ita tamen ut post
implentibus. mediam noctem haec adoratio absque sollemnitate fiat.
2. Ubi ratio pastoralis id postulet, loci Ordinarius alteram 8. Ubi, post Missa in Cena Domini, facta est repositio
Missam in ecclesiis et oratoriis permittere poterit, horis ves- Ss.mi Sacramenti, celebranda est quoque Actio liturgica
pertinis celebrandam, et, in casu verae necessitatis, etiam propria feriae VI in Passione Domini.
92
TRIDUUM PASCHALE
VESPERAE omittuntur ab iis, qui Missae vespertinae
intersunt.
Cp. post II Vp. dom.
Cras: Ieiunium et abstinentia.
S. Vicentii Ferrer P. memoria omittitur.
ANNIVERSARIA
1985. Perugia. Fr. Silverio M. Ercoli, presb., a. 63, r. 45.
1998. Ancona. Fr. Alfonso M. Baccarani, presb., a. 75, r. 57.
6. Rub. FERIA VI IN PASSIONE DOMINI.
De ea. Officium divinum cum peculiaritatibus in
Proprio indicatis.
Valde convenit ut hodie et cras Off. lect. et Ld. sol-
lemniter cum populo celebrentur (IH, 210).
CELEBRATIO PASSIONIS DOMINI, ut in Missali.
L 1 Is 52, 13 – 53, 12;
Ps 30, 2 et 6. 12-13. 15-16. 17 et 25.
L 2 Hebr 4, 14-16; 5, 7-9.
Ev Io 18, 1 – 19, 42.
In ecclesiis Ordinis nostri, expleta Crucis adora-
tione, convenienter fit Celebratio memoriae
Compassionis beatae Mariae Virginis, secun-
dum ritum in novissima editione Proprii
Missarum O.S.M. (anno 1998) describitur.
APRILIS 2012
93
Advertenda.
1. Celebratio Passionis Domini agenda est horis postmeri-
dianis, et quidem circam horam nonam; si vero ratio pas-
toralis id suadeat, tardiore hora inchoari potest.
2. Sacerdos et diaconus vestes coloris rubri, sicut ad Missae
celebrationem, induunt, iam ab initio actionis liturgicae.
3. Altare omnino nudum sit: sine cruce, sine candelabris,
sine tobaleis; nullum tapetum et ornamentum adsit.
4. Iuxta antiquissimam traditionem, Ecclesia hac die
Eucharistiam non celebrat.
Sacra Communio fidelibus distribuitur unice inter cele-
brationem Passionis Domini; infirmis autem, qui hanc
celebrationem participare nequeunt, quacumque diei hora
deferri potest.
5. Hodie post crucis detectionem et cras usque ad Vigiliam
paschalem exclusive, cruci genuflectitur.
6. Pro lectione Passionis Domini, cf. ea quae in dominica
palmarum dicta sunt (p. 84, n. 6).
7. Crux quae populo ostenditur et adoranda praebetur sat
magna sit et eleganti manu sculpta. Formula autem ad
crucem ostendendam et responsio populi cantu profera-
tur. Unica tantum crux, ratione veritatis signi, adorationi
praebeatur; provideatur tamen ut singuli fideles crucem
adorare possint: quod magni momenti est in celebratione
huius diei. Ritus proinde in quo crux ab omnibus una
simul silentio adoratur, adhibeatur tantummodo si fideles
vere numerosiores celebrationem participant.
94
TRIDUUM PASCHALE
8. Post celebrationem Passionis Domini Ss.ma Eucharistia
reportatur, forma simplici, ad locum asservationis, et ibi-
dem custoditur, lampade de more accensa. Et privatim
denudatur altare, relictis tamen cruce et candelabris.
Praestat locum aptum parari (v. gr. sacellum in quo respo-
sitio et adoratio Sacramenti die praecedenti facta est) et
orationi et meditationi congruum, in quo crux deponatur
a fidelibus adoranda.
9. Magni fiant etiam pia populi pietatis exercitia, quae
momentum pastorale prae se ferunt, v. gr. Via crucis, pro-
cessiones de passione Domini, memoria dolorum B.
Mariae V.
Eorum textus et cantus cum liturgia congruant, immo ad
ipsam participandam fideles inducant.
VESPERAE ab iis, qui celebrationi Passionis Domini
interfuerunt, non dicuntur.
Cp. post II Vp. dom.
ANNIVERSARIA
2002. Montréal. Fr. Francesco M. Maddalena, a. 86, r. 57.
7. Viol. SABBATUM SANCTUM.
De eo. Officium proprium.
Hodie, ante Vigiliam pasch., sacra Communio deferri
potest tantum ut Viaticum.
Cp. dic. tantum ab iis qui Vig. pasch. non intersunt: Cp.
post II Vp. dom.; loco R. br. dicitur ant. Christus.
APRILIS 2012
95
Animadvertenda.
1. Sabbato Sancto Ecclesia ad sepulcrum Domini immo-
ratur, passionem eius et mortem necnon descensum ad
inferos meditando, eius resurrectionem ieiunio et oratione
expectando.
2. Valde commendatur celebratio Officii lectionis et Lau-
dum cum populi participatione. Quod si fieri non potest,
sacra habeatur verbi Dei celebratio aut aliud pium exerci-
tium mysterio huius diei respondens, praesertim in hono-
rem B. Mariae V. Filii sui passioni sociatae.
3. Fidelium venerationi in ecclesia proponi potest imago
Christi crucifixi aut in sepulcro depositi, aut imago eius
descensus ad inferos, quae mysterium Sabbati sancti illus-
tret, aut demum imago B. Virginis perdolentis.
4. Hac die Ecclesia ab Eucharistiae celebratione omnino
abstinet. Sacra Communio solummodo ad modum Viatici
dari potest. Matrimonii aliorumque sacramentorum, prae-
ter quam Paenitentiae et Unctionis infirmorum, celebratio
ne habeatur.
5. Fideles de peculiari natura huius diei erudiantur.
Celebritates vero festivae, quae cum Paschae celebratione
sabbato sancto olim anticipatae conectebantur, nocti et
diei Paschalis reserventur.
S. Ioannis Baptistae de la Salle P. memoria omittitur.
ANNIVERSARIA
1992. Ciriè. Fr. Alessandro M. Ongaro, presb., a. 68, r. 51.
1997. Denver. Fr. Benedetto M. Rori, presb., a. 82, r. 66.
2001. Curitiba. Fr. Agostino M. Poli, presb., a. 91, r. 73.
APRILIS 2012
TEMPUS PASCHALE
Quinquaginta die a dominica Resurrectionis ad
dominicam Pentecostes in laetitia et exsultatione
celebrantur sicut unus dies festus, immo «magna
dominica». Hi sunt dies in quibus praecipue can-
tatur Alleluia (AC, 22).
APRILIS 2012
Animadvertenda pro tempore paschali:
1. Cereus paschalis servatur apud altare vel apud ambo-
nem usque ad dom. Pentecostes inclusive.
2. In fine Cp. et loco Angelus Domini, dic. Regina caeli,
usque ad dom. Pentecostes inclusive.
8. Alb. DOMINICA PASCHAE IN RESURREC-
TIONE DOMINI, sollemnitas cum oct. Hodie Off.
lect. omittitur ab iis qui Vig. pasch. interfuerunt.
Animadvertenda de Vigilia paschali:
1. Ex antiquissima traditione, ista nox est observabilis
Domino, et Vigilia quae in ea celebratur, noctem sanctam
commemorando qua Dominus resurrexit, habetur ut
«mater omnium sanctarum vigiliarum». In ea enim Ecclesia
resurrectionem Domini vigilando exspectat, eamque sacra-
mentis initiationis christianae celebrat. Ipsi autem Vigiliae
indolem exspectationis adventus Domini eschatologici tra-
ditio christiana semper agnovit.
97
2. Tota celebratio Vigiliae paschalis peragitur nocte, ita ut
vel incipiatur post initium noctis, vel finiatur ante dilucu-
lum diei dominicae. Usus agendi Vigiliam paschalem
horis vespertinis in quibus Missae dominicae sabbato anti-
cipari solent, reprobandus est. Ita insuper tota celebratio
ordinanda est ut eius natura vigiliae protractae servetur.
3. Celebratio solius Missae sine ritibus Vigiliae paschalis
non permittitur.
4. Vigilia paschalis celebrari potest etiam in ecclesiis et
oratoriis ubi actiones liturgicae feriae V et feriae VI locum
non habuerunt, et omitti ubi praefatae actiones sacrae
celebratae sunt. At de praecepto est celebranda ubi fons
baptismalis adest.
5. Per totam actionem liturgicam sacri ministri induuntur,
sicut ad Missam, vestibus liturgicis albi coloris.
6. Vigilia huius noctis ita ordinatur, ut post breve lucerna-
rium (quod est prima pars huius Vigiliae) sancta Ecclesia
meditetur mirabilia, quae fecit Dominus Deus populo suo
ab initio, confisa verbo eius et promisso (pars secunda seu
liturgia verbi), usque dum, appropinquante die resurrectio-
nis, cum novis membris in baptismate renatis (pars tertia),
vocatur ad mensam, quam Dominus populo suo praepara-
vit per mortem et resurrectionem suam (quarta pars).
Tota Vigilia paschalis symbolis et ritibus perficitur, quae
amplitudine et dignitate ipsis consona peragi debent, ita ut
fideles eorum sensum attingere possint, monitionibus et
orationibus etiam insinuatum. Praestat praesertim fideles
brevi monitione introducere ad intelligendum sensum
typologicum lectionum Veteris Testamenti quae in Vigilia
proponuntur.
98
TEMPUS PASCHALE
7. Ad ignem benedicendum quantum fieri potest, loco
apto extra ecclesiam rogus paretur, cuius flamma revera
tenebras valeat dissipare et noctem illuminare.
8. Cereus paschalis, ad signi veritatem servandam, ex cera sit
confectus, integer, sat notabilis magnitudinis, singulis annis
renovandus: figuram enim Christi exprimere debet qui, vera
lux, mundum illuminat. Signis autem et verbis benedicatur
in libris liturgicis relatis, vel ab Episcoporum conferentia
statutis.
9. Praeconium pasch. annuntiari potest, ex necessitate,
etiam a cantore qui non sit diaconus; qui tamen benedic-
tionem a celebrante non accipit et omittit alteram partem
invitationis (Quapropter…) necnon salutationem Dominus
vobiscum.
Cani potest forma longiore vel forma breviore.
10. Legendae sunt saltem tres lectiones Veteris Testamenti,
et in casibus urgentioribus saltem duae; numquam omittenda
est lectio libri Exodi. En series lectionum huius Vigiliae:
L 1 Gen 1, 1 – 2, 2 vel 1, 1. 26-31a; Ps 103, 1-2a. 5-6. 10 et
12. 13-14. 24 et 35c vel Ps 32, 4-5. 6-7. 12-13. 20 et 22.
L 2 Gen 22, 1-18 vel 22, 1-2, 9a, 10-13, 15-18; Ps 15, 5
et 8. 9-10. 11.
L 3 Ex 14, 15 – 15, 1; Ps Ex 15, 1-2. 3-4. 5-6. 17-18.
L 4 Is 54, 5-14; Ps 29, 2 et 4. 5-6. 11 et 12a et 13b.
L 5 Is 55, 1-11; Ps Is 12, 2-3. 4bcd. 5-6.
L 6 Bar 3, 9-15. 32 – 4, 4; Ps 18, 8. 9. 10. 11.
L 7 Ez 36, 16-17a. 18-28; Ps 41, 3. 5bcd; 42, 3. 4 vel,
quando celebratur Baptisma, Is 12, 2-3. 4bcd. 5-6 vel
Ps 50, 12-13. 14-15. 18-19.
L 8 Rom 6, 3-11; Ps 117, 1-2. 16ab-17. 22-23.
Ev Mc 16, 1-7.
APRILIS 2012
99
11. Liturgia baptismalis Vigiliae paschalis plenitudinem
attingit cum adultorum, vel saltem parvulorum, baptis-
mus celebratur. Attamen, etsi baptismus non est celebran-
dus, in ecclesiis paroecialibus aqua baptismalis benedica-
tur; ubi vero neque fons est benedicendus, memoria bap-
tismi fiat benedictione aquae, qua post renovatas promis-
siones baptismales populus aspergitur.
12. Ad Missae evangelium proclamandum thus adhiberi
potest, sed luminaria non portantur.
13. Praestat plenitudinem signi eucharistici in Vigilia
paschali communione attingi, quae sub speciebus panis et
vini distribuatur. Ordinarii locorum opportunitatem et cir-
cumstantias huius concessionis perpendant et de iis normas
praebeant.
14. Missa Vigiliae est Missa paschalis dominicae Resurrec-
tionis. Qui celebrat vel concelebrat Missam noctis, potest
etiam Missam diei Paschalis celebrare vel concelebrare.
In ecclesiis Ordinis nostri, in fine Vigiliae paschalis,
convenienter fit Sollemnis salutatio Dominae nos-
trae, secundum ritum in novissima editione Proprii
Missarum O.S.M. (anno 1998) descriptum.
Alb. In MISSA VIGILIAE PASCHALIS, pf. I pasch. (in hac
positissimum nocte). In Can. rom. Comm. (noctem
sacratissimam) et Hanc igitur pr.
Adhibeatur PE cum praefatione variabili.
100
TEMPUS PASCHALE
© MISSA IN DIE pr., Gloria, sequentia, Credo, pf. I pasch.
(in hac potissimum die) et Hanc igitur pr.
L 1 Act 10, 34a. 37-43; Ps 117, 1-2. 16ab-17. 22-23.
L 2 Col 3, 1-4 vel 1 Cor 5, 6b-8.
Ev Io 20, 1-9 vel Mc 16, 1-7.
In Missa vespertina legi potest Lc 24, 13-35.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, et Missa exsequialis.
1. Missa diei Paschalis magna cum sollemnitate celebretur.
In ea, loco actus paenitentialis, aspersio fiat aquae (in
nocte) benedictae, ut baptismi memoria revocetur.
2. Cereus paschalis, apud ambonem vel apud altare collo-
candus, ibique toto tempore paschali servandus, in cele-
brationibus liturgici sollemnioribus huius temporis, idest
in Missa, in Laudibus et in Vesperis, accendatur, usque ad
dominicam Pentecostes.
3. Ubi viget, diligentissime servetur aut, si fieri potest,
inducatur usus celebrandi, die Paschae, Vesperas baptis-
males, in quibus, dum cantantur psalmi, fit processio ad
fontes (IH, 213).
Hodie et per totam oct. Cp. dom. (post I vel II
Vp.), ant. Haec dies, cum or. de Resurrectione, loco
Resp. br.
ANNIVERSARIA
2009. Ronzano. Fr. Ivo M. Paoloni, presb., a. 79, r. 61.
9. Alb. FERIA II INFRA OCT. PASCHAE.
APRILIS 2012
101
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 2, 14. 22-33; Ps 15, 1-2a et 5. 7-8. 9-10. 11.
Ev Mt 28, 8-15.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
ANNIVERSARIA
1965. Ferrara. Fr. Angelo M. Barsella, presb., a. 52, r. 34.
2000. Recanati. Fr. Donato M. Senigagliesi, a. 87, r. 60.
10. Alb. FERIA III INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 2, 36-41; Ps 32, 4-5. 18-19. 20 et 22.
Ev Io 20, 11-18.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
ANNIVERSARIA
1990. Nigel. Fr. Giulio M. Zini, presb., a. 86, r. 68.
2004. Negrar. Fr. Angelo M. Vedelago, presb., a. 81, r. 62.
2010. London. Fr. Patrick M. Carroll, presb., a. 57, r. 36.
11. Alb. FERIA IV INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
102
TEMPUS PASCHALE
L 1 Act 3, 1-10; Ps 104, 1-2. 3-4. 6-7. 8-9.
Ev Lc 24, 13-35.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
S. Stanislai E. M. memoria omittitur.
ANNIVERSARIA
1967. Innsbruck. Fr. Joseph M. Valentin, a. 80, r. 39.
1983. Siteki. Fr. Pietro M. Coser, a. 71, r. 41.
12. Alb. FERIA V INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 3, 11-26; Ps 8, 2a et 5. 6-7. 8-9.
Ev Lc 24, 35-48.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
13. Alb. FERIA VI INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 4, 1-12; Ps 117, 1-2 et 4. 22-24. 25-27a.
Ev Io 21, 1-14.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
S. Martini I Pp. M. memoria omittitur.
ANNIVERSARIA
1962. Rio de Janeiro. Ep. Antonio Giulio M. Mattioli, a. 59, r. 42.
1974. Pesaro. Fr. Giovanni M. Nanni, presb., a. 62, r. 45.
APRILIS 2012
103
1977. Chicago. Fr. David M. Motzny, presb., a. 51, r. 30.
1991. Bologna. Fr. Giovanni M. Ibatici, a. 68, r. 54.
1993. Vicenza. Fr. Giovannangelo M. Mazzocato, presb., a. 86,
r. 66.
2010. Montréal. Fr. Georges-Étienne M. Allard, presb., a. 85,
r. 51.
APRILIS 2012
L
ANNUS A TRANSITU FR. IULII M. MATTIOLI,
SERVI MARIAE, EPISCOPI
105
14. Alb. SABBATUM INFRA OCT. PASCHAE.
MISSA pr., cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia est ad libi-
tum et Credo om.
L 1 Act 4, 13-21; Ps 117, 1 et 14-15. 16ab-18. 19-21.
Ev Mc 16, 9-15.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
I VESPERAE dom. II Paschae. – Cp. post I vel II Vp.
dom.
Anno 1962, die 13 aprilis, in urbe Rio de Janeiro (Brasilia)
obiit fr. Iulius M. Mattioli, Servus Mariae, episcopus Praelatiae
«Acre e Purus» nuncupatae. Qui ab adventu in Brasiliam
(27.VI.1926) usque ad mortem illi regioni evangelizandae
impense incubuit. Eius corpus in ecclesiae cathedrali urbis Rio
Branco est conditum.
Il 13 aprile 1962, a Rio de Janeiro (Brasile) morì fra Giulio M.
Mattioli, servo di Maria, vescovo della prelazia dell’Acre e
Purús. Egli, fin dal suo arrivo (27.VI.1926), si dedicò instan-
cabilmente all’evangelizzazione di quella regione. Il suo corpo
riposa nella cattedrale di Rio Branco.
On 13 April 1962, fra Giulio M. Mattioli, Servant of Mary
and bishop of the Prelature of Acre and Purus, died in Rio de
Janerio (Brazil). Since his arrival (27.VI.1926), he dedicated
himself tirelessly to the evangelization of that region. His body
is laid to rest in the cathedral of Rio Branco.
15. Alb. In oct. Paschae. DOMINICA II PASCHAE
seu DE DIVINA MISERICORDIA.
De ea.
© MISSA pr. cum omnibus peculiaritatibus dom.
Resurrect. assignatis; attamen sequentia omitti potest.
Credo.
L 1 Act 4, 32-35; Ps 117, 2-4. 16ab-18. 22-24.
L 2 1 Io 5, 1-6.
Ev Io 20, 19-31.
Prohibentur aliae celebrationes, excepta Missa exsequiali.
II VESPERAE dom. II Paschae. – Cp. post I vel II Vp.
dom.
Per totum tempus paschale peculiaris ratio habeatur de
institutione mystagogica neophytorum (OICA, 235-239).
106
TEMPUS PASCHALE
Tempore paschali haec serventur:
1. In feriis non permittuntur Missae ad diversa, votivae aut
cotidianae defunctorum (IM, 337), nisi utilitas pastoralis id
requirat (IM, 333). Permittuntur tamen Missae de memo-
riis his diebus in Martyrologio inscriptis (IM, 316 b).
APRILIS 2012
107
17. Alb. Feria III post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 4, 32-37; Ps 92, 1ab. 1c-2. 5.
Ev Io 3, 7b-15.
2. In Missa unum Alleluia ant. ad introitum et ad commu- ANNIVERSARIA
nionem addatur, nisi iam adsit vel cum sensu verborum 1989. Nepean. Fr. Eric M. Renhas de Pouzet, presb., a. 80, r. 25.
repugnet. 2008. Chicago. Fr. Vincent M. O’Shea, presb., a. 95, r. 73.
3. In Off. Sanctorum (praesertim in Co. App. et Mm.) 18. Alb. Feria IV post dom. II Paschae (hebd. II Psalt.).
partes huic tempori propriae exstant.
4. In Off. Alleluia additur tantum ubi et quomodo indica-
tur. Partes propriae habentur in Ordinario.
ANNIVERSARIA
1984. Livorno. Fr. Giorgio M. Franci, presb., a. 71, r. 52.
16. Alb. Feria II post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 5, 17-26; Ps 33, 2-3. 4-5. 6-7. 8-9.
Ev Io 3, 16-21.
Cras recurret anniversarium electionis Benedicti Pp. XVI
(2005).
Oremus pro eo et pro universa Ecclesia.
MISSA feriae, pf. pasch.
L 1 Act 4, 23-31; Ps 2, 1-3. 4-6. 7-9.
Ev Io 3, 1-8.
1963.
1971.
1976.
2000.
2000.
ANNIVERSARIA
Turvo. Fr. Gregorio M. Dal Monte, presb., a. 72, r. 56.
Figline Valdarno. Fr. Aurelio M. Prosperi, presb., a. 85,
r. 68.
Montréal. Fr. Bruno M. Dely, presb., a. 62, r. 41.
Ancona. Fr. Enrico M. Battistella, diac., a. 85, r. 65.
Firenze. Fr. Michele M. Bari, presb., a. 86, r. 68.
ANNIVERSARIA
1962. Wien. Fr. Leopold M. Mungenast, presb., a. 75, r. 56.
1987. Albuquerque. Fr. Caspar M. Yost, presb., a. 87, r. 64.
1993. Chicago. Fr. Patrick M. Roche, presb., a. 89, r. 70.
19. Alb. Feria V post dom. II Paschae (hebd. II Psalt.).
MISSA feriae, pf. pasch.
L 1 Act 5, 27-33; Ps 33, 2 et 9. 17-18. 19-20.
Ev Io 3, 31-36.
108
TEMPUS PASCHALE
DIES MISSIONIS
Missio in regione Swaziland anno 1923, die 19 apri-
lis, in Praefecturam apostolicam erecta, hodie Diem
Missionis celebrat.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deum enixe exorent ut in illa regione Ecclesia in
dies floreat.
APRILIS 2012
109
21. Alb. Sabb. post dom. II Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb. Vel:
Alb. S. Anselmi E. D.
MISSA sabb., pf. pasch., vel MISSA memoriae, Temp.
pasch. vel de sancto, vel MISSA B. Mariae V., Temp.
pasch.
L 1 Act 6, 1-7; Ps 32, 1-2. 4-5. 18-19.
Ev Io 6, 16-21.
ANNIVERSARIA
1965.
1999.
2002.
2006.
Wien. Fr. Anselm M. Wimmer, presb., a. 65, r. 48.
Portland. Fr. Philip M. Brennan, presb., a. 84, r. 63.
Benburb. Fr. Gabriel M. Bracken, a. 75, r. 51.
Negrar. Fr. Matteo M. Novello, presb., a. 86, r. 66.
20. Alb. Feria VI post dom. II Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 5, 34-42; Ps 26, 1. 4. 13-14.
Ev Io 6, 1-15.
ANNIVERSARIA
1963.
1963.
1963.
1964.
1999.
Reggio Emilia. Fr. Bernardo M. Savi, presb., a. 77, r. 61.
Bologna. Fr. Amadio M. Piccinelli, presb., a. 66, r. 41.
Frohnleiten. Fr. Simeon M. Oberleitner, a. 84, r. 54.
Workingham. Fr. Joachim M. McCarthy, presb., a. 81, r. 63.
Manduria. Fr. Carmelo M. Padalino, presb., a. 75, r. 56.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 15: Beata Maria Virgo in resurrectione Domini.
I VESPERAE dom. III Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Pisa. Fr. Agostino M. Del Cesta, presb., a. 82, r. 57.
22. Alb. DOMINICA III PASCHAE (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. Pasch.
L 1 Act 3, 13-15. 17-19; Ps 4, 2. 4. 7. 9.
L 2 1 Io 2, 1-5a.
Ev Lc 24, 35-48.
Prohibentur aliae celebrationes necnon Missa exsequialis.
II VESPERAE dom. III Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Siena. Fr. Bartolomeo M. Giorgi, presb., a. 82, r. 65.
1969. Tirano. Fr. Guido M. Dalle Carbonare, presb., a. 45, r. 25.
110
TEMPUS PASCHALE
APRILIS 2012
111
1973. Hillside. Fr. Hyacinth M. Breski, presb., a. 80, r. 60. ANNIVERSARIA
1978. Vicenza. Fr. Gerardo M. Borsato, a. 63, r. 42. 1998. Eger. Fr. Agostón M. Csete, presb., a. 85, r. 65.
1984. Portland. Fr. Peregrine M. Pillarella, a. 84, r. 41. 2003. KwaNgwanase. Fr. Alphonse M. Mooney, presb., a. 69, r. 50.
23. Alb. Feria II post dom. III Paschae (hebd. III Psalt.). 24. Alb. Feria III post dom. III Paschae (hebd. III Psalt.).
De ea. Vel: De ea. Vel:
Rub. S. Georgii M. Vel: Rub. S. Fidelis de Sigmaringen P. M.
Rub. S. Adalberti E. M.
MISSA feriae, pf. pasch., vel MISSA unius e memoriis,
pf. pasch. vel de sancto.
L 1 Act 6, 8-15; Ps 118, 23-24. 26-27. 29-30.
Ev Io 6, 22-29.
In Anglia:
23. Rub. Feria II. S. GEORGII M., ANGLIAE PATRONI,
festum. – Ad H. m. ant. et pss. feriae II hebd. IV.
MISSA pr., Gloria, pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
Cras recurret anniversarium sollemnis inaugurationis
Pontificatus Benedicti Pp. XVI (2005), quem Dominus
in omnibus prosperet et diu conservet.
In omnibus Missis habeatur peculiaris intentio pro Papa in
oratione universali.
MISSA feriae, pf. pasch. vel MISSA memoriae, pf. pasch.
vel de sancto.
L 1 Act 7, 51 – 8, 1a;
Ps 30, 3cd-4. 6ab et 7b et 8a. 17 et 21ab.
Ev Io 6, 30-35.
ANNIVERSARIA
1972. Firenze. Fr. Paolo M. Giannelli, presb., a. 86, r. 68.
1979. Superga. Fr. Tarcisio M. Pons, a. 79, r. 43.
1980. Vicenza. Fr. Giacomo M. Tonellotto, a. 67, r. 44.
1992. Portland. Fr. Donald M. Morgan, presb., a. 76, r. 51.
2010. Piggs Peak. Fr. Maurice M. O’Gorman, presb., a. 67, r. 47.
25. Rub. Feria IV. S. MARCI, EVANGELISTAE, festum.
– Ad H. m. ant. de temp. et pss. feriae IV hebd. III.
MISSA pr., Gloria, lect. pr., pf. App. II.
L 1 1 Petr 5, 5b-14; Ps 88, 2-3. 6-7. 16-17.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1985. Venezia. Fr. Amadio M. Righele, presb., a. 88, r. 69.
1988. Roma. Fr. Agostino M. Rossi, presb., a. 70, r. 51.
1998. Dublin. Fr. Vincent M. McGlue, a. 72, r. 42.
112
113
TEMPUS PASCHALE APRILIS 2012
26. Alb. Feria V post dom. III Paschae (hebd. III Psalt.). ANNIVERSARIA
De ea. 1987. Marina di Carrara. Fr. Lorenzo M. Giannelli, presb., a. 78,
r. 59.
1995. Manchester. Fr. James M. O’Connell, presb., a. 73, r. 53.
MISSA feriae, pf. pasch.
L 1 Act 8, 26-40; Ps 65, 8-9. 16-17. 20.
Ev Io 6, 44-51.
DIES PRO FOVENDIS VOCATIONIBUS O.S.M.
27. Alb. Feria VI post dom. III Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 9, 1-20; Ps 116, 1. 2.
Ev Io 6, 52-59.
ANNIVERSARIA
1986. Fullerton. Fr. Manettus M. Ortmann, presb., a. 75, r. 55.
1995. Saint Louis. Fr. Joseph M. Byrne, diac., a. 73, r. 43.
Sanctus Philippus Benizi, feria quinta Paschae, in mis-
sae celebratione verba audivit: Dixit Spiritus Philippo:
«Accede et adiunge te ad currum istum» (Act 8, 29) sta-
timque ad gloriosae Virginis currum in religione
Servorum eius adiungi decrevit.
Tota Servorum familia, quae hodie in liturgia euchari-
stica eadem verba ac Philippus audivit, Deo omnipo-
tenti ferventes effundat preces ad copiosas vocationes
religiosas et sacerdotales in Ordine nostro impetran-
das. Quae supplicatio in omnibus Servorum ecclesiis,
in missae celebratione, fidelibus de eius sensu hac vi
admonitis, fiat oportet, praesertim in orationis uni-
versalis precibus.
28. Alb. Sabb. post dom. III Paschae (hebd. III Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb. Vel:
Rub. S. Petri Chanel P. M. Vel:
Alb. S. Ludovici Mariae Grignion de Montfort P.
MISSA feriae, pf. pasch., vel MISSA B. Mariae V.,
Temp. Pasch., vel MISSA unius e memoriis, pf. pasch.
vel de sancto.
L 1 Act 9, 31-42; Ps 115, 12-13. 14-15. 16-17.
Ev Io 6, 60-69.
Vel:
Una e missis CMBMV Temp. Pasch., praesertim
form. n. 16: Sancta Maria Virgo, fons lucis et vitae.
I VESPERAE dom. IV Paschae. – Cp. post I Vp. dom.
114
TEMPUS PASCHALE
ANNIVERSARIA
1976. Bruxelles. Fr. Leonard M. Walters, a. 65, r. 45.
2004. Vicenza. Fr. Filippo M. Zanin, presb., a. 77, r. 55.
29. Alb. DOMINICA IV PASCHAE (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 4, 8-12; Ps 117, 1 et 8-9. 21-23. 26 et 28cd et 29.
L 2 1 Io 3, 1-2.
Ev Io 10, 11-18.
DIES PRO FOVENDIS VOCATIONIBUS
Hac dominica peculiare supplicationes fiunt pro
fovendis vocationibus sacerdotalibus et religiosis.
Haec intentio, fidelibus explicanda in homilia, preces
informet in oratione universali.
Prohibentur Missae defunctorum, excepta Missa exsequiali.
S. Catharinae Senensis V.D. memoria omittitur.
II VESPERAE dom. IV Paschae. – Cp. post II Vp.
dom.
In Italia et in Europa:
S. Catharinae Senensis V.D., Italiae et Europae patronae,
festum omittitur.
APRILIS 2012
115
ANNIVERSARIA
1996. Quilmes. Fr. Attilio M. Pizzolato, presb., a. 71, r. 51.
2002. Plasencia. Fr. Juan Ángel M. Bracesco, presb., a. 83, r. 60.
2004. Hall bei Innsbruck. Fr. Laudislaus M. Maurer, presb.,
a. 90, r. 73.
30. Alb. Feria II post dom. IV Paschae (hebd. IV Psalt.).
De ea. Vel:
Alb. S. Pii V Pp.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de sancto.
L 1 Act 11, 1-18; Ps 41, 2-3; 42, 3. 4.
Ev Io 10, 1-10.
ANNIVERSARIA
1988. Torino. Fr. Guido M. Mattioli, presb., a. 54, r. 35.
TRIDUUM
S. PEREGRINI LAZIOSI
Diebus 1-2-3 maii in omnibus ecclesiis Ser-
vorum Familiæ dicantur oportet preces ut fratres
omnesque sodales ad festum S. Peregrini Laziosi
celebrandum apte disponantur. Ad hoc oppor-
tune adhibebitur subsidium cui est titulus In
lode di san Pellegrino Laziosi vel In praise of saint Peregrine Laziosi
vel À la louange de saint Pérégrin Laziosi vel En honor de San
Peregrino Laziosi.
MAIUS 2012
MAIUS 2012
1. Alb. Feria III post dom. IV Paschae (hebd. IV Psalt.).
De ea. Vel:
Alb. S. Ioseph Opificis.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pr.
L 1 Act 11, 19-26; Ps 86, 1-3. 4-5. 6-7.
Ev Io 10, 22-30.
Vel, in Missis S. Ioseph:
L 1 Gen 1, 26 – 2, 3 vel Col 3, 14-15. 17. 23-24;
Ps 89, 2. 3-4. 12-13. 14 et 16.
Ev Mt 13, 54-58.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Minime del-
l’Addolorata, hanc diem, qua anno 1868 Sancta Clelia
Barbieri (1847-1870), Congegrationis Fundatrix, in
pace obdormivit, tamquam Diem Congregationis cele-
brat. Anno 1951 die 9 ianuarii Congregatio Ordini
nostro aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
beatae Virgini reddant et pro bono atque incremen-
to Instituti ferventes adhibeant preces.
1977.
1982.
1989.
1994.
ANNIVERSARIA
Udine. Fr. Virginio M. Rigo, a. 68, r. 49.
Reggio Emilia. Fr. Alfonso M. Montà, presb., a. 75, r. 56.
Vicenza. Fr. Nazareno M. Milani, presb., a. 75, r. 59.
Bend (Oregon). Fr. Maurice M. Gillespie, presb., a. 76,
r. 56.
117
2. Alb. Feria IV post dom. IV Paschae (hebd. IV Psalt.).
S. Athanasii E. D., memoria.
MISSA memoriae, pf. pasch. vel de sancto.
L 1 Act 12, 24 – 13, 5a; Ps 66, 2-3. 5. 6 et 8.
Ev Io 12, 44-50.
ANNIVERSARIA
1972. Terni. Fr. Luciano M. De Luca, presb., a. 46, r. 22.
1995. Francavilla al Mare. Fr. Luigi M. Rufini, presb., a. 72,
r. 53.
1996. Montréal. Fr. Mario M. De Santis, presb., a. 78, r. 59.
3. Rub. Feria V. SS. PHILIPPI ET IACOBI APP., festum.
– Ad H. m. ant. de temp. et pss. feriae V hebd. IV.
De ea.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 1 Cor 15, 1-8; Ps 18, 2-3. 4-5.
Ev Io 14, 6-14.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1963. S. Paulo. Fr. Giovanni M. Cardinale, presb., a. 33, r. 16.
1994. Moncalieri. Fr. Romeo M. Rizzo, a. 46, r. 16.
4. Alb. Feria VI. S. PEREGRINI LAZIOSI, RELIGIOSI
O.N., festum. – Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 2 Cor 4, 10-18; Ps 87, 2-3. 4-5. 10. 14.
Ev Mt 7, 7-14.
118
TEMPUS PASCHALE
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1968. Roma. Fr. Alessio M. Rossi, presb., a. 80, r. 62.
1977. Pannonhalma. Fr. Bertalan M. Süle, a. 73, r. 36.
2011. Pietermaritzburg. Fr. Mthokozisi M. Maseko, presb., a. 54,
r. 32.
5. Alb. Sabb. post dom. IV Paschae (hebd. IV Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch., vel Missa B. Mariae V., Temp.
Pasch.
L 1 Act 13, 44-52; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 14, 7-14.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 18: Beata Maria Virgo, Regina Apostolorum.
I VESPERAE dom. V Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1981. Budapest. Fr. Benedek M. Pataki, presb., a. 63, r. 41.
6. Alb. DOMINICA V PASCHAE (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 9, 26-31; Ps 21, 26b-27. 28 et 30. 31-32.
L 2 1 Io 3, 18-24.
Ev Io 15, 1-8.
Prohibentur aliae celebrationes, excepta exsequiali.
MAIUS 2012
119
II VESPERAE dom. V Paschae. – Cp. post II Vp. dom.
1966.
1979.
1981.
1988.
1989.
1997.
ANNIVERSARIA
Firenze. Fr. Andrea M. Nesi, presb., a. 85, r. 68.
Chicago. Fr. Joseph M. Grabrian, presb., a. 74, r. 52.
Pesaro. Fr. Stefano M. Cherubini, presb., a. 56, r. 38.
Arco. Fr. Vincenzo M. Campesato, presb., a. 72, r. 52.
Gnas. Fr. Otho M. Trummer, presb., a. 68, r. 33.
Wheeling. Fr. Thomas M. Lo Cascio, presb., a. 83, r. 63.
7. Alb. Feria II post dom. V Paschae (hebd. I Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 14, 5-18; Ps 113B, 1-2. 3-4. 15-16.
Ev Io 14, 21-26.
ANNIVERSARIA
1976. Siteki. Fr. Giuseppe M. Vitelli, presb., a. 66, r. 48.
1993. Nigel. Fr. Alessio M. Treppo, a. 70, r. 46.
2007. Sainte-Foy. Fr. Gérard M. Therrien, presb., a. 57, r. 36.
8. Alb. Feria III post dom. V Paschae (hebd. I Psalt.).
De ea. Vel:
Alb. B. Mariae V. gratiarum Matris ac Mediatricis
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. B.
Mariae V.
L 1 Act 14, 19-28; Ps 144, 10-11. 12-13ab. 21.
Ev Io 14, 27-31a.
120
TEMPUS PASCHALE
MAIUS 2012
Vel, in Missa de B. Mariae V.:
L 1 Est 8, 3-8. 16-17a; Ps 66, 2-3. 4-5. 6-7.
Ev Io 2, 1-12.
121
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Suore di Maria
Ss. Addolorata (Napoli), hanc diem, qua anno 1840
Institutum initium cepit, tamquam Diem Congrega-
tionis celebrat. Anno 1951 die 25 octobris Congre-
gatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici, grates Deo et beatae Mariae Virgini rependen-
tes, enixas effundant preces pro Instituti bono atque
incremento.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 30: Beata Maria Virgo, mater et media-
trix gratiae.
In Argentina:
7. I VESPERAE seq. – Cp. post I Vp. dom.
ANNIVERSARIA
Tirano. Fr. Giovanni M. Todesco, presb., a. 51, r. 29.
Saluzzo. Fr. Giovanni M. Ballerini, presb., a. 66, r. 34.
Bruxelles. Fr. Pérégrin M. Desaever, a. 79, r. 62.
Torino. Fr. Adriano M. Canavoso, a. 88, r. 69.
8. Alb. Feria III. «NUESTRA SEÑORA DE LUJÁN», 1968.
PATRONAE PRINCIPALIS REI PUBLICAE 1975.
ARGENTINAE, sollemnitas. – Ad H. m. ant. pr. cum 2001.
psalmodia complementari. 2008.
© MISSA pr., Gloria, Credo, pf. pr. 9. Alb. Feria IV post dom. V Paschae (hebd. I Psalt.).
L 1 Is 35, 1-6a. 10 vel Act 1, 12-14; 2,1-4; De ea.
Ps Lc 1, 46-47. 48-49. 50-51. 52-53. 54-55.
L 2 Eph 1, 3-14
Ev Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Non permittuntur aliae celebrationes, excepta Missa
exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
MISSA feriae, pf. pasch.
L 1 Act 15, 1-6; Ps 121, 1-2. 3-4a. 4b-5.
Ev Io 15, 1-8.
ANNIVERSARIA
1979. Gelsenkirchen-Buer. Fr. Theophil M. Wanderti, presb.,
a. 50, r. 29.
1985. Phoenix. Fr. Gilbert M. Hayden, presb., a. 70, r. 49.
10. Alb. Feria V post dom. V Paschae (hebd. I Psalt.).
De ea.
122
TEMPUS PASCHALE
MISSA feriae, pf. pasch.
L 1 Act 15, 7-21; Ps 95, 1-2a. 2b-3. 10.
Ev Io 15, 9-11.
11. Alb. Feria VI post dom. V Paschae (hebd. I Psalt.).
De ea. Vel:
Alb. B. Benincasa, religiosi O.N.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de beato.
L 1 Act 15, 22-31; Ps 56, 8-9. 10-12.
Ev Io 15, 12-17.
ANNIVERSARIA
1974. Elmhurst. Fr. Francis M. Fitzgerald, presb., a. 69, r. 30.
1978. Rosznó. Fr. Ferenc M. Repási, a. 79, r. 31.
12. Alb. Sabb. post dom. V Paschae (hebd. I Psalt.).
B. Francisci Senensis, presbyteri O.N., memoria.
MISSA memoriae, pf. pasch. vel de beato.
L 1 Act 16, 1-10; Ps 99, 2. 3. 5.
Ev Io 15, 18-21.
Ss. Nerei et Achillei Mm. et de S. Pancratii M. memoriae
omittuntur.
I VESPERAE dom. VI Paschae. – Cp. post I Vp. dom.
ANNIVERSARIA
1997. Wien. Fr. Joachim M. Nagy, a. 92, r. 68.
1997. Viareggio. Fr. Alfonso M. Marinucci, a. 70, r. 47.
MAIUS 2012
123
13. Alb. DOMINICA VI PASCHAE (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch.
L 1 Act 10, 25-26. 34-35. 44-48; Ps 97, 1. 2-3ab. 3cd-4.
L 2 1 Io 4, 7-10.
Ev Io 15, 9-17.
Vel ad libitum, ubi sollemnitas Ascensionis dominica
sequenti celebratur:
L 1 et Ps ut supra.
L 2 1 Io 4, 11-16.
Ev Io 17, 11b-19.
Prohibentur aliae celebrationes, excepta exsequiali.
B. Mariae Virginis de Fatima memoria omittitur.
II VESPERAE dom. VI Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. Detroit. Fr. Alexis M. Croke, presb., a. 75, r. 59.
1971. Montréal. Fr. Henri M. Paradis, presb., a. 71, r. 38.
2000. Portland. Fr. Mark M. Holmes, a. 93, r. 54.
14. Rub. Feria II. S. MATTHIAE, AP., festum. – Ad H.
m. ant. de temp. et pss. feriae II hebd. II.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Act 1, 15-17. 20-26; Ps 112, 1-2. 3-4. 5-6. 7-8.
Ev Io 15, 9-17.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
124
TEMPUS PASCHALE
ANNIVERSARIA
1964. Tiszanagyfalu. Fr. Janos-Angyal M. Kováts, presb., a. 49,
r. 32.
1967. Firenze. Fr. Anton M. Keulemans, a. 64, r. 2.
15. Alb. Feria III post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
MAIUS 2012
125
In Provincia Tirolensi:
16. Rub. Feria IV. S. IOANNIS NEPOMUCENI P. M.,
PROVINCIAE TIROLENSIS PATRONI, festum. – Ad
H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
L 1 Act 16, 22-34; Ps 137, 1-2a. 2bc-3. 7c-8.
Ev Io 16, 5-11.
ANNIVERSARIA
1983. Cittadella. Fr. Domenico M. Corna, a. 78, r. 53.
1984. Chichester. Fr. Francis M. Mildner, presb., a. 73, r. 54.
COMMODITATIS CAUSA DUPLEX INTEGRA
SERIES DIERUM 15-20 MAII PROPONITUR PROUT
SOLLEMNITAS ASCENSIONIS DIE 17 MAII AUT
DOMINICA VII POST PASCHA CELEBRATUR.
Ubi sollemnitas Ascensionis die dominica celebratur:
16. Alb. Feria IV post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 17, 15. 22 – 18, 1;
Ps 148, 1-2. 11-12ab. 12c-14a. 14bcd.
Ev Io 16, 12-15.
ANNIVERSARIA
1982. Portland. Fr. Philip M. Willy, a. 87, r. 56.
2011. Lisieux. Fr. Bruno M. Chénais, presb., a. 60, r. 30.
17. Alb. Feria V post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 18, 1-8; Ps 97, 1. 2-3ab. 3cd-4.
Ev Io 16, 16-20.
ANNIVERSARIA
1987. Midhurst. Fr. Augustine M. Cadd, presb., a. 83, r. 64.
2005. Montréal. Fr. Gaston M. Venne, presb., a. 90, r. 70.
18. Alb. Feria VI post dom. VI Paschae (hebd. II Psalt.).
De ea. Vel:
Rub. S. Ioannis I Pp. M.
MISSA feriae, pf. pasch., vel MISSA memoriae, pf. pasch.
vel de sancto.
126
TEMPUS PASCHALE
L 1 Act 18, 9-18; Ps 46, 2-3. 4-5. 6-7.
Ev Io 16, 20-23a.
ANNIVERSARIA
1998. Trento. Fr. Bruno M. Sartori, presb., a. 70, r. 52.
2000. Pietrasanta. Fr. Davide M. Montagna, presb., a. 63, r. 46.
2008. Marina di Carrara. Fr. Federico M. Aliboni, presb., a. 86,
r. 69.
19. Alb. Sabb. post dom. VI Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch., vel MISSA B. Mariae V.,
Temp. pasch.
L 1 Act 18, 23-28; Ps 46, 2-3. 8-9. 10.
Ev Io 16, 23b-28.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 17: Beata Maria Virgo a Cenaculo.
I VESPERAE soll. Ascensionis – Cp. post I Vp. dom.
20. Alb. Dom. IN ASCENSIONE DOMINI, sollemnitas.
© MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Act 1, 1-11; Ps 46, 2-3. 6-7. 8-9.
L 2 Eph 1, 17-23 vel Eph 4, 1-13 vel 4, 1-7. 11-13.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Bernardini Senensis P. memoria omittitur.
MAIUS 2012
127
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Torino. Fr. Giacomo M. Tivano, presb., a. 77, r. 59.
1967. Portland. Fr. Michael M. Miller, presb., a. 84, r. 64.
Ubi sollemnitas Ascensionis die 17 maii celebratur:
16. Alb. Feria IV post dom. VI Paschae (hebd. II Psalt.).
De ea.
MISSA feriae, pf. pasch.
L 1 Act 17, 15. 22 – 18, 1;
Ps 148, 1-2. 11-12ab. 12c-14a. 14bcd.
Ev Io 16, 12-15.
I VESPERAE soll. Ascensionis – Cp. post I Vp. dom.
In Provincia Tirolensi:
16. Rub. Feria IV. S. IOANNIS NEPOMUCENI P. M.,
PROVINCIAE TIROLENSIS PATRONI, festum. – Ad
H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. Ss. Martyrum.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1982. Portland. Fr. Philip M. Willy, a. 87, r. 56.
2011. Lisieux. Fr. Bruno M. Chénais, presb., a. 60, r. 30.
128
TEMPUS PASCHALE
17. Alb. Feria V. IN ASCENSIONE DOMINI, sollem-
nitas.
MISSA pr., Gloria, Credo, pf. (et Comm.) pr.
L 1 Act 1, 1-11; Ps 46, 2-3. 6-7. 8-9.
L 2 Eph 1, 17-23 vel Eph 4, 1-13 vel 4, 1-7. 11-13.
Ev Mc 16, 15-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1987. Midhurst. Fr. Augustine M. Cadd, presb., a. 83, r. 64.
2005. Montréal. Fr. Gaston M. Venne, presb., a. 90, r. 70.
18. Alb. Feria VI post dom. VI Paschae (hebd. II Psalt.).
De ea. Vel:
Rub. S. Ioannis I Pp. M.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancto.
L 1 Act 18, 9-18; Ps 46, 2-3. 4-5. 6-7.
Ev Io 16, 20-23a.
ANNIVERSARIA
1998. Trento. Fr. Bruno M. Sartori, presb., a. 70, r. 52.
2000. Pietrasanta. Fr. Davide M. Montagna, presb., a. 63, r. 46.
2008. Marina di Carrara. Fr. Federico M. Aliboni, presb., a. 86,
r. 69.
MAIUS 2012
129
19. Alb. Sabb. post dom. VI Paschae (hebd. II Psalt.).
De eo. Vel:
Alb. De S. Maria in sabb.
MISSA sabb., pf. pasch. vel Asc., vel MISSA B. Mariae
V., Temp. pasch.
L 1 Act 18, 23-28; Ps 46, 2-3. 8-9. 10.
Ev Io 16, 23b-28.
Vel:
Una e Missis CMBMV Temp. pasch., praesertim
form. n. 17: Beata Maria Virgo a Cenaculo.
I VESPERAE dom. VII Paschae. – Cp. post I Vp. dom.
20. Alb. DOMINICA VII PASCHAE (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. pasch. vel Asc.
L 1 Act 1, 15-17. 20a. 20c-26; Ps 102, 1-2. 11-12.
19-20ab.
L 2 1 Io 4, 11-16.
Ev Io 17, 11b-19.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Bernardini Senensis P. memoria omittitur.
II VESPERAE dom. VII Paschae. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Torino. Fr. Giacomo M. Tivano, presb., a. 77, r. 59.
1967. Portland. Fr. Michael M. Miller, presb., a. 84, r. 64.
130
TEMPUS PASCHALE MAIUS 2012
21. Alb. Feria II post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Rub. Ss. Christophori Magallanes P. et soc., Mm.
131
L 1 Act 20, 28-38; Ps 67, 29-30. 33-35a. 35b-36c.
Ev Io 17, 11b-19.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancto.
L 1 Act 19, 1-8; Ps 67, 2-3. 4-5ac. 6-7ab.
Ev Io 16, 29-33.
ANNIVERSARIA
1965. Manzini. Ep. Costantino M. Barneschi, a. 72, r. 56.
22. Alb. Feria III post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Alb. S. Ritae de Cascia Rel.
MISSA feriae, pf. pasch. vel Asc., vel MISSA memoriae,
pf. pasch. vel Asc. vel de sancta.
L 1 Act 20, 17-27; Ps 67, 10-11. 20-21.
Ev Io 17, 1-11a.
1968.
1971.
1971.
1992.
1996.
ANNIVERSARIA
Chicago. Fr. Paul M. Grace, presb., a. 57, r. 35.
Roma. Fr. Giovanni M. Pioppi, presb., a. 94, r. 78.
São Paolo. Fr. Andrew M. Van Halder, presb., a. 81, r. 63.
Negrar. Fr. Clemente M. Alba, presb., a. 92, r. 74.
Brescia. Fr. Contardo M. Dal Bianco, presb., a. 82, r. 64.
23. Alb. Feria IV post dom. VII Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch. vel Asc.
1980.
1986.
1986.
2001.
ANNIVERSARIA
Pannonhalma. Fr. Imre M. Góra, a. 80, r. 31.
Mtubataba. Fr. Giovanni M. Bardini, a. 79, r. 56.
Santiago de Chile. Fr. Tommaso M. Sgualdino, presb.,
a. 75, r. 56.
Sainte-Foy. Fr. Roland M. Corbeil, diac., a. 77, r. 31.
24. Alb. Feria V post dom. VII Paschae (hebd. III Psalt.).
De ea.
MISSA feriae, pf. pasch. vel Asc.
L 1 Act 22, 30; 23, 6-11; Ps 15, 1-2a et 5. 7-8. 9-10. 11.
Ev Io 17, 20-26.
In Australia:
23. I VESPERAE seq. soll. – Cp. post II Vp. dom.
24. Alb. Feria V. B. MARIAE V. AUXILIATRICIS CHRI-
STIANORUM, AUSTRALIAE PATRONAE PRINCI-
PALIS, sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
132
TEMPUS PASCHALE
ANNIVERSARIA
1996. Firenze. Fr. Pellegrino M. Buracchi, presb., a. 87, r. 67.
2009. Benburb. Fr. Aloyisius M. Peoples, presb., a. 78, r. 56.
25. Vir. Feria VI post dom. VII Paschae (hebd. III Psalt.).
De ea. Vel:
Alb. S. Bedae Venerabilis P. D. Vel:
Alb. S. Gregorii VII Pp. Vel:
Alb. S. Mariae Magdalenae de’ Pazzi V.
MISSA feriae, pf. pasch. vel Asc., vel MISSA unius e
memoriis, pf. pasch. vel Asc. vel de sancto.
L 1 Act 25, 13b-21; Ps 102, 1-2. 11-12. 19-20ab.
Ev Io 21, 15-19.
MAIUS 2012
133
DOMINICA PENTECOSTES, sollemnitas
Sacrum quinquaginta dierum tempus paschale concluditur
dominica Pentecostes, qua commemorantur donum Spiritus
Sancti in Apostolos, primordia Ecclesiae atque initia eius
missionis ad omnes linguas et populos et nationes.
Praestat ampliore forma Missam in vigilia celebrare, cum
lectionibus et orationibus in libris liturgicis propositis. Haec
tamen Missa characterem baptismalem, ut in Vigilia paschali,
non habet, sed intensioris orationis exemplo Apostolorum,
qui erant, cum Maria Matre Iesu, unanimes in oratione per-
severantes, Spiritus effusionem exspectando.
26. Rub. Sabbato, vespere. – MISSA VIGILIAE pr., Gloria,
Credo, pf. (et Comm.) pr.
MISSA memoriae, pf. pasch. vel Asc. vel de sancto. L 1 Gen 11, 1-9; Ps 32, 10-11. 12-13. 14-15
vel Ex 19, 3-8a. 16-20b; Ps 102, 1-2. 3-4. 6-7. 17-18
vel Ez 37, 1-14; Ps 50, 1-2. 8-9. 12-13. 14 et 17
vel Ioel 3, 1-5; Ps 103, 1-2a. 24 et 35c. 27-28. 29bc-30.
L 2 Rom 8, 22-27.
Ev Io 7, 37-39.
Ad Missam vigiliae et diei adhibeatur PE cum praefatione
variabili.
L 1 Act 28, 16-20. 30-31; Ps 10, 4. 5 et 7. I VESPERAE soll. – Cp. post I Vp. dom.
Ev Io 21, 20-25.
ANNIVERSARIA
1968. Trieste. Fr. Agostino M. Perin, a. 66, r. 16.
26. Alb. Sabb. post dom. VII Paschae (hebd. III Psalt.).
S. Philippi Neri P., memoria.
ANNIVERSARIA
1995. Beaverton. Fr. Eugene M. Walsh, presb., a. 76, r. 56.
2003. Richard’s Bay (KwaZulu-Natal). Fr. Edwin M. Kinch,
presb., a. 84, r. 65.
2010. Vicenza. Fr. Battista M. Pivato, a. 89, r. 68.
27. Rub. Dominica. Officium proprium.
© MISSA IN DIE pr., Gloria, Sequentia, Credo, pf. (et
Comm.) pr.
L 1 Act 2, 1-11; Ps 103, 1ab et 24ac. 29bc-30. 31 et 34.
L 2 1 Cor 12, 3b-7. 12-13 vel Gal 5, 16-25.
Ev Io 20, 19-23 vel Io 15, 26-27; 16, 12-15.
134
TEMPUS PASCHALE
Prohibentur aliae celebrationes, excepta exsequiali.
S. Augustini Cantuariensis E. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
Post dominicam Pentecostes cereus paschalis honorifice in
baptisterio servetur, ut ex eius flamma, in celebratione bap-
tismi, cerei baptizatorum illuminentur. In exequiis autem
cereus paschalis apud feretrum collocetur, ad insinuandum
mortem christiano esse ipsius verum pascha.
Extra tempus paschale cereus paschalis in presbyterio nec
servetur nec accendatur.
Cras resumetur oratio Angelus Domini.
ANNIVERSARIA
1985. Arco. Fr. Ernesto M. Giovanazzi, presb., a. 69, r. 51.
2003. Fullerton. Fr. David M. Kondik, presb., a. 84, r. 62.
TEMPUS PER ANNUM
post Tempus Paschale
Tempore per annum non celebratur peculiaris my-
sterii Christi aspectus; sed potius ipsum mysterium
Christi in sua plenitudine recolitur, praesertim die-
bus dominicis (AC, 43).
Resumitur tempus per annum ab hebdomada VIII, cum
vol. III Liturgiae Horarum et, in Missa, cum Lectionario
feriali, Anno II.
MAIUS 2012
28. Vir. Feria II hebd. VIII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Petr 1, 3-9; Ps 110, 1-2. 5-6. 9 et 10c.
Ev Mc 10, 17-27.
ANNIVERSARIA
1969. Manzini. Fr. Martin M. Nagy, a. 75, r. 38.
1981. Rio de Janeiro. Fr. Tommaso M. Maronati, a. 73, r. 44.
2002. Medellín. Fr. Tarcisio M. Milani Spagnoli, presb., a. 73,
r. 55.
29. Vir. Feria III hebd. VIII per annum (IV Psalt.).
De ea.
136
TEMPUS PER ANNUM
MISSA ad libitum (cf. p. XVIII).
L 1 1 Petr 1, 10-16; Ps 97, 1. 2-3ab. 3c-4.
Ev Mc 10, 28-31.
ANNIVERSARIA
1983. San Pierre. Fr. William M. Walsh, presb., a. 70, r. 50.
1994. Orvieto. Fr. Giuseppe M. Lupardini, presb., a. 75, r. 58.
1999. Negrar. Fr. Paolo M. Ferronato, presb., a. 75, r. 55.
30. Alb. Feria IV hebd. VIII per annum (IV Psalt.).
B. Iacobi Philippi Bertoni, presbyteri O. N.,
memoria.
MISSA memoriae.
L 1 1 Petr 1, 18-25; Ps 147, 12-13. 14-15. 19-20.
Ev Mc 10, 32-45.
1978.
2006.
2006.
2007.
ANNIVERSARIA
Torino. Fr. Benizio M. Botta, presb., a. 82, r. 63.
Siracusa. Fr. Enrico M. Gibilisco, presb., a. 87, r. 70.
Empangeni. Ep. Michael M. O’Shea, a. 75, r. 55.
Dundee. Fr. Peter M. Broadhurst, a. 61, r. 34.
31. Rub. Feria V. IN VISITATIONE B. MARIAE V.,
festum. – Ad H. m. ant. de temp. et pss. feriae V hebd.
IV.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
L 1 Soph 3, 14-18 vel Rom 12, 9-16b;
Ps Is 12, 2-3. 4bcd. 5-6.
Ev Lc 1, 39-56.
MAIUS 2012
137
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1972. Tirano. Fr. Samuele M. Giuriato, presb., a. 50, r. 31.
1976. Perth Amboy. Fr. Charles M. Lyons, presb., a. 87, r. 70.
IUNIUS 2012
IUNIUS 2012
1. Rub. Feria VI hebd. VIII per annum (IV Psalt.).
S. Iustini M., memoria.
MISSA memoriae.
L 1 1 Petr 4, 7-13; Ps 95, 10. 11-12. 13.
Ev Mc 11, 11-26.
ANNIVERSARIA
1985. Dungannon. Fr. Manettus M. Brady, a. 69, r. 27.
1988. Senigallia. Fr. Filippo M. Gervasi, presb., a. 75, r. 58.
2. Alb. Sabb. hebd. VIII per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iud 17, 20b-25; Ps 62, 2. 3-4. 5-6.
Ev Mc 11, 27-33.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 42: Beata Maria Virgo, auxilium chris-
tianorum.
Ss. Marcellini et Petri M. memoria omittitur.
I VESPERAE SS. Trinitatis. – Cp. post I Vp. dom.
ANNIVERSARIA
2000. London. Fr. Gerard M. Corr, presb., a. 89, r. 70.
139
3. Alb. Dominica. SS. TRINITATIS, sollemnitas.
Missa et Off. exstant in fine Proprii de Tempore.
Ad H. m. ant. pr. cum pss. dom. hebd. I.
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Deut 4, 32-34. 39-40; Ps 32, 4-5. 6 et 9. 18-19. 20
et 22.
L 2 Rom 8, 14-17.
Ev Mt 28, 16-20.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
Ss. Caroli Lwanga et soc. Mm. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1976. Fiesole. Fr. Alberto M. Cagnoni, presb., a. 68, r. 48.
1992. Vicenza. Fr. Adriano M. Zini, presb., a. 72, r. 54.
2010. Firenze. Fr. Pietro M. Papini, presb., a. 87, r. 68.
4. Vir. Feria II hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Petr 1, 2-7; Ps 90, 1-2. 14-15ab. 15c-16.
Ev Mc 12, 1-12.
ANNIVERSARIA
1993. Firenze. Fr. Paolo M. Cianferoni, a. 84, r. 45.
1998. Roma. Fr. Jean-M. Delepouve, presb., a. 75, r. 51.
5. Rub. Feria III hebd. IX per annum (I Psalt.).
S. Bonifatii E. M., memoria.
140
TEMPUS PER ANNUM
MISSA memoriae.
L 1 2 Petr 3, 12-15a. 17-18; Ps 89, 2. 3-4. 10. 14 et 16.
Ev Mc 12, 13-17.
1997.
2001.
2007.
2011.
ANNIVERSARIA
Portland. Fr. Kevin M. Fitzpatrick, presb., a. 69, r. 48.
Firenze. Fr. Edoardo M. Balloni, presb., a. 80, r. 60.
São Paulo. Fr. Mario M. Scuppa, presb., a. 76, r. 59.
Firenze. Fr. Eugenio M. Casalini, presb., a. 88, r. 70.
6. Alb. Feria IV hebd. IX per annum (I Psalt.).
De ea. Vel:
Alb. S. Norberti E.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 1, 1-3. 6-12; Ps 122, 1-2a. 2bcd.
Ev Mc 12, 18-27.
I VESPERAE soll. – Cp. post I Vp. dom.
ANNIVERSARIA
1987. Bolzano. Fr. Angelo M. Pedot, presb., a. 76, r. 58.
7. Alb. Feria V. SS. CORPORIS ET SANGUINIS
CHRISTI, sollemnitas. Missa et Off. in fine Pr. de
Tempore exstant. Ad H. m. ant. pr. cum psalmodia
complementari.
© MISSA pr., Gloria, sequentia ad libitum, Credo, pf.
Euch.
L 1 Ex 24, 3-8; Ps 115, 12-13. 15 et 16bc. 17-18.
L 2 Hebr 9, 11-15.
Ev Mc 14, 12-16. 22-26.
IUNIUS 2012
141
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
Ubi sollemnitas Ss.mi Corporis et Sanguinis Christi trans-
fertur in dominicam sequentem:
6. Vir. VESPERAE de feria.
7. Vir. Feria V hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 2, 8-15; Ps 24, 4bc-5ab. 8-9. 10 et 14.
Ev Mc 12, 28b-34.
ANNIVERSARIA
1990. Roma. Fr. Salvatore M. Meo, presb., a. 62, r. 46.
8. Alb. Feria VI hebd. IX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Tim 3, 10-17; Ps 118, 157. 160. 161. 165. 166.
168.
Ev Mc 12, 35-37.
ANNIVERSARIA
1983. Torino. Fr. Alfonso M. Rossi, presb., a. 65, r. 46.
2009. Las Toscas. Fr. Roberto M. Braida, presb., a. 69, r. 42.
2009. Napoli. Fr. Agostino M. Sommese, presb., a. 95, r. 77.
142
TEMPUS PER ANNUM
9. Alb. Sabb. hebd. IX per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 2 Tim 4, 1-8; Ps 70, 8-9. 14-15ab. 16-17. 22.
Ev Mc 12, 38-44.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 23: Beata Maria Virgo, templum Domini.
IUNIUS 2012
143
10. Vir. DOM. X PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Gen 3, 9-15; Ps 129, 1-2. 3-4ab. 4c-6. .7-8.
L 2 2 Cor 4, 13 – 5, 1.
Ev Mc 3, 20-35.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
S. Ephraem Diac. D. memoria omittitur.
I VESPERAE dominicae. – Cp. post I Vp. dom.
In Provincia Insularum:
9. Alb. Sabb. S. COLUMBANI A., PROVINCIAE INSULA-
RUM PATRONI, festum. – Ad H. m. ant. et pss. sabbati
hebd. I.
MISSA pr., Gloria, lect. pr., pf. de sancto.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE seq. – Cp. post I Vp. dom.
ANNIVERSARIA
1962. Forlì. Fr. Cleto M. Zamboni, presb., a. 59, r. 34.
1964. Forchtenau. Fr. Heinrich M. Pielenhofer, presb., a. 89,
r. 54.
1968. Roma. Ep. Antonio M. Michelato, a. 59, r. 40.
1983. Genova. Fr. Amadio M. Landucci, a. 71, r. 50.
Ubi sollemnitas Ss.mi Corporis et Sanguinis Christi non
est de praecepto servanda, assignatur huic dominicae tam-
quam diei proprio:
9. Alb. I VESPERAE soll. – Cp. post I Vp. dom.
10. Alb. Dom. SS. CORPORIS ET SANGUINIS CHRISTI,
sollemnitas. Missa et Off. in fine Pr. de Tempore exstant.
Ad H. m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, sequentia ad libitum, Credo, pf. Euch.
L 1 Ex 24, 3-8; Ps 115, 12-13. 15 et 16bc. 17-18.
L 2 Hebr 9, 11-15.
Ev Mc 14, 12-16. 22-26.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
144
TEMPUS PER ANNUM
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Servants of Mary
(London) tamquam Diem Congregationis hanc diem
celebrat, qua anno 1840, in pago Cuves (Gallia),
Maria Guyot (1821-1849), pia iuvenis, cum duobus
sociis «habitum religiosum» sumendo, Congrega-
tionis fundamenta iecerunt. Anno 1864 die 18 iunii
Congregatio Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Litur-
giae Horarum necnon Sacrificii eucharistici frater-
nas Deo effundant preces pro bono et incremento
Congregationis.
1971.
1974.
1988.
2006.
ANNIVERSARIA
Monte Senario. Fr. Raffaello M. Taucci, presb., a. 88, r. 70.
Nepi. Fr. Giovanni M. Minnucci, a. 81, r. 51.
Alvignano. Fr. Salvatore M. Mazzocca, presb., a. 55, r. 37.
Monte Senario. Fr. Roberto M. Salvetti, a. 85, r. 66.
11. Rub. Feria II hebd. X per annum (II Psalt.).
S. Barnabae Ap., memoria.
MISSA memoriae, lect. pr., pf. pr.
L 1 Act 11, 21b-26; 13, 1-3; Ps 97, 1. 2-3ab. 3c-4. 5. 6.
Ev Mt 10, 7-13.
ANNIVERSARIA
1961. Cuneo. Fr. Michelangelo M. Enrici, presb., a. 75, r. 59.
1982. Vecs. Fr. Jenö M. Tóth, presb., a. 65, r. 44.
1999. Negrar. Fr. Antonio M. Rizzi, presb., a. 93, r. 72.
IUNIUS 2012
145
12. Vir. Feria III hebd. X per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 17, 7-16; Ps 4, 2-3. 4-5. 7-8.
Ev Mt 5, 13-16.
ANNIVERSARIA
1994. Negrar. Fr. Paolo M. Brunello, presb., a. 72, r. 54.
1996. Firenze. Fr. Leonardo M. Valdisserra, presb., a. 81, r. 63.
13. Alb. Feria IV hebd. X per annum (II Psalt.).
S. Antonii de Padova P. D., memoria.
MISSA memoriae.
L 1 1 Reg 18, 20-39; Ps 15, 1-2a. 4. 5 et 8. 11.
Ev Mt 5, 17-19.
ANNIVERSARIA
1961. Venezia. Fr. Luigi M. Crippa, presb., a. 73, r. 56.
1987. Chicago. Fr. Joseph M. Loftus, presb., a. 65, r. 45.
14. Vir. Feria V hebd. X per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 18, 41-46; Ps 64, 10abcd. 10e-11. 12-13.
Ev Mt 5, 20-26.
I VESPERAE soll. Ss.mi Cordis Iesu – Cp. post I Vp.
dom.
ANNIVERSARIA
1973. Monte Senario. Fr. Filippo M. Bugnini, a. 64, r. 45.
1981. Venezia. Fr. Michele M. Selmo, presb., a. 76, r. 54.
146
TEMPUS PER ANNUM
IUNIUS 2012
147
15. Alb. Feria VI. SS. CORDIS IESU, sollemnitas. MISSA matutina memoriae, lect. pr., pf. B. Mariae V.
Missa et Off. in fine Pr. de Tempore exstant. – Ad H.
m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, Credo, pf. pr. Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 28: Cor immaculatum beatae Mariae
Virginis.
L 1 Os 11, 1. 3-4. 8c-9; Ps Is 12, 2-3. 4bcd. 5-6.
L 2 Eph 3, 8-12. 14-19.
Ev Io 19, 31-37.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. Ss.mi Cordis Iesu – Cp. post II Vp.
dom.
ANNIVERSARIA
1987. Roma. Fr. Gesualdo M. D’Errico, presb., a. 64, r. 39.
2008. Morelia (Michoacán). Fr. Cristián M. Monjaraz Navarrete,
presb., a. 36, r. 16.
TRIDUUM
S. IULIANÆ FALCONIERI
Diebus 16-17-18 iunii in omnibus ecclesiis Ser-
vorum Familiæ dicantur oportet preces ut fratres
omnesque sodales disponantur ad festum S. Iulianæ
Falconieri digne celebrandum. Ad hoc opportune adhibebitur
subsidium cui est titulus In lode di santa Giuliana di Firenze
vel In praise of saint Juliana of Florence vel À la louange de sainte
Julienne de Florence vel En honor de Santa Juliana de Florencia.
16. Alb. Sabb. hebd. X per annum (II Psalt.).
Immaculati Cordis B. Mariae V., memoria.
L 1 Is 61, 9-11; Ps 1 Sam 2, 1. 4-5. 6-7. 8abcd.
Ev Lc 2, 41-51.
I VESPERAE dom. – Cp. post I Vp. dom.
DIES CONGREGATIONIS
Congregatio Sororum, a Servo Dei Jean-François
Régis Barthès (1790-1861) condita, cui est titulus
Soeurs de Notre-Dame de la Compassion tamquam
Diem Congregationis hanc diem celebrat qua, anno
1845, primae sorores a sancto Eugenio de Mazenod
(1782-1861), episcopo Massiliensi, habitum religio-
nis ceperunt. Anno 1992 die 7 iunii Congregatio
Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Laudum
et Vesperarum necnon Sacrificii eucharistici grates
Deo et Beatae Mariae Virgini rependant et fraternas
effundant preces pro Congregationis bono atque
incremento.
ANNIVERSARIA
1963. Aysén. Ep. Gerardo M. Vielmo, a. 49, r. 30.
17. Vir. DOM. XI PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
148
149
TEMPUS PER ANNUM IUNIUS 2012
L 1 Ez 17, 22-24; Ps 91, 2-3. 13-14. 15-16. 19. Alb. Feria III. S. M. IULIANAE FALCONIERI,
L 2 2 Cor 5, 6-10. VIRG. O. N., festum. – Ad H. m. ant. et pss. feriae
Ev Mc 4, 26-34. III hebd. III.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom. L 1 1 Cor 7, 25-28. 32-35 vel Apoc 21, 1-5a;
Ps 62, 2. 3-4. 5-6. 7-9.
Ev Mt 25, 1-13 vel Mt 13, 44-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Romualdi A. memoria omittitur.
DIES CONGREGATIONIS
Congregatio sororum cui est titulus Servas de Maria
do Brasil, hanc diem qua, anno 1917, «Madre Cecilia»
(†1945) Instituti fundamenta iecit, tamquam Diem
Congregationis celebrat. Anno 1922 die 2 maii Con-
gregatio Ordini nostro aggregata est.
Servi et Servae sanctae Mariae in celebratione Laudum
et Vesperarum necnon Sacrificii eucharistici grates
Deo et Beatae Mariae Virgini rependant et fraternas
effundant preces pro Congregationis bono atque
incremento.
ANNIVERSARIA
1982. Firenze. Fr. Ludovico M. Langianni, presb., a. 89, r. 72.
1987. Marshfield. Fr. Matthew M. Shekleton, presb., a. 71, r. 52.
18. Vir. Feria II hebd. XI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Reg 21, 1-16; Ps 5, 2-3. 5-6. 7.
Ev Mt 5, 38-42.
ANNIVERSARIA
1964. Chicago. Fr. Bonifaz M. Efferenn, presb., a. 85, r. 65.
1984. Firenze. Fr. Giovanni M. Vannucci, presb., a. 70, r. 53.
MISSA pr., Gloria, pf. pr.
Pro Monialibus et Sororibus O.N.:
18. I VESPERAE soll. – Cp. post I Vp. dom.
19. Alb. Feria III. S. M. IULIANAE FALCONIERI VIRG.
O.N., sollemnitas. – Ad H. m. ant. pr. cum psalmodia
complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Cant 3, 1-4a; 8, 6-7; Ps 62, 2. 3-4. 5-6. 7-9.
L 2 1 Cor 7, 25-28. 32-35 vel Apoc 21, 1-5a.
Ev Mt 25, 1-13 vel Mt 13, 44-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Nové Hrady. Fr. Raymund M. Chalupa, presb., a. 66, r. 48.
1986. Kötschach. Fr. Erhard M. Hohenwarter, presb., a. 75, r. 57.
150
TEMPUS PER ANNUM
1987. Ottawa. Fr. Paul M. Desrochers, presb., a. 61, r. 40.
1997. Dorsten. Fr. Bernhard M. Alpers, presb., a. 60, r. 33.
2004. Chicago. Fr. Andrew M. Motsko, a. 80, r. 51.
20. Vir. Feria IV hebd. XI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 2, 1. 6-14; Ps 30, 20. 21. 24.
Ev Mt 6, 1-6. 16-18.
1977.
1984.
1986.
1987.
ANNIVERSARIA
Innsbruck. Fr. Ubald M. Ihrenberger, a. 96, r. 71.
Vicenza. Fr. Venanzio M. Milani, presb., a. 62, r. 42.
Montréal. Fr. Gabriel M. Lussier, presb., a. 79, r. 61.
Fullerton. Fr. Bonfilius M. Zens, a. 74, r. 44.
21. Alb. Feria V hebd. XI per annum (III Psalt.).
S. Aloisii Gonzaga Rel., memoria.
MISSA memoriae.
L 1 Sir 48, 1-15 (gr. 1-14); Ps 96, 1-2. 3-4. 5-6. 7.
Ev Mt 6, 7-15.
1985.
1993.
2000.
2002.
2005.
2010.
ANNIVERSARIA
Montréal. Fr. Philippe M. Forgues, presb., a. 78, r. 60.
Jesi. Fr. Carlo M. Zucchini, presb., a. 81, r. 64.
Orange. Fr. Gerard M. Calkins, presb., a. 81, r. 61.
Forlì. Fr. Girolamo M. Bellagamba, a. 82, r. 62.
Saviano. Fr. Raffaele M. Montanino, presb., a. 81, r. 63.
Piggs Peak. Fr. Stefano M. Papini, presb., a. 90, r. 72.
IUNIUS 2012
151
22. Vir. Feria VI hebd. XI per annum (III Psalt.).
De ea. Vel:
Alb. S. Paulini Nolani E. Vel:
Rub. Ss. Ioannis Fisher E. et Thomae More Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 11, 1-4. 9-18.20; Ps 131, 11. 12. 13-14. 17-18.
Ev Mt 6, 19-23.
ANNIVERSARIA
1997. Roma. Fr. Paolo M. Valente, a. 89, r. 60.
IUNIUS 2012
CL
ANNUS AB OBITU
BEATI FERDINANDI MARIAE BACCILIERI, PRESBYTERI,
TERTII ORDINIS SERVORUM MARIAE SODALIS
153
23. Alb. Sabb. hebd. XI per annum (III Psalt.).
De S. Maria in sabb. memoria.
MISSA memoriae.
L 1 2 Chron 24, 17-25; Ps 88, 4-5. 29-30. 31-32. 33-34.
Ev Mt 6, 24-34.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 22: Sancta Maria, ancilla Domini.
IN NATIVITATE S. IOANNIS BAPT., sollemnitas.
Anno 1862, die 23 iunii, in oppido Galeazza Pepoli, dioeceseos Bono-
niensis, obiit Beatus Ferdinandus Maria Baccilieri, parochus eiusdem
oppidi, qui fundamenta iecit Congregationis Servarum Mariae a Galeazza,
una cum piis iuvenibus M. Iiuliana Busi (1824-1891) [priora], M. Aloysia
Busi (1841-1896) et M. Rosa Gallerani (1836-1909). Congregatio proba-
ta est a dioeceseos episcopo die 21 novembris 1899 et a Sede Apostolica
die 19 maii 1939 et die 21 ianuarii 1947.
Il 23 giugno 1862, a Galeazza Pepoli, diocesi di Bologna, morì il beato
Ferdinando Maria Baccilieri, parroco di quella cittadina, fondatore insie-
me con le giovani M. Giuliana Busi (1824-1891) [priora], M. Luigia Busi
(1841-1896) e M. Rosa Gallerani (1836-1909), della Congregazione delle
Serve di Maria di Galeazza. Tale Congregazione ebbe l’approvazione dio-
cesana il 21 novembre 1899 e l’approvazione della Sede Apostolica il 19
maggio 1939 e il 21 gennaio 1947.
On 23 June 1862, at Galeazza Pepoli, Diocese of Bologna, Blessed
Ferdinando Maria Baccilieri died. He was the pastor of that town and foun-
der of the Congregation of Sister Servants of Mary of Galeazza, together
with the young M. Giuliana Busi (1824-1891) [prioress], M. Luigia Busi
(1841-1896) and M. Rosa Gallerani (1836-1909). The Congregation recei-
ved diocesan approval on 21 November 1899 and the approval of the Holy
See on 19 May, 1939 and 21 January 1947.
23. Alb. Sabb., vespere. – In Vigilia: MISSA VIGILIAE pr.,
Gloria, Credo, pf. pr.
L 1 Ier 1, 4-10; Ps 70, 1-2. 3-4a. 5-6ab. 15ab et 17.
L 2 1 Petr 1, 8-12.
Ev Lc 1, 5-17.
Ad Missam vigiliae et soll. adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
24. Alb. Dom. IN NATIVITATE S. IOANNIS BAPT.,
sollemnitas – Officium proprium. – Ad H. m. ant. pr.
cum psalm. complementari.
MISSA IN DIE pr., Gloria, Credo, pf. pr.
L 1 Is 49, 1-6; Ps 138, 1-3. 13-14ab. 14c-15.
L 2 Act 13, 22-26.
Ev Lc 1, 57-66. 80.
154
TEMPUS PER ANNUM
Prohibentur aliae celebrationes, excepta Missa exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
IUNIUS 2012
155
26. Vir. Feria III hebd. XII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria di
Galeazza, hanc diem qua, anno 1862, a beato Ferdi-
nando Baccilieri (1821-1893) est condita, tamquam
Diem Congregationis celebrat. Anno 1932 die 8 dicem-
bris Congregatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici, grates Deo et beatae Mariae Virgini rependen-
tes, enixas effundant preces pro Instituti bono atque
incremento.
ANNIVERSARIA
1973. Luggau. Fr. Gabriel M. Weisskopf, presb., a. 87, r. 69.
1976. Santiago de Chile. Fr. Luis M. Villalobos Román, a. 24,
r. 2.
1997. Anaheim. Fr. Timothy M. Culhane, a. 86, r. 60.
25. Vir. Feria II hebd. XII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 17, 5-8. 13-15a. 18; Ps 59, 3. 4-5. 12-13.
Ev Mt 7, 1-5.
ANNIVERSARIA
1981. Palermo. Fr. Gerardo M. Caligiore, presb., a. 68, r. 50.
1986. Conegliano. Fr. Clemente M. Francescon, presb., a. 73, r. 57.
L 1 2 Reg 19, 9b-11. 14-21. 31-35a. 36;
Ps 47, 2-3a. 3b-4. 10-11.
Ev Mt 7, 6. 12-14.
ANNIVERSARIA
1993. Madrid. Fr. Lorenzo M. Maeso Avila, a. 80, r. 39.
27. Vir. Feria IV hebd. XII per annum (IV Psalt.).
De ea. Vel:
Alb. B. Thomae de Urbe Vetere, religiosi O.N. Vel:
Alb. S. Cyrilli Alexandrini E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 2 Reg 22, 8-13; 23, 1-3; Ps 118, 33. 34. 35. 36. 37. 40.
Ev Mt 7, 15-20.
1969.
1971.
1980.
1982.
2009.
ANNIVERSARIA
Innsbruck. Fr. Justin M. Walser, presb., a. 80, r. 35.
London. Fr. Ambrose M. Castleton, presb., a. 54, r. 34.
Pistoia. Fr. Filippo M. Parretti, presb., a. 63, r. 42.
Montréal. Fr. Alessandro M. Pini, presb., a. 66, r. 48.
Negrar. Fr. Luigi M. Zonta, a. 87, r. 68.
28. Rub. Feria V hebd. XII per annum (IV Psalt.).
S. Irenaei E. M., memoria.
MISSA matutina memoriae.
L 1 2 Reg 24, 8-17; Ps 78, 1-2. 3-5. 8. 9.
Ev Mt 7, 21-29.
156
TEMPUS PER ANNUM
SS. PETRI ET PAULI APP., sollemnitas.
28. Rub. Feria V, vespere. – Ubi soll. Apostolorum est de
praecepto servanda, dicitur MISSA VIGILIAE pr.,
Gloria, Credo, pf. pr.
L 1 Act 3, 1-10; Ps 18, 2-3. 4-5.
L 2 Gal 1, 11-20.
Ev Io 21, 15-19.
Ad Missam vigiliae et diei adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
1985.
1996.
1999.
2002.
ANNIVERSARIA
Perugia. Fr. Ildefonso M. Bartolini, presb., a. 69, r. 53.
Rovato. Fr. Angelo M. Dal Maso, a. 69, r. 44.
Siracusa. Fr. Paolo M. Pasqua, presb., a. 75, r. 56.
Firenze. Fr. Angelo M. Conti, presb., a. 77, r. 57.
29. Rub. Feria VI. – Officium proprium – Ad H. m. ant.
pr. cum psalmodia complementari.
© MISSA IN DIE pr., Gloria, Credo, pf. pr.
L 1 Act 12, 1-11; Ps 33, 2-3. 4-5. 6-7. 8-9.
L 2 2 Tim 4, 6-8. 17-18.
Ev Mt 16, 13-19.
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
IUNIUS 2012
157
ANNIVERSARIA
1962. Budrio. Fr. Amadio M. Tinti, presb., a. 80, r. 63.
1990. Reggio Emilia. Fr. Raffaele M. Baldi, presb., a. 69, r. 51.
2007. Siracusa. Fr. Carlo M. Ramondetta, presb., a. 77, r. 55.
30. Alb. Sabb. hebd. XII per annum (IV Psalt.).
De S. Maria in sabb. memoria.
MISSA memoriae.
L 1 Lam 2, 2. 10-14. 18-19; Ps 73, 1-2. 3-5a. 5b-7. 20-21.
Ev Mt 8, 5-17.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 35: Beata Maria Virgo, fidei praesidium.
Ss. Protomartyrum S. Romanae Ecclesiae memoria omit-
titur.
I VESPERAE dom. – Cp. post I Vp. dom.
Pro sororibus vulgo nuncupatis «Serve di Maria di Galeazza»:
30. Alb. Sabb. B. FERDINANDI M. BACCILIERI, PRES-
BYTERI OSSM, FUNDATORIS CONGREGATIONIS
SERVARUM MARIAE VIRGINIS A GALEAZZA, fes-
tum. – Ad H. m. ant. et pss. sabbati hebd. IV.
MISSA pr., Gloria, lect. pr., pf. de beato.
L 1 1 Thes 2, 2b-8; Ps 23, 1-2. 3-4ab. 5-6.
Ev Mt 23, 8-12 vel Io 10, 11-16.
158
TEMPUS PER ANNUM
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1971. Ancona. Fr. Anselmo M. Voltolina, presb., a. 31, r. 12.
1976. Reggio Emilia. Fr. Giovanni M. Zamboni, presb., a. 61,
r. 4.
1978. Mboluzi (Manzini). Fr. Gabriele M. Signori, a. 83, r. 58.
IULIUS 2012
1. Vir. DOM. XIII PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Sap 1, 13-15; 2, 23-24; Ps 29, 2 et 4. 5-6. 11 et 12a
et 13b.
L 2 2 Cor 8, 7. 9. 13-15.
Ev Mc 5, 21-43 vel 5, 21-24. 35b-43.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
B. Ferdinandi M. Baccilieri presbyteri OSSM, Fundatoris
Congregationis Servarum Mariae Virginis a Galeazza,
memoria omittitur.
1972.
1974.
1987.
1995.
ANNIVERSARIA
Mátraháza. Fr. Rafael M. Jáger, presb., a. 71, r. 50.
Roma. Fr. Francesco M. Agostini, presb., a. 70, r. 52.
Chicago. Fr. John M. Wondrasek, presb., a. 74, r. 53.
Chicago. Fr. Thomas M. Calkins, presb., a. 72, r. 51.
2. Vir. Feria II hebd. XIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 2, 6-10. 13-16; Ps 49, 16bc-17. 18-19. 20-21.
22-23.
Ev Mt 8, 18-22.
160
1966.
1968.
1983.
1992.
TEMPUS PER ANNUM
ANNIVERSARIA
Manzini. Fr. Antonino M. Agostinelli, a. 83, r. 55.
Saint-Ortaire. Fr. Hildebrand M. Grannec, presb., a. 80,
r. 58.
Denver. Fr. Julius M. Porcellini, presb., a. 83, r. 63.
Roma. Fr. Giacinto M. Verna, presb., a. 78, r. 58.
3. Rub. Feria III. S. THOMAE AP., festum. – Ad H. m.
ant. et pss. feriae III hebd. I.
MISSA pr., Gloria, pf. App.
L 1 Eph 2, 19-22; Ps 116, 1. 2.
Ev Io 20, 24-29.
In India:
2. I VESPERAE seq. soll. – Cp. post I Vp. dom.
3. Rub. Feria III. S. THOMAE AP., PATRONI PRINCIPA-
LIS, sollemnitas. – Ad H. m. ant. pr. cum psalmodia com-
plementari.
MISSA pr., Gloria, Credo, lect. pr., pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1963. Spa. Fr. Augustin M. Lépicier, presb., a. 82, r. 66.
2000. Carrara. Fr. Carlo M. Dell’Unto, a. 88, r. 70.
IULIUS 2012
161
4. Vir. Feria IV hebd. XIII per annum (I Psalt.).
De ea. Vel:
Alb. B. Ubaldi de Burgo Sancti Sepulcri, presbyteri
O.N. Vel:
Alb. S. Elisabeth Lusitaniae.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 5, 14-15. 21-24; Ps 49, 7. 8-9. 10-11. 12-13.
16bc-17.
Ev Mt 8, 28-34.
ANNIVERSARIA
1977. Kiralyhegyes. Fr. Gábor M. Takács, presb., a. 64, r. 40.
1983. London. Fr. Alexis M. Mullens, presb., a. 71, r. 53.
2002. Verona. Fr. Giuseppe M. Epis, presb., a. 67, r. 40.
5. Vir. Feria V hebd. XIII per annum (I Psalt.).
De ea. Vel:
Alb. S. Antonii M. Zaccaria P.
MISSA ad libitum (cf. p. XVIII).
L 1 Am 7, 10-17; Ps 18, 8. 9. 10. 11.
Ev Mt 9, 1-8.
ANNIVERSARIA
1981. Santiago de Chile. Fr. Severino M. Bernardis, presb., a. 68,
r. 47.
1983. Todi. Fr. Pacifico M. Felici, presb., a. 64, r. 46.
1991. Kersal. Fr. John Angel M. Fletcher, presb., a. 87, r. 68.
6. Vir. Feria VI hebd. XIII per annum (I Psalt.).
De ea. Vel:
Rub. S. Mariae Goretti V. M.
162
TEMPUS PER ANNUM
IULIUS 2012
MISSA ad libitum (cf. p. XVIII). Prohibentur Missae defunctorum, excepta exsequiali.
L 1 Am 8, 4-6. 9-12; Ps 118, 2. 10. 20. 30. 40. 131.
Ev Mt 9, 9-13.
163
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1969. Ponhalma. Fr. Amideus M. Alyusik, a. 74, r. 36.
1974. Milano. Fr. Pio M. Della Pietra, presb., a. 84, r. 48.
7. Alb. Sabb. hebd. XIII per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Am 9, 11-15; Ps 84, 9. 11-12. 13-14.
Ev Mt 9, 14-17.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 34: Beata Maria Virgo, causa nostrae laetitiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1980. Torino. Fr. Alberto M. Ferrero, presb., a. 68, r. 51.
1986. Firenze. Fr. Tommaso M. Banci, presb., a. 74, r. 55.
1986. Vicenza. Fr. Alfredo M. Segafredo, presb., a. 74, r. 57.
8. Vir. DOM. XIV PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ez 2, 2-5; Ps 122, 1-2a. 2bcd. 3-4.
L 2 2 Cor 12, 7-10.
Ev Mc 6, 1-6.
ANNIVERSARIA
1980. Vicenza. Fr. Angelo M. Menon, a. 70, r. 52.
1980. Mbabane. Fr. Joseph M. Perkins, presb., a. 68, r. 15.
2003. Massa Carrara. Fr. Eliseo M. Ferraretto, a. 70, r. 50.
9. Vir. Feria II hebd. XIV per annum (II Psalt.).
De ea. Vel:
Rub. Ss. Augustini Zhao Rong P. et soc. Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 2, 16. 17b-18. 21-22; Ps 144, 2-3. 4-5. 6-7. 8-9.
Ev Mt 9, 18-26.
In Columbia:
9. Alb. Feria II. B. MARIAE V. A ROSARIO DE CHIQUIN-
QUIRÁ, COLUMBIAE PATRONAE, festum. – Ad H. m.
ant. et pss. feriae II hebd. II.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE seq. – Cp. post I Vp. dom.
Ss. Augustini Zhao Rong P. et soc. Mm. memoria omittitur.
ANNIVERSARIA
1998. Benoni. Fr. Michele M. Signori, presb., a. 72, r. 52.
164
TEMPUS PER ANNUM
10. Vir. Feria III hebd. XIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 8, 4-7. 11-13; Ps 113B, 3-4. 5-6. 7ab-8. 9-10.
Ev Mt 9, 32-38.
ANNIVERSARIA
1970. Roma. Fr. Lorenzo M. Orlandi, presb., a. 67, r. 38.
1979. Verona. Fr. Stanislao M. Zanetti, presb., a. 64, r. 46.
1983. Avellaneda. Fr. Girolamo M. Meneghini, presb., a. 69, r. 50.
1984. Portland. Fr. Victor M. Grabrian, presb., a. 76, r. 50.
1995. Perugia. Fr. Antonio M. Contardi, presb., a. 83, r. 66.
2004. El Paso. Fr. Francesco M. De Tomasi, presb., a. 76, r. 58.
11. Alb. Feria IV hebd. XIV per annum (II Psalt.).
S. Benedicti A., memoria.
MISSA memoriae.
L 1 Os 10, 1-3. 7-8. 12; Ps 104, 2-3. 4-5. 6-7.
Ev Mt 10, 1-7.
In Europa:
11. Alb. Feria IV. S. BENEDICTI A. ET EUROPAE PATRONI,
festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA festi, Gloria, lect. pr., pf. de sancto.
L 1 Prov 2, 1-9; Ps 33, 2-3. 4-5. 6-7. 8-9. 10-11.
Ev Mt 19, 27-29.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
IULIUS 2012
165
ANNIVERSARIA
1967. Montevideo. Fr. Augusto M. Pierasco, a. 48, r. 29.
1967. Firenze. Fr. Sergio M. Cerroni, presb., a. 34, r. 15.
12. Vir. Feria V hebd. XIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Os 11, 1-4. 8c-9; Ps 79, 2ac et 3b. 15-16.
Ev Mt 10, 7-15.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
Riparatrici hanc diem qua, anno 1900, Serva Dei M.
Elisa Andreoli (1861-1935) una cum Matre ac duo-
bus sociis Instituti fundamenta iecit, tamquam Diem
Congregationis celebrat. Anno 1910 die 19 ianuarii
Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae cum in litur-
gicis tum in privatis orationibus dignas Deo et glo-
riosae Virgini grates referant et pro bono atque incre-
mento Congregationis fraternas effundant preces.
ANNIVERSARIA
1987. Perugia. Fr. Pellegrino M. Rocchi, a. 74, r. 54.
1999. Negrar. Fr. Carlo M. Calvillo, presb., a. 82, r. 64.
13. Alb. Feria VI hebd. XIV per annum (II Psalt.).
S. Cleliae Barbieri V., Fundatricis Minimarum B.
Mariae V. Perdolentis, memoria.
166
TEMPUS PER ANNUM
MISSA memoriae.
CCL
ANNUS A TITULO PROTECTORIS OPPIDI FAVENTIAE
B. IACOBO PHILIPPO BERTONI TRIBUTO
L 1 Os 14, 2-10; Ps 50, 3-4. 8-9. 12-13. 14 et 17.
Ev Mt 10, 16-23.
S. Henrici memoria omittitur.
Pro sororibus Minimis B. Mariae V. Perdolentis:
12. I VESPERAE soll. – Cp. post I Vp. dom.
13. Alb. Feria VI. S. CLELIAE BARBIERI VIRG., FUNDA-
TRICIS SORORUM MINIMARUM B. MARIAE V.
PERDOLENTIS, sollemnitas. – Ad H. m. pr. cum psalmo-
dia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Ct 8, 6-7; Ps 32, 12-13. 18-19. 20-21.
L 2 1 Cor 1, 26-31.
Ev Mt 11, 25-30.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Henrici memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1966. Viareggio. Fr. Giuliano M. Bernardi, presb., a. 55, r. 33.
1975. Innsbruck. Fr. Hermann M. Auer, presb., a. 93, r. 72.
Die 14 iulii 1762 Consilium civitatis iussit adnumerari in protec-
toribus oppidi Faventiae Beatum Iacobum Philippum Bertoni
(+1483), Servum Mariae, presbyterum. cui ab obitus anno pecu-
liaris cultus tributus erat.
Il 14 luglio 1762 il Consiglio comunale stabilì di annoverare fra i
protettori della città di Faenza il beato Giacomo Filippo Bertoni
(+1483), servo di Maria, presbitero, a cui era stato tributato un
particolare culto subito dopo la morte.
On 14 July 1762 the city council decided to include Blessed
James Philip Bertoni (+1483) among the protectors of the city.
He was a Servant of Mary and priest to whom particular devotion
was afforded immediately after death.
168
TEMPUS PER ANNUM
14. Alb. Sabb. hebd. XIV per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Is 6, 1-8; Ps 92, 1ab. 1c-2. 5.
Ev Mt 10, 24-33.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 32: Beata Maria Virgo, mater et magistra
spiritalis.
S. Camilli de Lellis P. memoria omittitur.
I VESPERAE seq. – Cp. post I Vp. dom.
15. Vir. DOM. XV PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Am 7, 12-15; Ps 84, 9ab-10. 11-12. 13-14.
L 2 Eph 1, 3-14 (vel 1, 3-10).
Ev Mt 6, 7-13.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Bonaventurae E.D. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
2006. Orange. Fr. George M. Luznicky, presb., a. 77, r. 56.
16. Vir. Feria II hebd. XV per annum (III Psalt.).
De ea. Vel:
Alb. B. Mariae V. de Monte Carmelo.
IULIUS 2012
169
MISSA ad libitum (cf. p. XVIII).
L 1 Is 1, 10-17; Ps 49, 8-9. 16bc-17. 21 et 23.
Ev Mt 10, 34 – 11, 1.
Vel, in Missa B. Mariae V. de Monte Carmelo:
L 1 Zac 2, 14-17;
Ps Lc 1, 46-47. 48-49. 50-51. 52-53. 54-55.
Ev Mt 12, 46-50.
In Chilia:
15. I VESPERAE seq. – Cp. post I Vp. dom.
16. Alb. Feria II. B. MARIAE V. DE MONTE CARMELO,
CHILIAE MATRIS ATQUE REGINAE, sollemnitas. –
Ad H. m. pr. cum psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1985. Firenze. Fr. Paolino M. Pezzini, a. 87, r. 62.
17. Vir. Feria III hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 7, 1-9; Ps 47, 2-3a. 3b-4. 5-6. 7-8.
Ev Mt 11, 20-24.
170
1967.
1995.
2002.
2008.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Stegi. Fr. Agostino M. Botta, presb., a. 65, r. 47.
Firenze. Fr. Lorenzo M. Perri, presb., a. 70, r. 50.
Verona. Fr. Antonio M. Crevattin, a. 87, r. 62.
Magog. Fr. Jacques M. Coderre, presb., a. 92, r. 72.
Magog. Fr. Columba M. McManus, presb., a. 75, r. 54.
18. Vir. Feria IV hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 10, 5-7. 13-16; Ps 93, 5-6. 7-8. 9-10. 14-15.
Ev Mt 11, 25-27.
ANNIVERSARIA
1982. Valmontone. Fr. Gaetano M. Del Brusco, presb., a. 82,
r. 62.
2004. Verona. Fr. Gabriele M. Rocca, presb., a. 83, r. 65.
19. Vir. Feria V hebd. XV per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 26, 7-9. 12. 16-19; Ps 101, 13-14ab et 15. 16-18.
19-21.
Ev Mt 11, 28-30.
1982.
1994.
1996.
1999.
Firenze.
Firenze.
Hillside.
Firenze.
ANNIVERSARIA
Fr. Alfonso M. Bottai, presb., a. 63, r. 46.
Fr. Francesco M. Banci, presb., a. 84, r. 66.
Fr. Martin M. Jenco, presb., a. 61, r. 42.
Fr. Giorgio M. Francini, presb., a. 78, r. 60.
IULIUS 2012
171
20. Vir. Feria VI hebd. XV per annum (III Psalt.).
De ea. Vel:
Rub. S. Apollinaris E. M.
MISSA ad libitum (cf. p. XVIII).
L 1 Is 38, 1-6. 21-22. 7-8; Ps Is 38, 10. 11. 12abcd. 16.
Ev Mt 12, 1-8.
ANNIVERSARIA
1970. Johannesburg. Fr. Michael M. Ramsey, presb., a. 88, r. 45.
1970. Calgary. Fr. Tarcisio M. Hajdusik, presb., a. 56, r. 36.
1977. Volders. Fr. Plazidus M. Schulz, presb., a. 83, r. 61.
1982. Vicenza. Fr. Giuseppe M. Lovato, a. 70, r. 46.
1982. Vicenza. Fr. Gabriele M. Pigato, a. 68, r. 37.
1985. Albuquerque. Fr. John M. Castillo, presb., a. 72, r. 50.
21. Alb. Sabb. hebd. XV per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Mic 2, 1-5; Ps 9, 22-23. 24-25. 28-29. 35.
Ev Mt 12, 14-21.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 36: Beata Maria Virgo, mater pulchrae
dilectionis.
S. Laurentii de Brindisi P.D. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
172
1965.
1992.
1998.
2004.
2006.
TEMPUS PER ANNUM
ANNIVERSARIA
Graz. Fr. Karl M. Zangerle, presb., a. 72, r. 49.
Massa. Fr. Pellegrino M. Pieretti, presb., a. 72, r. 53.
Roma. Fr. Antonio M. Vinciguerra, presb., a. 72, r. 55.
Montréal. Ep. André M. Cimichella, a. 83, r. 64.
Maria Luggau. Fr. Franz M. Weiss, a. 72, r. 42.
22. Vir. DOM. XVIII PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ier 23, 1-6; Ps 22, 1-3a. 3b-4. 5. 6.
L 2 Eph 2, 13-18.
Ev Mc 6, 30-34.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Mariae Magdalenae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Tirano. Fr. Bonfiglio M. Mascioni, presb., a. 47, r. 29.
1987. Buenos Aires. Fr. Giuseppe M. Fogliatto, presb., a. 50, r. 30.
23. Vir. Feria II hebd. XVI per annum (IV Psalt.).
De ea. Vel:
Alb. S. Birgittae Rel.
MISSA ad libitum (cf. p. XVIII).
L 1 Mic 6, 1-4. 6-8; Ps 49, 5-6. 8-9. 16bc-17. 21 et 23.
Ev Mt 12, 38-42.
IULIUS 2012
173
In Europa:
23. Alb. Feria II. S. BIRGITTAE REL., EUROPAE PATRO-
NAE, festum. – Ad H. m. ant. et pss. feriae II hebd. IV.
MISSA festi, Gloria, lect. pr., pf. de sancta.
L 1 Gal 2, 19-20; Ps 33, 2-3. 4-5. 6-7. 8-9. 10-11.
Ev Io 15, 1-8.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1980. Alessandria. Fr. Leone M. Botta, presb., a. 80, r. 62.
24. Vir. Feria III hebd. XVIII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Sarbelii Makhlüf P.
MISSA ad libitum (cf. p. XVIII).
L 1 Mic 7, 14-15. 18-20; Ps 84, 2-4. 5-6. 7-8.
Ev Mt 12, 46-50.
ANNIVERSARIA
1961. Arco. Fr. Pietro M. Tuninetti, a. 45, r. 19.
2004. Santiago del Cile. Fr. Faustino M. Gazziero De Stefani,
presb., a. 69, r. 50.
2010. Bologna. Fr. Pellegrino M. Santucci, presb., a. 89, r. 72.
25. Rub. Feria IV. S. IACOBI AP., festum. – Ad H. m.
ant. et pss. feriae IV hebd. IV.
174
TEMPUS PER ANNUM
MISSA pr., Gloria, lect. pr., pf. App.
L 1 2 Cor 4, 7-15; Ps 125, 1-2ab. 2cd-3. 4-5. 6.
Ev Mt 20, 20-28.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
IULIUS 2012
175
In Missa de Ss. Ioachim et Anna:
L 1 Sir 44, 1. 10-15; Ps 131, 11. 13-14. 17-18.
Ev Mt 13, 16-17.
ANNIVERSARIA
1971. Graz. Fr. Blasius M. Walcher, a. 71, r. 39.
1990. Prata Sannita. Fr. Amadio M. Arcopinto, presb., a. 72, r. 53.
1996. Ottawa. Fr. Henri M. Gamache, presb., a. 75, r. 54.
In Hispania:
24. I VESPERAE soll. – Cp. post I Vp. dom.
25. Rub. Feria IV. S. IACOBI AP., PATRONI PRINCIPALIS
HISPANIAE, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1962. Foligno. Fr. Anselmo M. Torelli, presb., a. 79, r. 63.
26. Alb. Feria V hebd. XVI per annum (IV Psalt.).
Ss. Ioachim et Annae, Parentum B. Mariae V.,
memoria.
MISSA memoriae.
L 1 Ier 2, 1-3. 7-8. 12-13; Ps 35, 6-7ab. 8-9. 10-11.
Ev Mt 13, 10-17.
27. Vir. Feria VI hebd. XVI per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 3, 14-17; Ps Ier 31, 10. 11-12ab. 13.
Ev Mt 13, 18-23.
ANNIVERSARIA
1961. Stegi. Fr. Luigi M. Da Meda, a. 79, r. 49.
28. Alb. Sabb. hebd. XVI per annum (IV Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Ier 7, 1-11; Ps 83, 3. 4. 5-6a et 8a-11.
Ev Mt 13, 24-30.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 20: Sancta Maria, mulier nova.
I VESPERAE dom. – Cp. post I Vp. dom.
176
1962.
1972.
2002.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Saluzzo. Fr. Luigi M. Triulzi, presb., a. 49, r. 32.
Genova. Fr. Luigi M. Pazzaglia, presb., a. 66, r. 46.
Denia. Fr. Clemente M. Payá Martí, presb., a. 71, r. 49.
Firenze. Fr. Marcello M. Pisanelli, presb., a. 87, r. 69.
29. Vir. DOM. XVII PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 2 Reg 4, 42-44; Ps 144, 10-11. 15-16. 17-18.
L 2 Eph 4, 1-6.
Ev Io 6, 1-15.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Marthae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. S. José dos Campos. Fr. Filippo M. Gallerani, presb., a. 86,
r. 70.
1977. Siteki. Fr. Elia M. Dal Magro, a. 72, r. 49.
2001. Denia. Fr. José M. Fernández Calvo, presb., a. 66, r. 46.
2009. Treviso. Fr. Costanzo M. Roncato, presb., a. 90, r. 72.
30. Vir. Feria II hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Petri Chrysologi E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 13, 1-11; Ps Deut 32, 18-19. 20. 21.
Ev Mt 13, 31-35.
IULIUS 2012
177
ANNIVERSARIA
1984. Roma. Fr. Luigi M. Bertini, presb., a. 61, r. 44.
31. Vir. Feria III hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Ignatii de Loyola P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 14, 17-22; Ps 78, 8. 9. 11 et 13.
Ev Mt 13, 36-43.
ANNIVERSARIA
1987. Pisa. Fr. Pio M. Signorini, presb., a. 76, r. 57.
1988. Negrar. Fr. Ildefonso M. Graziotto, presb., a. 75, r. 57.
1988. Roma. Fr. Tommaso M. Cimaroli, presb., a. 72, r. 56.
AUGUSTUS 2012
AUGUSTUS 2012
1. Alb. Feria IV hebd. XVII per annum (I Psalt.).
S. Alfonsi M. de’ Liguori E. D., memoria.
MISSA memoriae.
L 1 Ier 15, 10. 16-21; Ps 58, 2-3. 4-5a. 10-11. 17. 18.
Ev Mt 13, 44-46.
ANNIVERSARIA
1963. Firenze. Fr. Vincenzo M. Mancini, a. 85, r. 59.
1970. Todmorden. Fr. John Angel M. Fitzpatrick, a. 79, r. 7.
1998. Colorado Springs. Fr. Ralph Otto M. Jensen, presb., a. 79,
r. 58.
179
tica et oratione ad mentem Summi Pontificis. Huiusmodi
indulgentia semel tantum acquiri potest. Visitatio fieri
potest a meridie diei praecedentis usque ad mediam noctem
quae statutum diem claudit (Enchiridion indulgentiarum,
ed. 1999, concessio n. 33).
ANNIVERSARIA
1968. Detroit. Fr. Joseph M. Markey, presb., a. 76, r. 59.
2000. Marina di Carrara. Fr. Venanzio M. Giamperini, presb.,
a. 81, r. 62.
2004. Negrar. Fr. Filippo M. Mondin, presb., a. 87, r. 69.
3. Vir. Feria VI hebd. XVII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
2. Vir. Feria V hebd. XVII per annum (I Psalt.).
De ea. Vel:
Alb. S. Eusebii Vercellensis E. Vel:
Alb. S. Petri Iuliani Eymard P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 18, 1-6; Ps 145, 2abc. 2d-4. 5-6.
Ev Mt 13, 47-53.
Die 2 Augusti, vel alio die ab Ordinario statuendo in fide-
lium utilitatem, in basilicis minoribus, in sanctuariis et in
ecclesiis paroecialibus acquiri potest indulgentia plenaria
«Portiunculae». Opus praescriptum ad acquirendam huius-
modi indulgentiam est pia ecclesiae visitatio, in qua recitan-
tur oratio dominica et fidei symbolum (Pater et Credo),
additis sacramentali confessione, communione eucharis-
L 1 Ier 26, 1-9; Ps 68, 5. 8-10. 14.
Ev Mt 13, 54-58.
ANNIVERSARIA
1971. Ronzano. Fr. Lorenzo M. Falconi, presb., a. 59, r. 43.
1977. Pieve di Soligo. Fr. Gaetano M. Crivello, a. 69, r. 47.
2008. México. Fr. Lorenzo M. Arroyo Vargas, presb., a. 49, r. 28.
4. Alb. Sabb. hebd. XVII per annum (I Psalt.).
S. Ioannis Mariae Vianney P., memoria.
MISSA memoriae.
L 1 Ier 26, 11-16. 24; Ps 68, 15-16. 30-31. 33-34.
Ev Mt 14, 1-12.
180
TEMPUS PER ANNUM
Reposito vol. III, incip. vol. IV Liturgiae Horarum.
I VESPERAE dom. – Cp. post I Vp. dom.
1966.
1969.
1991.
1996.
1998.
1999.
ANNIVERSARIA
Arco. Fr. Pio M. Sartor, a. 61, r. 40.
Langegg. Fr. Alex M. Fahrnholz, presb., a. 88, r. 67.
Negrar. Fr. Anastasio Nunzio M. Bertossi, presb., a. 79,
r. 60.
Rio Branco. Fr. José M. Carneiro de Lima, presb., a. 84,
r. 65.
Chieri. Fr. Pietro M. Frua, presb., a. 70, r. 52.
Saviano. Fr. Antonino M. Mautone, presb., a. 67, r. 49.
5. Vir. DOM. XVIII PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ex 16, 2-4. 12-15; Ps 77, 3 et 4bc. 23-24. 25 et 54.
L 2 Eph 4, 17. 20-24.
Ev Io 6, 24-35.
Prohibentur Missae defunctorum, excepta exsequiali.
In Dedicatione basilicae S. Mariae memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
Crastina die anniversarium recurret piae mortis Pauli Pp.
VI (1978).
ANNIVERSARIA
1962. Vicenza. Fr. Alfonso M. Sansigolo, presb., a. 71, r. 52.
1965. Pannonhalma. Fr. Bonfilius M. Laluk, presb., a. 67, r. 47.
AUGUSTUS 2012
1966.
1971.
1972.
1974.
2006.
2008.
181
Trieste. Fr. Alessio M. Piva, presb., a. 53, r. 33.
Viareggio. Fr. Alessio M. Pezzini, presb., a. 55, r. 36.
Oruro. Fr. Pablo M. Guarino, a. 39, r. 9.
Napoli. Fr. Filippo M. Micillo, presb., a. 91, r. 74.
Firenze. Fr. Filippo M. Tessari, a. 90, r. 71.
Chicago. Fr. Charles M. Brennan, presb., a. 87, r. 66.
6. Alb. Feria II. IN TRANSFIGURATIONE DOMINI,
festum. – Ad H. m. ant et pss. Feriae II hebd. II.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Dan 7, 9-10. 13-14 vel 2 Petr 1, 16-19;
Ps 96, 1-2. 5-6. 9.
Ev Mc 9, 2-10.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
1975.
1978.
1978.
1992.
ANNIVERSARIA
Detroit. Fr. Vincent M. Healy, presb., a. 86, r. 65.
Firenze. Fr. Antonio M. Cervelli, a. 83, r. 40.
Castelgandolfo. Pp. Paulus VI, a. 80. p. 15.
Wien. Fr. Theodor M. Mann, presb., a. 78, r. 60.
7. Vir. Feria III hebd. XVIII per annum (II Psalt.).
De ea. Vel:
Rub. Ss. Xisti II Pp. Soc. Mm. Vel:
Alb. S. Caietani P.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 30, 1-2. 12-15. 18-22; Ps 101, 16-18. 19-21. 29
et 22-23.
Ev Mt 14, 22-36.
182
TEMPUS PER ANNUM
ANNIVERSARIA
1965. Weihenlinden. Fr. Franzicus Salesius M. Saier, presb., a. 82,
r. 61.
1973. Csatka. Fr. Károly M. Laták, a. 77, r. 35.
1988. Alençon. Fr. Augustin M. Brunon, presb., a. 74, r. 53.
8. Alb. Feria IV hebd. XVIII per annum (II Psalt.).
S. Dominici P., memoria.
MISSA memoriae.
L 1 Ier 31, 1-7; Ps Ier 31, 10. 11-12ab. 13.
Ev Mt 15, 21-28.
ANNIVERSARIA
1980. Rovato. Fr. Giuseppe M. Tosoni, a. 84, r. 57.
1982. São Paolo. Fr. Ugo M. Poli, presb., a. 74, r. 57.
2000. Manchester. Fr. Paul M. Knowles, presb., a. 83, r. 58.
9. Vir. Feria V hebd. XVIII per annum (II Psalt.).
De ea. Vel:
Rub. S. Teresiae Benedictae a Cruce V. M.
MISSA ad libitum (cf. p. XVIII).
L 1 Ier 31, 31-34; Ps 50, 12-13. 14-15. 18-19.
Ev Mt 16, 13-23.
In Europa:
9. Rub. Feria V. S. TERESIAE BENEDICTAE A CRUCE
(Edith Stein) V. M., EUROPAE PATRONAE, festum. –
Ad H. m. ant. et pss. feriae V hebd. II.
AUGUSTUS 2012
183
MISSA festi, Gloria, lect. pr., pf. de sancta.
L 1 Os 2, 16b. 17b. 21-22; Ps 44, 11-12. 14-15. 16-17.
Ev Mt 25, 1-13.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
10. Rub. Feria VI. S. LAURENTII DIAC. M., festum. –
Ad H. m. ant. et pss. feriae VI hebd. II.
MISSA pr., Gloria, lect. pr., pf. Martyrum.
L 1 2 Cor 9, 6-10; Ps 111, 1-2. 5-6. 7-8. 9.
Ev Io 12, 24-26.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
11. Alb. Sabb. hebd. XVIII per annum (II Psalt.).
S. Clarae V., memoria.
MISSA memoriae, pf. com. vel de sancta.
L 1 Hab 1, 12 – 2, 4; Ps 9, 8-9. 10-11. 12-13.
Ev Mt 17, 14-20.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1971. Portland. Fr. Ambrose M. Mayer, presb., a. 88, r. 69.
1999. Figline Valdarno. Fr. Enrico M. Gori, presb., a. 77, r. 61.
2008. Roma. Fr. Manetto M. Salvador, presb., a. 93, r. 72.
12. Vir. DOM. XIX PER ANNUM (Hebd. III Psalt.).
De ea.
184
TEMPUS PER ANNUM
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Reg 19, 4-8; Ps 33, 2-3. 4-5. 6-7. 8-9.
L 2 Eph 4, 30 – 5, 2.
Ev Io 6, 41-51.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Ioannae Franciscae de Chantal Rel. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1972.
1977.
1981.
1985.
2005.
ANNIVERSARIA
Vicenza. Fr. Romedio M. Zuecco, a. 50, r. 17.
Avellaneda. Fr. Gioacchino M. Bonaldo, presb., a. 67, r. 49.
Pómaz. Fr. Pal M. Szabó, a. 66, r. 46.
Firenze. Fr. Zanobi M. Luisi, a. 85, r. 51.
Vicenza. Fr. Egidio M. Merlo, presb., a. 75, r. 57.
13. Vir. Feria II hebd. XIX per annum (III Psalt.).
De ea. Vel:
Rub. Ss. Pontiani Pp. et Hippolyti P., Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 1, 2-5. 24-28c; Ps 148, 1-2. 11-12ab. 12c-14a.
14bcd.
Ev Mt 17, 22-27.
ANNIVERSARIA
1994. Saint-Vaast (Belgique). Fr. Josef M. Commandeur, presb.,
a. 71, r. 51.
14. Rub. Feria III hebd. XIX per annum (III Psalt.).
S. Maximiliani M. Kolbe P. M., memoria.
AUGUSTUS 2012
185
MISSA MATUTINA memoriae.
L 1 Ez 2, 8 – 3, 4; Ps 118, 14. 24. 72. 103. 111. 131.
Ev Mt 18, 1-5. 10. 12-14.
ANNIVERSARIA
1970. Ronzano. Fr. Michele M. Boni, a. 81, r. 31.
1973. Firenze. Fr. Amadio M. Serpi, presb., a. 73, r. 51.
1986. Orvieto. Fr. Vincenzo M. De Paolis, presb., a. 63, r. 45.
IN ASSUMPTIONE B. MARIAE V., sollemnitas.
14. Alb. Feria III, vespere. – IN VIGILIA: MISSA VIGILIAE,
Gloria, lect. pr., Credo, pf. pr.
L 1 1 Chron 15, 3-4. 15-16; 16, 1-2;
Ps 131, 6-7. 9-10. 13-14.
L 2 1 Cor 15, 54b-57.
Ev Lc 11, 27-28.
Ad Missam vigiliae et soll. adhibeatur PE cum praefatione
variabili.
I VESPERAE soll. – Cp. post I Vp. dom.
15. Alb. Feria IV – Officium proprium soll. – Ad H. m.
ant. pr. cum psalmodia complementari.
© MISSA IN DIE pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Apoc 11, 19a; 12, 1-6a. 10ab; Ps 44, 10bc. 11. 12ab.
16.
L 2 1 Cor 15, 20-27.
Ev Lc 1, 39-56.
186
TEMPUS PER ANNUM
Prohibentur aliae celebrationes et, ubi sollemnitas est de
praecepto servanda, etiam Missa exsequialis.
II VESPERAE soll. – Cp. post II Vp. dom.
AUGUSTUS 2012
187
16. Vir. Feria V hebd. XIX per annum (III Psalt.).
De ea. Vel:
Alb. S. Stephani Hungariae.
MISSA ad libitum (cf. p. XVIII).
In Gallia et in Africa Australi:
Sollemnitas ASSUMPTIONIS B. MARIAE V. celebratur
quoque ut patronae principalis totius Regionis.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Serve di Maria
(Ravenna), hanc diem qua, anno 1852, venerabilis
presbyter Georgius Ghiselli (1815-1897) una cum
Margarita Zamara, pia iuvene, Instituti fundamenta
iecit, tamquam Diem Congregationis festive celebrat.
Anno 1926 die 24 aprilis Congregatio Ordini nostro
aggregata est.
Fratres et sorores totius Ordinis grates debitas Deo et
gloriosae Virgini reddant atque pro fidelitate Con-
gregationis erga Spiritus Sancti donum ferventes
effundant preces.
1965.
1966.
1991.
2000.
ANNIVERSARIA
Meyerton. Fr. Cristoforo M. Tapparello, presb., a. 34, r. 15.
Torino. Fr. Luigi M. Zanetta, presb., a. 65, r. 47.
Alessandria. Fr. Tommaso M. Dente, a. 82, r. 57.
Napoli. Fr. Antonio M. Fedele, presb., a. 79, r. 46.
L 1 Ez 12, 1-12; Ps 77, 56-57. 58-59. 61-62.
Ev Mt 18, 21 – 19, 1.
1965.
1982.
1986.
1992.
2008.
ANNIVERSARIA
Arco. Fr. Tommaso M. Campagnolo, a. 84, r. 54.
Roma. Fr. Hilaire M. Morris, presb., a. 90, r. 72.
Milano. Fr. Mario M. Manganelli, presb., a. 65, r. 46.
Udine. Fr. Albino M. Candido, presb., a. 76, r. 57.
El Paso. Fr. Andrea M. Ponso Bellon, presb., a. 82, r. 63.
17. Vir. Feria VI hebd. XIX per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 16, 1-15. 60. 63 vel 16, 59-63;
Ps Is 12, 2-3. 4bcd. 5-6.
Ev Mt 19, 3-12.
ANNIVERSARIA
1982. Olympia Fields. Fr. Frank M. Marron, presb., a. 75, r. 55.
1994. Rum (Innsbruck). Fr. Nivard M. Fuchs, presb., a. 81, r. 62.
1998. Montréal. Fr. Rosaire M. Latraverse, presb., a. 73, r. 54.
18. Alb. Sabb. hebd. XIX per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
188
TEMPUS PER ANNUM
L 1 Ez 18, 1-10. 13b. 30-32; Ps 50, 12-13. 14-15. 18-19.
Ev Mt 19, 13-15.
Vel:
Una e missis CMBMV Temp. per annum, praeser-
tim form. n. 25: Beata Maria Virgo, imago et mater
Ecclesiae I.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1961. S. José dos Campos. Fr. Pellegrino M. Bellezze, presb., a. 77,
r. 61.
2007. Isola Vicentina. Fr. Giorgio M. Sasso, presb., a. 78, r. 51.
2009. Negrar. Fr. Giovanni M. Lupatin, presb., a. 90, r. 73.
AUGUSTUS 2012
189
TRIDUUM
S. PHILIPPI BENIZI
Diebus 20-21-22 augusti in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut
fratres omnesque sodales ad festum S. Philippi
Benizi celebrandum apte disponantur. Ad hoc
opportune adhibebuntur subsidia, quibus sunt
tituli In lode di san Filippo Benizi vel In praise of saint Philip
Benizi vel À la louange de saint Philippe Benizi vel En honor de
san Felipe Benizi et Benedizionale di san Filippo Benizi vel Livre
des bénédictions de saint Philippe Benizi.
20. Alb. Feria II hebd. XX per annum (IV Psalt.).
S. Bernardi A. D., memoria.
MISSA memoriae, pf. com. vel de sancto.
19. Vir. Dom. XX PER ANNUM (Hebd. IV Psalt.).
De ea.
L 1 Ez 24, 15-24; Ps Deut 32, 18-19. 20. 21.
Ev Mt 19, 16-22.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Prov 9, 1-6; Ps 33, 2-3. 10-11. 12-13. 14-15.
L 2 Eph 5, 15-20.
Ev Io 6, 51-58.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Ioannis Eudes P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1974. Roma. Fr. Luigi M. Artusi, presb., a. 74, r. 57.
In Hungaria:
19. I VESPERAE soll. – Cp. post I Vp. dom.
20. Alb. Feria II. S. STEPHANI HUNGARIAE, PATRONI
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
190
1962.
1972.
1973.
1992.
2010.
TEMPUS PER ANNUM
ANNIVERSARIA
Luggau. Fr. Emmeran M. Schicker, presb., a. 50, r. 30.
Rio Branco. Fr. Carlo M. Casavecchia, presb., a. 31, r. 14.
Budapest. Fr. József M. Herhoffer, a. 63, r. 37.
Nigel. Fr. Norberto M. Signori, presb., a. 81, r. 62.
Firenze. Fr. Luciano M. Guidi, a. 97, r. 69.
21. Vir. Feria III hebd. XX per annum (IV Psalt.).
De ea. Vel:
Alb. S. Pii X Pp.
MISSA ad libitum (cf. p. XVIII).
L 1 Ez 28, 1-10; Ps Deut 32, 26-27ab. 27cd-28. 30.
35cd-36ab.
Ev Mt 19, 23-30.
1968.
1969.
1993.
1994.
ANNIVERSARIA
Pointe-Navarre. Fr. Jean-M. Watier, presb., a. 70, r. 42.
Montefano. Fr. Tommaso M. Del Lungo, a. 72, r. 36.
Saviano. Fr. Carmelo M. Abbate, presb., a. 80, r. 61.
Bolzano. Fr. Enrico M. Zanotto, presb., a. 83, r. 62.
22. Alb. Feria IV hebd. XX per annum (IV Psalt.).
B. Mariae Virg. Reginae, memoria.
MISSA memoriae, pf. B. Mariae V.
L 1 Ez 34, 1-11; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Mt 20, 1-16a.
Vel, e Lectionario Sanctorum:
L 1 Is 9, 1-6; Ps 112, 1-2. 3-4. 5-6. 7-8.
Ev Lc 1, 26-38.
Adhibeatur PE cum praefatione variabili.
AUGUSTUS 2012
1978.
2000.
2006.
2007.
191
ANNIVERSARIA
Rottanova. Fr. Emanuele M. Alba, presb., a. 50, r. 32.
Roma. Fr. Emilio M. Gallini, a. 81, r. 63.
Firenze. Fr. Martino M. Santini, presb., a. 91, r. 54.
Québec. Fr. Marcel M. Dégarie, presb., a. 81, r. 60.
23. Alb. Feria V. S.P. PHILIPPI BENIZI, O.N. PROPA-
GATORIS INSIGNIS, festum. – Ad H. m. ant. et
pss. feriae V hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 Col 3, 12-17; Ps 30, 2 et 6. 12-13. 15-16. 17 et 25.
Ev Io 13, 12-17. 34-35 vel Mc 9, 33-37.
Vel:
L 1 2 Cor 5, 17-20; Ps 84, 9-10. 11-12. 13-14.
Ev Lc 6, 27-31. 35b-38.
«Benedictio panis et aquae in honorem S. Philippi» fieri debet
secundum ritum in novissima editione Proprii Missarum
O.S.M. (anno 1998) descriptum, vel secundum unum e riti-
bus in Benedizionale di S. Filippo Benizi vel Livre des bénédic-
tions de saint Philippe Benizi (anno 1987) describuntur.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Rosae de Lima V. memoria omittitur.
In Americae Latinae Nationibus:
23. Alb. Feria V. S. ROSAE DE LIMA V., TOTIUS AMERICAE
LATINAE PATRONAE, festum. – Ad H. m. ant. et pss.
feriae V hebd. IV.
192
TEMPUS PER ANNUM
MISSA pr., Gloria, lect. pr., pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
In Chilia et in Rei Publica Argentina festum S. Rosae de
Lima V. die 30 augusti celebratur.
ANNIVERSARIA
1973. Chieti. Fr. Antonio M. Firmani, a. 56, r. 22.
1983. Verona. Fr. Mariano M. Todero, a. 82, r. 60.
1985. Trapani. Fr. Camillo M. Fioretti, presb., a. 74, r. 58.
24. Rub. Feria VI. S. BARTHOLOMEI AP., festum. –
Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Apoc 21, 9b-14; Ps 144, 10-11. 12-13ab. 17-18.
Ev Io 1, 45-51.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
ANNIVERSARIA
1998. Negrar. Fr. Marino M. Moro, presb., a. 76, r. 56.
1999. Melbourne (USA). Fr. John M. Martin, presb., a. 72, r. 52.
25. Alb. Sabb. hebd. XX per annum (IV Psalt.).
De S. Maria in sabbato, memoria.
MISSA memoriae.
L 1 Ez 43, 1-7a; Ps 84, 9ab.10. 11-12. 13-14.
Ev Mt 23, 1-12.
AUGUSTUS 2012
193
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 24: Beata Virgo Maria, sedes Sapientiae.
S. Ludovici et S. Ioseph de Calasanz P memoriae omittuntur.
.
I VESPERAE dom. – Cp. post I Vp. dom.
1972.
1976.
1977.
1985.
1998.
ANNIVERSARIA
Pisa. Fr. Sostegno M. Benedetti, presb., a. 84, r. 66.
Turvo. Fr. Egidio M. Muscini, a. 92, r. 66.
Rovato. Fr. Vincenzo M. Tessarolo, a. 69, r. 45.
Elmhurst. Fr. Clarence M. Brissette, presb., a. 85, r. 62.
Chicago. Fr. Kevin M. O’Byrne, a. 77, r. 46.
26. Vir. Dom. XXI PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ios 24, 1-2a. 15-17. 18b;
Ps 33, 2-3. 16-17. 18-19. 20-21. 22-23.
L 2 Eph 5, 21-32.
Ev Io 6, 60-69.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1977.
1988.
1997.
1997.
2003.
2008.
ANNIVERSARIA
Portland. Fr. Bartholomew M. Wright, presb., a. 67, r. 34.
Negrar. Fr. Lorenzo M. Boratto, presb., a. 86, r. 69.
Montréal. Fr. Julien M. Brodeur, presb., a. 80, r. 61.
Reggio Emilia. Fr. Pietro M. Rizzi, presb., a. 82, r. 63.
Roma. Fr. Mario M. Castelli, presb., a. 83, r. 66.
Coyhaique. Fr. José M. Belló Marcolín, a. 95, r. 77.
194
TEMPUS PER ANNUM
27. Alb. Feria II hebd. XXI per annum (I Psalt.).
S. Monicae, memoria.
MISSA memoriae.
L 1 2 Thes 1, 1-5. 11b-12; Ps 95, 1-2a. 2b-3. 4-5.
Ev Mt 23, 13-22.
ANNIVERSARIA
1967. S. José dos Campos. Fr. Michele M. Lorenzini, presb., a. 79,
r. 63.
1974. La Plata. Fr. Augusto M. Incao, presb., a. 59, r. 40.
1989. Oruro. Fr. Agostino M. Gobbo, presb., a. 81, r. 59.
28. Alb. Feria III. S. AUGUSTINI E. D. ATQUE LEGI-
SLATORIS ORDINIS NOSTRI, festum. – Ad H.
m. ant. et pss. feriae III hebd. I.
MISSA pr., Gloria, pf. pr.
L 1 1 Io 4, 7-16 vel 1 Cor 12, 31 – 13, 8a. 13;
Ps 36, 3-4. 5-6. 30-31.
Ev Mt 23, 8-12.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1982. Firenze. Ep. Girolamo M. Casalini, a. 66, r. 50.
1987. Pietralba. Fr. Sostegno M. Parise, a. 67, r. 47.
1993. Firenze. Fr. Stefano M. Galeotti, a. 77, r. 56.
29. Rub. Feria IV hebd. XXI per annum (I Psalt.).
In Passione S. Ioannis Baptistae, memoria.
Ad Ld. ant. pr. cum psalmis dom. hebd. I.
AUGUSTUS 2012
195
MISSA memoriae, lect. pr., pf. pr.
L 1 Ier 1, 17-19; Ps 70, 1-2. 3-4a. 5-6ab. 15ab et 17.
Ev Mc 6, 17-19.
Adhibeatur PE cum praefatione variabili.
Ad Vp. ant. pr. cum psalmis de Communi Martyrum.
ANNIVERSARIA
1975. Siracusa. Fr. Agostino M. Pappalardo, presb., a. 63, r. 47.
1988. Milano. Fr. Giorgio M. Cavasin, a. 66, r. 46.
2007. Léon. Fr. José Alejandro M. Medina Frausto, presb., a. 39,
r. 18.
30. Vir. Feria V hebd. XXI per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 1, 1-9; Ps 144, 2-3. 4-5. 6-7.
Ev Mt 24, 42-51.
ANNIVERSARIA
1981. Melbourne. Fr. Vincent M. Harkins, presb., a. 47, r. 28.
2007. Vincenza. Fr. Prospero M. Bobbato, diac., a. 80, r. 60.
2009. Valencia. Fr. Antonio M. Sánchez Iglesias, presb., a. 69, r. 50.
31. Vir. Feria VI hebd. XXI per annum (I Psalt.).
De ea. Vel:
Alb. B. Andreae de Burgo Sancti Sepulcri Rel. O.N.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 1, 17-25; Ps 32, 1-2. 4-5. 10ab et 11.
Ev Mt 25, 1-13.
ANNIVERSARIA
1976. Gaspé. Fr. Percival M. Sainte-Croix, presb., a. 57, r. 34.
1991. Vicenza. Fr. Ilario M. Marchesan, presb., a. 64, r. 46.
SEPTEMBER 2012
SEPTEMBER 2012
1. Alb. Sabb. hebd. XXI per annum (I Psalt.).
De S. Maria in sabbato, memoria.
MISSA memoriae.
L 1 1 Cor 1, 26-31; Ps 32, 12-13. 18-19. 20-21.
Ev Mt 25, 14-30.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 41: Beata Maria Virgo, mater consolationis.
B. Ioannae de Florentia Virg. O.N. memoria omittitur.
197
L 1 Deut 4, 1-2. 6-8; Ps 14, 2-3a. 3cd-4ab. 5.
L 2 Iac 1, 17-18. 21b-22. 27.
Ev Mc 7, 1-8. 14-15. 21-23.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Bruxelles. Fr. Joseph M. Brown, presb., a. 81, r. 62.
1995. Mbabane. Fr. Albert M. Mndzebele, presb., a. 69, r. 43.
2009. Roma. Fr. Raffaele M. Crivello, presb., a. 86, r. 68.
3. Alb. Feria II hebd. XXII per annum (II Psalt.).
S. Gregorii Magni Pp. D., memoria.
I VESPERAE dom. – Cp. post I Vp. dom. MISSA memoriae.
Pro Monialibus et Sororibus O.N.: L 1 1 Cor 2, 1-5; Ps 118, 97. 98. 99. 100. 101. 102.
Ev Lc 4, 16-30.
1. Alb. B. Ioannae de Florentia, Virg. O.N., memoria.
ANNIVERSARIA
1995. Salerno. Fr. Tarcisio M. Mascagni, presb., a. 74, r. 56.
MISSA memoriae.
ANNIVERSARIA
1970. Vicenza. Fr. Emilio M. Toffano, a. 83, r. 58.
2003. Des Plaines (Illinois). Fr. Michael M. Scanlon, presb., a. 95,
r. 77.
2. Vir. DOM. XXII PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
4. Vir. Feria III hebd. XXII per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 2, 10b-16; Ps 144, 8-9. 10-11. 12-13ab.
13cd-14.
Ev Lc 4, 31-37.
ANNIVERSARIA
1967. München. Fr. Paul M. Schifflers, presb., a. 66, r. 44.
2003. Roma. Fr. Giuseppe M. Bortone, presb., a. 77, r. 55.
198
TEMPUS PER ANNUM
5. Vir. Feria IV hebd. XXII per annum (II Psalt.).
De ea. Vel:
Alb. B. Mariae Magdalenae Starace, Virg. O.N.,
Fundatricis Congregationis Sororum Servarum Mariae
a Compassione.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 3, 1-9; Ps 32, 12-13. 14-15. 20-21.
Ev Lc 4, 38-44.
Pro sororibus Servis Mariae a Compassione:
5. Alb. Feria IV. MARIAE MAGDALENAE STARACE,
VIRG. O.N., FUNDATRICIS CONGREGATIONIS
SORORUM SERVARUM MARIAE A COMPASSIONE,
festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA pr., Gloria, lect. pr., pf. de beata.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
VESPERAE festi – Cp. post I Vp. dom.
ANNIVERSARIA
1976. Siteki. Fr. Alfonso M. Borelli, presb., a. 73, r. 56.
1980. Firenze. Fr. Ubaldo M. Forconi, presb., a. 73, r. 55.
1994. Venezia. Fr. Mario M. Turato, a. 84, r. 60.
6. Alb. Feria V hebd. XXII per annum (II Psalt.).
B. Bonaventurae de Foro Livii, presbyteri O.N.,
memoria.
SEPTEMBER 2012
199
MISSA memoriae.
L 1 1 Cor 3, 18-23; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 5, 1-11.
ANNIVERSARIA
1993. Cattolica. Fr. Francesco M. Di Blasio, presb., a. 50, r. 32.
2011. Torino. Fr. Germano M. Vassallo, presb., a. 84, r. 65.
7. Vir. Feria VI hebd. XXII per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 4, 1-5; Ps 36, 3-4. 5-6. 27-28. 39-40.
Ev Lc 5, 33-39.
ANNIVERSARIA
1962. Sublimity. Fr. Francis M. Wiehl, presb., a. 74, r. 55.
2010. Torino. Fr. Giovanni M. Onini, presb., a. 82, r. 65.
8. Alb. Sabb. IN NATIVITATE B. MARIAE V., fes-
tum. – Ad H. m. ant. cum pss. sabbati hebd. II.
MISSA pr., Gloria, lect. pr., pf. B. Mariae V.
L 1 Mic 5, 1-4a vel Rom 8, 28-30; Ps 12, 6ab. 6cd.
Ev Mt 1, 1-16. 18-23 vel 1, 18-23.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
200
TEMPUS PER ANNUM
DIES DIACONIARUM LAICARUM SERVORUM SANCTAE
MARIAE
Motus Diaconiae laicae OSM Diem Consociationis cele-
brant. Orta die 8 septembris 1982 ex felici consilio fra-
tris David M. Montagna (†2000), Consociatio probata
et sociata est Ordini Servorum die 1 ianuarii 1999 a fra-
tre Hubert M. Moons, Priore generali. Omnis diaconia
domi suae lectioni divinae assidue vacat, Nazaretanam
Familiam ut exemplar colit et tamquam festum pro-
prium unam ex festivitatibus marianis celebrant.
Fratres et sorores Ordinis nostri preces effundant ut
Consociatio diaconiarum laicarum in die augeatur
Evangelii testimonium et operum alacritatem.
ANNIVERSARIA
1988. Siteki. Fr. Raimondo M. Dal Magro, a. 85, r. 64.
1989. Vicenza. Fr. Paolino M. Montagna, presb., a. 72, r. 55.
9. Vir. DOM. XXIII PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 35, 4-7a; Ps 145, 7. 8-9a. 9bc-10.
L 2 Iac 2, 1-5.
Ev Mc 7, 31-37.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Petri Claver P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1968. Milano. Fr. Giovanni M. Trevisan, a. 72, r. 47.
1985. Maroslele. Fr. Venáncz M. Bezdán, a. 63, r. 35.
1992. Massa. Fr. Fedele M. Bonini, presb., a. 78, r. 59.
SEPTEMBER 2012
201
10. Vir. Feria II hebd. XXIII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 5, 1-8; Ps 5, 5-6. 7. 12.
Ev Lc 6, 6-11.
11. Vir. Feria III hebd. XXIII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 6, 1-11; Ps 149, 1-2. 3-4. 5-6a et 9b.
Ev Lc 6, 12-19.
ANNIVERSARIA
1975. Roma. Fr. Giovanni M. Poscolieri, presb., a. 63, r. 47.
1986. Arezzo. Fr. Bonagiunta M. Manetti, presb., a. 75, r. 55.
1993. Vicenza. Fr. Felice M. Filippi, a. 67, r. 25.
TRIDUUM
B. MARIÆ VIRGINIS PERDOLENTIS, O.N.
PATRONÆ PRINCIPALIS
Diebus 12-13-14 septembris in omnibus ecclesiis
Servorum Familiæ dicantur oportet preces ut fra-
tres omnesque sodales disponantur ad sollemnita-
tem B. Mariæ Virginis Perdolentis, O.N. Patronæ
Principalis, celebrandam apte disponantur. Ad hoc opportune
adhibebuntur subsidia, quibus sunt tituli Corona dell’Addolorata
vel Rosary of our Lady of sorrows vel Chapelet de Notre-Dame des
douleurs et Via Matris.
202
TEMPUS PER ANNUM
12. Vir. Feria IV hebd. XXIII per annum (III Psalt.).
De ea. Vel:
Alb. Ss.mi Nominis B. Mariae Virginis.
MISSA ad libitum (cf. p. XVIII).
Vel, in Missa B. Mariae V.:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 21: Sanctum Nomen beatae Mariae Virginis.
L 1 1 Cor 7, 25-31; Ps 44, 11-12. 14-15. 16-17.
Ev Lc 6, 20-26.
ANNIVERSARIA
1977. Roma. Fr. Gabriele M. Roschini, presb., a. 76, r. 57.
1979. Palma Campania. Fr. Fortunato M. Frattin, a. 83, r. 49.
1988. Montréal. Fr. Gilles M. Beaulac, presb., a. 61, r. 42.
13. Alb. Feria V hebd. XXIII per annum (III Psalt.).
S. Ioannis Chrysostomi E. D., memoria.
MISSA memoriae.
L 1 1 Cor 8, 1b-7. 11-13; Ps 138, 1-3. 13-14ab. 23-24.
Ev Lc 6, 27-38.
ANNIVERSARIA
2002. Chicago. Fr. Thomas M. Duff, presb., a. 80, r. 59.
14. Rub. Feria VI. IN EXALTATIONE S. CRUCIS, fes-
tum. – Ad H. m. ant. pr. cum pss. feriae VI hebd. III.
MISSA pr., Gloria, lect. pr., pf. pr. vel I Pass.
SEPTEMBER 2012
203
L 1 Num 21, 4b-9 vel Phil 2, 6-11;
Ps 77, 1-2. 34-35. 36-37. 38.
Ev Io 3, 13-17.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE soll. – Cp. post I Vp. dom.
1961.
1961.
1981.
1992.
ANNIVERSARIA
Modena. Fr. Giuseppe M. Gherardi, presb., a. 52, r. 34.
Montréal. Fr. Luigi M. Leonelli, a. 79, r. 55.
S. Colombano. Fr. Bernardo M. Michelato, presb., a. 70,
r. 53.
Rio Branco. Fr. Peregrino M. Carneiro de Lima, presb.,
a. 79, r. 61.
15. Alb. Sabb. B. MARIAE VIRGINIS PERDOLEN-
TIS, O.N. PATRONAE PRINCIPALIS, sollemnitas.
– Ad H. m. ant. pr. cum psalmodia complementari.
MISSA pr., Gloria, lect. pr., sequentia ad libitum, Credo,
pf. pr.
L 1 Iudith 13, 22-25 (gr. 17b-20); Ps 144, 1-2. 4-6. 8-9.
L 2 Col 1, 18-24.
Ev Lc 2, 33-35 vel Io 19, 25-27.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
204
TEMPUS PER ANNUM
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Sisters of the
Mother of Sorrows Servants of Mary (India) hanc
diem qua beatam Virginem Perdolentem Patronam
Instituti venerantur, celebrat quoque tanquam Diem
Congregationis. Anno 1927 die 18 septembris Con-
gregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Liturgiae Horarum necnon Sacrificii eucharistici
Deo gratias agant et pro bono atque incremento
Instituti fraternas effundant preces.
DIES CONGREGATIONIS
Sorores quae Misioneras de María Dolorosa (Ciudad
Juárez, México) vocantur, hunc diem quo earum Insti-
tutum, anno 1947, canonice est erectum, tamquam
Diem Congregationis celebrant. Anno 1953 die 29
martii Congregatio Ordini nostro aggregata est.
Omnes fratres et sorores Ordinis nostri cum in
matutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini laudes
agant et pro bono atque incremento Congregationis
enixe supplicent.
ANNIVERSARIA
1974. Trieste. Fr. Leandro M. Zanussi, a. 70, r. 46.
1994. St. Petersburg Beach. Fr. Dominic M. Manzo, presb., a. 78,
r. 59.
1995. Vicenza. Fr. Andrea M. Cecchin, presb., a. 80, r. 62.
1997. Chieti. Fr. Michele M. Garofalo, presb., a. 77, r. 24.
2000. Napoli. Fr. Tommaso M. Chianese, presb., a. 79, r. 61.
SEPTEMBER 2012
205
16. Vir. DOM. XXIV PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf., dom. per annum.
L 1 Is 50, 5-9a; Ps 114, 1-2. 3-4. 5-6. 8-9.
L 2 Iac 2, 14-18.
Ev Mc 8, 27-35.
Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Cornelii P. et Cypriani E. Mm. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1972. Monte Senario. Fr. Filippo M. Ferrini, presb., a. 91, r. 75.
1981. Vicenza. Fr. Giuseppe M. Micottis, a. 64, r. 43.
2009. Santiago del Cile. Fr. Venancio M. Petracco Orlando,
a. 93, r. 68.
17. Vir. Feria II hebd. XXIV per annum (IV Psalt.).
De ea. Vel:
Alb. S. Roberti Bellarmino E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 11, 17-26. 33; Ps 39, 7-8a. 8b-9. 10. 17.
Ev Lc 7, 1-10.
ANNIVERSARIA
1999. Bologna. Fr. Tiago M. Coccolini, presb., a. 84, r. 68.
18. Vir. Feria III hebd. XXIV per annum (IV Psalt.).
De ea.
206
TEMPUS PER ANNUM
MISSA ad libitum (cf. p. XVIII).
C
ANNUS A CONDITO
INSTITUTO SERVARUM MARIAE A LADYSMITH
L 1 1 Cor 12, 12-14. 27-31a; Ps 99, 2. 3. 4. 5.
Ev Lc 7, 11-17.
1964.
1974.
1976.
1983.
ANNIVERSARIA
Stegi. Fr. Anselmo M. Marsigli, presb., a. 74, r. 55.
Begbroke. Fr. Joachim M. King, presb., a. 66, r. 48.
Chicago. Fr. Gregor M. Ford, presb., a. 70, r. 51.
Firenze. Fr. Celestino M. Bresci, presb., a. 68, r. 48.
Anno 1912, die 19 septembris, in oppido Ladysmith (Wisconsin), USA,
condita est communitas religiosa cui anno 1919 nomen datum est Insti-
tutum Servarum Mariae a Ladysmith. Primae sorores, in quibus numeran-
tur M. Alphonse Bradley (1880-1950), M. Rose Smith (1879-1955), M.
Evangelist Corcoran (1875-1962), in oppido Ladysmith (Wisconsin) perve-
nerunt, ut puellas docerent in schola paroeciali, quo fratres Servi Mariae
anno 1910 venerant. Anno 1919, die 8 decembris, Institutum iuris dioece-
sani factum et appellatum est Congregatio Servarum Mariae a Ladysmith.
Il 19 settembre 1912, fu fondata a Ladysmith (Wisconsin), USA, in cui i
Servi di Maria erano arrivati nel 1910, una comunità religiosa a cui fu
dato il nome di «Istituto delle Serve di Maria di Ladysmith. Le prime
sorelle, fra cui si ricordano M. Alphonse Bradley (1880-1950), M. Rose
Smith (1879-1955), M. Evangelist Corcoran (1875-1962), giunsero a
Ladysmith per insegnare alle ragazze della scuola parrocchiale. L’8 dicembre
1919 l’Istituto divenne di diritto diocesano e presero il nome di Congre-
gazione delle Serve di Maria di Ladysmith.
On 19 September 1912, at Ladysmith (Wisconsin), USA, where the friar
Servants of Mary had arrived in 1910, a religious community of women was
founded with the name “Institute of Sister Servants of Mary of Ladysmith”.
The first sisters, among whom were M. Alphonse Bradley (1880-1950),
M. Rose Smith (1879-1955), and M. Evangelist Corcoran (1875-1962),
went to Ladysmith to teach the girls in the parish school. On 8 December,
1919 it became an Institute of diocesan right and took the name Congre-
gation of Sister Servants of Mary of Ladysmith.
208
TEMPUS PER ANNUM
19. Vir. Feria IV hebd. XXIV per annum (IV Psalt.).
De ea. Vel:
Rub. S. Ianuarii E. M.
MISSA ad libitum (cf. p. XVIII).
L 1 1 Cor 12, 31 – 13, 13; Ps 32, 2-3. 4-5. 12 et 22.
Ev Lc 7, 31-35.
DIES CONGREGATIONIS
Congregatio Sororum cui est titulus Servants of Mary
(Ladysmith) hanc diem qua, anno 1912, primae
Sorores ad civitatem Ladysmith pervenerunt, tam-
quam Diem Congregationis celebrat. Anno 1921
die 16 novembris Congregatio Ordini nostro aggre-
gata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii eucha-
ristici Deo gratias agant et pro bono atque incre-
mento Instituti fraternas effundant preces.
ANNIVERSARIA
1975. Ladysmith. Fr. James M. Keane, presb., a. 74, r. 54.
2000. Santiago de Chile. Fr. Paolo M. Venezian, presb., a. 89,
r. 71.
2001. Nepi. Fr. Giuseppe M. Zamin, presb., a. 75, r. 54.
20. Rub. Feria V hebd. XXIV per annum (IV Psalt.).
Ss. Andreae Kim Taegon, Pauli Chong et Soc.
Mm., memoria.
MISSA memoriae.
SEPTEMBER 2012
209
L 1 1 Cor 15, 1-11; Ps 117, 1-2. 16ab-17. 28.
Ev Lc 7, 36-50.
ANNIVERSARIA
2003. Negrar. Fr. Gioacchino M. Pizzolato, a. 90, r. 71.
2010. Negrar. Fr. Giulio M. Signori, presb., a. 93, r. 74.
2011. Chicago. Fr. Martin M. Doherty, presb., a. 77, r. 56.
21. Rub. Feria VI. S. MATTHAEI AP. ET EV., festum. –
Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. App.
L 1 Eph 4, 1-7. 11-13; Ps 18, 2-3. 4-5.
Ev Mt 9, 9-13.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1991. Firenze. Fr. Giovanni M. Catocci, presb., a. 84, r. 63.
2000. Wien. Fr. Amideus M. Schuhmaier, presb., a. 83, r. 65.
2010. Negrar. Fr. Alessio M. Zanollo, a. 85, r. 56.
22. Alb. Sabb. hebd. XXIV per annum (IV Psalt.).
In Dedicatione Basilicae sacri conventus Montis
Senarii, memoria.
MISSA memoriae.
L 1 1 Cor 15, 35-37. 42-49; Ps 55, 10. 11-12. 13-14.
Ev Lc 8, 4-15.
I VESPERAE dom. – Cp. post I Vp. dom.
210
TEMPUS PER ANNUM
In Monte Senario:
21. I VESPERAE soll. – Cp. post I Vp. dom.
22. Alb. Sabb. IN DEDICATIONE BASILICAE SACRI
CONVENTUS MONTIS SENARII, sollemnitas. – Ad
H. m. ant. pr. cum psalmodia complementari.
MISSA pr., Gloria, Credo, pf. pr.
L 1 Is 56, 1. 6-7; Ps 83, 3. 4. 5-6a et 8a. 11.
L 2 1 Petr 2, 4-9.
Ev Io 4, 19-24.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
Tirano. Fr. Francesco M. Paolazzi, presb., a. 69, r. 45.
Wheeling. Fr. George M. Wheeler, presb., a. 84, r. 64.
Milano. Fr. Maurizio M. Gamba, a. 84, r. 60.
Bologna. Fr. Luigi M. Barbieri, presb., a. 81, r. 65.
Jolimont (Belgique). Fr. Gérard M. Biron, presb., a. 50,
r. 30.
2000. Detroit. Fr. Frederick M. Reiman, presb., a. 80, r. 63.
2005. Negrar. Fr. Alessio M. Eugelmi, a. 77, r. 59.
1972.
1990.
1991.
1992.
1995.
23. Vir. DOM. XXV PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
SEPTEMBER 2012
211
L 1 Sap 2, 12. 17-20; Ps 53, 3-4. 5. 6 et 8.
L 2 Iac 3, 16 – 4, 3.
Ev Mc 9, 30-37.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Pii de Pietrelcina P. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1978. Wien. Fr. Gotthard M. Kreuzer, presb., a. 71, r. 49.
1989. Torino. Fr. Giovanni M. Pollaroli, a. 94, r. 40.
1990. Pesaro. Fr. Vincenzo M. Gualtieri, presb., a. 52, r. 34.
24. Vir. Feria II hebd. XXV per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 3, 27-34; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Lc 8, 16-18.
ANNIVERSARIA
1987. Genova. Fr. Alessio M. Cerrato, presb., a. 81, r. 64.
25. Vir. Feria III hebd. XXV per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 21, 1-6. 10-13; Ps 118, 1. 27. 30. 34. 35. 44.
Ev Lc 8, 19-21.
ANNIVERSARIA
1966. Chicago. Fr. Maurice M. Cronin, presb., a. 38, r. 19.
2002. Waterford. Fr. Aidan M. Kennedy, a. 87, r. 62.
2009. Valencia. Fr. Lorenzo M. Pochettino, presb., a. 83, r. 64.
212
TEMPUS PER ANNUM
26. Vir. Feria IV hebd. XXV per annum (I Psalt.).
De ea. Vel:
Rub. Ss. Cosmae et Damiani Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Prov 30, 5-9; Ps 118, 29. 72. 89. 101. 104. 163.
Ev Lc 9, 1-6.
ANNIVERSARIA
2002. Firenze. Fr. Alessio M. Danti, a. 85, r. 53.
2003. Orléans. Fr. Patrice M. Pharand, presb., a. 84, r. 66.
27. Alb. Feria V hebd. XXV per annum (I Psalt.).
S. Vincentii de Paul P., memoria.
MISSA memoriae.
L 1 Qoh 1, 2-11; Ps 89, 3-4. 5-6. 12-13. 14 et 17.
Ev Lc 9, 7-9.
Crastina die anniversarium recurret piae mortis Ioannis
Pauli Pp. I (1978).
SEPTEMBER 2012
1965.
1971.
1977.
1978.
1992.
213
ANNIVERSARIA
Monte Senario. Fr. Enrico M. Gargiani, presb., a. 75, r. 58.
Sena Madureira. Ep. Giocondo M. Grotti, a. 43, r. 27.
Furtwangen. Fr. Fridolin M. Müller, a. 69, r. 47.
Città del Vaticano. Pp. Ioannes Paulus I, a. 65. p. 33 dierum.
Denver. Fr. Hugh M. Moffett, presb., a. 78, r. 53.
29. Alb. Sabb. SS. MICHAELIS, GABRIELIS ET
RAPHAELIS, ARCHANG., festum. – Ad H. m. ant.
pr. et pss. de sabbati hebd. I.
MISSA pr., Gloria, lect. pr., pf. Angelorum.
L 1 Dan 7, 9-10. 13-14 vel Apoc 12, 7-12a;
Ps 137, 1-2a. 2bc-3. 4-5.
Ev Io 1, 47-51.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA ANNIVERSARIA
1982. Perugia. Fr. Gregorio M. Logli, presb., a. 71, r. 53. 1988. Anaheim. Fr. Philip M. Grimes, presb., a. 81, r. 62.
1991. San Diego. Fr. Raymond M. Geb, presb., a. 65, r. 47. 2007. Firenze. Fr. Ermenegildo M. Biagini, presb., a. 88, r. 70.
28. Vir. Feria VI hebd. XXV per annum (I Psalt.). 30. Vir. DOM. XXVI PER ANNUM (Hebd. II Psalt.).
De ea. Vel: De ea.
Rub. S. Venceslai M. Vel:
Rub. Ss. Laurentii Ruiz et Soc. Mm.
MISSA ad libitum (cf. p. XVIII).
L 1 Qoh 3, 1-11; Ps 143, 1a et 2abc. 3-4.
Ev Lc 9, 18-22.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Num 11, 25-29; Ps 18, 8. 10. 12-13. 14.
L 2 Iac 5, 1-6.
Ev Mc 9, 38-43. 45. 47-48.
214
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
S. Hieronymi P.D. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
ANNIVERSARIA
1978. Superga. Fr. Mauro M. Rapido, a. 49, r. 2.
1992. El Paso. Fr. Egidio M. Pasquon, presb., a. 54, r. 34.
1999. Ceské Budejovice. Fr. Kasimir M. Jindra, presb., a. 84, r. 61.
OCTOBER 2012
Oratio per Mariale Rosarium fidelibus commendetur
eiusque natura et momentum in luce ponantur.
Indulgentia plenaria conceditur recitantibus mariale
Rosarium in ecclesia aut oratorio, vel in familia, in
religiosa communitate, in christifidelium consocia-
tione et generatim cum plures ad aliquem honestum
finem convenerint; indulgentia vero partialis in aliis
rerum adiunctis (Enchiridion Indulgentiarum, ed. 1999,
concessio n. 17).
1. Alb. Feria II hebd. XXVI per annum (II Psalt.).
S. Theresiae a Iesu Infante V. D., memoria.
MISSA memoriae.
L 1 Iob 1, 6-22; Ps 16, 1. 2-3. 6-7.
Ev Lc 9, 46-50.
1974.
1982.
1984.
1991.
2003.
ANNIVERSARIA
Reggio Emilia. Fr. Giuseppe M. Milani, a. 70, r. 36.
Treviso. Fr. Tarcisio M. Campagnolo, presb., a. 47, r. 27.
Ancona. Ep. Bernardino M. Piccinelli, a. 79, r. 62.
Chicago. Fr. Dominic M. Monforti, a. 58, r. 36.
Dundee. Fr. Philip M. Walsh, presb., a. 76, r. 54.
2. Alb. Feria III hebd. XXVI per annum (II Psalt.).
Ss. Angelorum Custodum., memoria.
MISSA pr., lect. pr., pf. de Angelis.
216
TEMPUS PER ANNUM
L 1 Ex 23, 20-23; Ps 90, 1-2. 3-4. 5-6. 10-11.
Ev Mt 18, 1-5. 10.
Adhibeatur PE cum praefatione variabili.
ANNIVERSARIA
1985. Viareggio. Fr. Luca M. Caramelli, presb., a. 65, r. 49.
2001. Las Toscas. Fr. Eligio M. Giacomozzi, presb., a. 90, r. 72.
2004. Derry. Fr. Seamus M. Heffernan, a. 65, r. 42.
3. Rub. Feria IV hebd. XXVI per annum (II Psalt.).
B. Maria Guadalupe Ricart Olmos Virg. M. O.N.,
memoria.
OCTOBER 2012
217
ANNIVERSARIA
1971. Viareggio. Fr. Benedetto M. Maltempi, presb., a. 83, r. 66.
1988. Saint-Augustin (Québec). Fr. Jean M. Gervais, presb., a. 43,
r. 22.
1989. Dundee. Fr. Joseph M. Hynd, a. 58, r. 27.
4. Alb. Feria V hebd. XXVI per annum (II Psalt.).
S. Francisci Assisiensi, memoria.
MISSA memoriae.
L 1 Iob 19, 21-27; Ps 26, 7-8a. 8b-9abc. 13-14.
Ev Lc 10, 1-12.
MISSA memoriae.
L 1 Iob 9, 1-12. 14-16; Ps 87, 10bc-11. 12-13. 14-15.
Ev Lc 9, 57-62.
In Italia:
4. Alb. Feria V. S. FRANCISCI ASSISIENSIS, ITALIAE
PATRONI, festum. Ad H. m. ant. et pss. feriae V hebd. II.
Pro Monialibus O.N.:
Rub. Feria IV. B. Mariae Guadalupe Ricart Olmos, Virg.
M. O.N., festum. – Ad H. m. ant. et pss. feriae IV hebd. II.
MISSA festi, Gloria, lect. pr., pf. de martyr. vel de virg.
L 1 Rom 8, 31b-39; Ps 114-115, 1-2. 3-4. 14-15.
Ev Mt 10, 28-33.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
VESPERAE festi.
Missa pr., Gloria, lect. pr., pf. Sanctorum.
L 1 Gal 6, 14-18; Ps 15, 1-2a et 5. 7-8. 11.
Ev Mt 11, 25-30.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
218
TEMPUS PER ANNUM
DIES MISSIONIS
Missio in regione Acre (Brasilia), die 4 octobris 1919
in Praefecturam apostolicam erecta, hodie Diem
Missionis celebrat.
Omnes fratres et sorores Ordinis nostri in celebratio-
ne Laudum et Vesperarum necnon Sacrificii eucari-
stici fraternas Deo effundant preces pro propagatio-
ne Evangelii in illa regione.
OCTOBER 2012
219
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 40: Beata Maria Virgo, divinae providentiae
mater.
S. Brunonis P. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
DIES CONGREGATIONIS
ANNIVERSARIA
2003. Pesaro. Fr. Pietro M. Giogoli, presb., a. 85, r. 66.
2004. London. Fr. Joseph M. Colella, presb., a. 73, r. 53.
2011. Roma. Fr. Mario M. Bozzi, presb., a. 85, r. 69.
5. Vir. Feria VI hebd. XXVI per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Iob 38, 1. 12-21; 40, 3-5; Ps 138, 1-3. 7-8. 9-10.
13-14ab.
Ev Lc 10, 13-16.
6. Alb. Sabb. hebd. XXVI per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Iob 42, 1-3. 5-6. 12-16 (hebr. 1-3. 5-6. 12-17);
Ps 118, 66. 71. 75. 91. 125. 130.
Ev Lc 10, 17-24.
Congregatio Sororum cui est titulus Mantellate Serve
di Maria di Pistoia, hanc diem qua, anno 1861, in
pago Treppio (Pistorii) Philomena Rossi (1822-1878)
et Ioanna Ferrari (1832-1900) initium Instituti fece-
runt, tamquam Diem Congregationis celebrat. Anno
1868 die 16 novembris Congregatio Ordini nostro
aggregata est.
Omnes fratres et sorores Ordinis nostri cum in mati-
tutinis tum in vespertinis precibus necnon in
Sacrificio eucharistico Deo et beatae Virgini laudes
agant et pro bono atque incremento Congregationis
enixe supplicent.
ANNIVERSARIA
1971. Innsbruck. Fr. Anton M. Mosandl, a. 78, r. 48.
1987. Negrar. Fr. Cirillo M. Diquigiovanni, presb., a. 77, r. 55.
7. Vir. DOM. XXVII PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Gen 2, 18-24; Ps 127, 1-2. 3. 4-5. 6.
L 2 Hebr 2, 9-11.
Ev Mc 10, 2-16 vel 10, 2-12.
220
TEMPUS PER ANNUM
Prohibentur Missae defunctorum, excepta exsequiali.
B. Mariae Virg. a Rosario memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1969.
1988.
2005.
2008.
ANNIVERSARIA
Gutenstein. Fr. Angelicus M. Schwarzenbach, presb., a. 57,
r. 40.
Fullerton. Fr. Bernard M. Paul, presb., a. 62, r. 39.
Montréal. Fr. Gabriel M. Saint-Germain, presb., a. 77, r. 58.
Vicenza. Fr. Graziano M. Casarotto, presb., a. 95, r. 76.
8. Vir. Feria II hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 1, 6-12; Ps 110, 1-2. 7-8. 9 et 10c.
Ev Lc 10, 25-37.
In Hungaria:
7. I VESPERAE soll. – Cp. post I Vp. dom.
8. Alb. Feria II. B. MARIAE V. MAGNAE DOMINAE
HUNGARORUM, sollemnitas. – Ad H. m. ant. pr. cum
psalmodia complementari.
MISSA pr., Gloria, lect. pr., Credo, pr. B. Mariae V.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
OCTOBER 2012
221
ANNIVERSARIA
1989. Orvieto. Fr. Giuseppe M. Conti, presb., a. 61, r. 45.
9. Vir. Feria III hebd. XXVII per annum (III Psalt.).
De ea. Vel:
Rub. Ss. Dionysii E. et Soc. Mm. Vel:
Alb. S. Ioannis Leonardi P.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 1, 13-24; Ps 138, 1-3. 13-14ab. 14c-15.
Ev Lc 10, 38-42.
ANNIVERSARIA
1984. Monte Senario. Fr. Gioacchino M. Bottaro, a. 80, r. 50.
2006. Innsbruck. Fr. Gregor M. Heine, presb., a. 75, r. 48.
2010. Milano. Fr. Giovanni M. Pressacco, a. 89, r. 71.
10. Vir. Feria IV hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 2, 1-2. 7-14; Ps 116, 1. 2.
Ev Lc 11, 1-4.
1981.
1982.
1991.
2004.
2005.
ANNIVERSARIA
Sherbrooke. Fr. Paulin M. Roger, a. 68, r. 28.
Maria Luggau. Fr. Lásló M. Héder, presb., a. 74, r. 54.
Negrar. Fr. Agostino M. Vasina, presb., a. 77, r. 57.
Chicago. Fr. George M. O’Connell, presb., a. 91, r. 72.
Ottawa. Fr. Hervé M. Rochon, a. 74, r. 35.
OCTOBER 2012
L
ANNUS AB INITIO CONCILII OECUMENICI VATICANO II
223
11. Vir. Feria V hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 3, 1-5; Ps Lc 1, 69-70. 71-72. 73-75.
Ev Lc 11, 5-13.
Hodie (die 11 octobris) commemoratur initium Concilii oecu-
menici Vaticani II, quod convocatum est ab beato Ioanne XXIII
(+1963), Summo Pontifici, die 25 decembris 1959.
Oggi (11 ottobre) si commemora l’inizio del Concilio ecumeni-
co Vaticano II, convocato dal beato Sommo Pontefice Giovanni
XXIII (+1963) il 25 dicembre 1959.
Today (11 October) commemorates the start of the Ecumenical
Council, Vatican II, convoked by Blessed Pope John XXIII
(+1963) on 25 December, 1959.
ANNIVERSARIA
1980. Arpadföld. Fr. Bonaventura M. Rácz, presb., a. 67, r. 48.
1983. Abbadia Lariana. Fr. Augusto M. Bottazzi, presb., a. 70,
r. 51.
1987. Chicago. Fr. Ralph M. O’Brien, presb., a. 52, r. 32.
1996. Saviano. Fr. Carlo M. Ruocco, presb., a. 70, r. 53.
2004. Francavilla al Mare. Fr. Mario M. Mariani, presb., a. 82,
r. 63.
2005. Nové Hrady. Fr. Bonfilius M. Wagner, presb., a. 79, r. 55.
12. Vir. Feria VI hebd. XXVII per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 3, 7-14; Ps 110, 1-2. 3-4. 5-6.
Ev Lc 11, 15-26.
In Brasilia:
11. I VESPERAE seq. – Cp. post I Vp. dom.
12. Alb. Feria VI. B. MARIAE VIRGINIS «NOSSA SEN-
HORA DA CONCEIÇÃO APARECIDA, PADROEIRA
PRINCIPAL DO BRASIL», BRASILIAE PATRONAE
PRINCIPALIS, sollemnitas. – Ad H. m. ant. pr. cum psal-
modia complementari.
224
TEMPUS PER ANNUM
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Est 5, 1b-2; 7, 2b-3;
Ps 44, 11-12a. 12b-13. 14-15a. 15b-16.
L 2 Apoc 12, 1- 5. 13a. 15-16a.
Ev Io 2, 1-11.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
1978.
1990.
1997.
2004.
ANNIVERSARIA
Portland. Fr. Lawrence M. Quigley, presb., a. 85, r. 64.
Firenze. Fr. Stanislao M. Cogo, presb., a. 54, r. 35.
São Paolo. Fr. Antonio M. Venturoli, presb., a. 70, r. 53.
Saviano. Fr. Filippo M. Arianna, presb., a. 81, r. 62.
13. Alb. Sabb. hebd. XXVII per annum (III Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Gal 3, 22-29; Ps 104, 2-3. 4-5. 6-7.
Ev Lc 11, 27-28.
Vel:
Una e missis CMBMV Temp. per annum, praesertim
form. n. 19: Sancta Maria, mater Domini.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1968. Roma. Fr. Pellegrino M. Righele, a. 69, r. 45.
1975. Portland. Fr. Stanislaus M. Trojanowski, a. 65, r. 19.
OCTOBER 2012
225
1983. Roma. Fr. Paolino M. Lirussi, a. 75, r. 55.
2003. Downers Grove (Illinois). Fr. Robert M. Lee, a. 63, r. 40.
2004. Torino. Fr. Salvatore M. Mulas, a. 77, r. 43.
14. Vir. DOM. XXVIII PER ANNUM (Hebd. IV Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Sap 7, 7-11; Ps 89, 12-13. 14-15. 16-17.
L 2 Hebr 4, 12-13.
Ev Mc 10, 17-30 vel 10, 17-27.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Callisti Pp. M. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1975.
1996.
2009.
2010.
ANNIVERSARIA
Udine. Fr. Lorenzo M. Cazzola, presb., a. 81, r. 60.
Cuneo. Fr. Giuseppe M. Garelli, presb., a. 74, r. 57.
Saluzzo. Fr. Felice M. Savio, presb., a. 83, r. 66.
Vicenza. Fr. Carlo M. Turati, presb., a. 87, r. 69.
15. Alb. Feria II hebd. XXVIII per annum (IV Psalt.).
S. Teresiae a Iesu V. D., memoria.
MISSA memoriae.
L 1 Gal 4, 22-24. 26-27. 31 – 5, 1; Ps 112, 1-2. 3-4. 5a
et 6-7.
Ev Lc 11, 29-32.
ANNIVERSARIA
1982. Chicago. Fr. Aurelius M. Capra, presb., a. 90, r. 51.
1985. Blue Island. Fr. Terence M. O’Connor, presb., a. 67, r. 47.
226
TEMPUS PER ANNUM
16. Vir. Feria III hebd. XXVIII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Hedvigis Rel. Vel:
Alb. S. Margaritae M. Alacoque V.
MISSA ad libitum (cf. p. XVIII).
L 1 Gal 5, 1-6; Ps 118, 41. 43. 44. 45. 47. 48.
Ev Lc 11, 37-41.
ANNIVERSARIA
1962. Ala (Trento). Fr. Clemens M. Gleinzer, presb., a. 47, r. 30.
1975. Bologna. Fr. Paolo M. Gabrielli, presb., a. 87, r. 71.
1979. Roma. Fr. Alessio M. Cuttano, a. 77, r. 34.
1984. Orvieto. Fr. Michele M. Feudo, presb., a. 68, r. 51.
2010. Negrar. Fr. Agostino M. Rizzotto, presb., a. 87, r. 67.
2010. Negrar. Ep. Aldo M. Lazzarin, a. 83, r. 67.
17. Rub. Feria IV hebd. XXVIII per annum (IV Psalt.).
S. Ignatii Antiocheni E. M., memoria.
OCTOBER 2012
227
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
1974. Wien. Fr. Martin M. Schulz, a. 83, r. 58.
1981. Budapest. Fr. Peregrin M. Quikker, presb., a. 67, r. 44.
2008. Manduria. Fr. Raffaele M. Bonaldo, presb., a. 83, r. 58.
19. Vir. Feria VI hebd. XXVIII per annum (IV Psalt.).
De ea. Vel:
Rub. Ss. Ioannis de Brébeuf P. et Isaac Jogues P. et
Soc. Mm. Vel:
Alb. S. Pauli a Cruce P.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 1, 11-14; Ps 32, 1-2. 4-5. 12-13.
Ev Lc 12, 1-7.
MISSA memoriae.
L 1 Gal 5, 18-25; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 11, 42-46.
ANNIVERSARIA
1976. Klagenfurt. Fr. Magnus M. Herbst, presb., a. 69, r. 50.
1988. Ottawa. Fr. Denis M. Fortin, presb., a. 56, r. 35.
1988. Bologna. Fr. Marco M. Brunori, a. 86, r. 66.
18. Rub. Feria V. S. LUCAE EVANG., festum. – Ad H.
m. ant. et pss. feriae V hebd. IV.
MISSA pr., Gloria, lect. pr., pf. II App.
L 1 2 Tim 4, 10-17b; Ps 144, 10-11. 12-13ab. 17-18.
Ev Lc 10, 1-9.
In Canada festum Ss. Ioannis de Brébeuf P. et Isaac Jogues
P. et Soc. Mm. die 26 septembris celebratur.
Hodie dies anniversaria electionis fratris ÁNGEL M. RUIZ
GARNICA ad Prioris generalis munus recurrit. Impensas
Deo effundamus preces ut, Domina nostra intercedente,
eum, qui universae Servorum Familiae praeest eiusdemque
exsistit unitatis signum, custodiat atque caelestibus repleat
muneribus.
228
TEMPUS PER ANNUM
ANNIVERSARIA
1997. Siteki. Fr. Michael M. Tsabedze, presb., a. 59, r. 33.
20. Alb. Sabb. hebd. XXVIII per annum (IV Psalt.).
De S. Maria in sabb., memoria.
OCTOBER 2012
1972.
1995.
1997.
2000.
229
ANNIVERSARIA
Ottawa. Fr. Jérôme M. Ferraro, presb., a. 53, r. 35.
Chicago. Fr. Tommaso M. Ferrazzi, presb., a. 83, r. 67.
Portland. Fr. Lawrence M. Calkins, presb., a. 86, r. 68.
Wheeling. Fr. Louis M. Cortney, presb., a. 86, r. 67.
MISSA memoriae.
L 1 Eph 1, 15-23; Ps 8, 2-3a. 4-5. 6-7.
Ev Lc 12, 8-12.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 33: Beata Maria Virgo, mater boni consilii.
I VESPERAE dom. – Cp. post I Vp. dom.
1967.
1980.
1983.
1988.
1996.
2008.
ANNIVERSARIA
Knightsville. Fr. Matthew M. Steiger, a. 23, r. 4.
Saluzzo. Fr. Pio M. Mussi, presb., a. 72, r. 53.
Napoli. Fr. Luigi M. Coluzzi, presb., a. 73, r. 56.
Fullerton. Fr. Joseph Steven M. Gibbons, presb., a. 68, r. 48.
Moretta (Cuneo). Fr. Fedele M. Banchio, presb., a. 83, r. 66.
Negrar. Fr. Giovanni M. Apolloni, presb., a. 91, r. 71.
21. Vir. DOM. XXIX PER ANNUM (Hebd. I Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Is 53, 10-11; Ps 32, 4-5. 18-19. 20 et 22.
L 2 Hebr 4, 14-16.
Ev Mc 10, 35-45 vel 10, 42-45.
Prohibentur Missae defunctorum, excepta exsequiali.
II VESPERAE dominicae. – Cp. post II Vp. dom.
DIES MISSIONUM
Recurrente, hac die, dominica ad commemorandum
opus missionum dicata, dici potest Missa «Pro evan-
gelizatione populorum», prouti in Missali Romano
indicatur.
22. Vir. Feria II hebd. XXIX per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 2, 1-10; Ps 99, 2. 3. 4. 5.
Ev Lc 12, 13-21.
ANNIVERSARIA
1987. Kersal. Fr. Charles M. Cunningham, presb., a. 76, r. 53.
1988. Bologna. Fr. Tommaso M. Santi, presb., a. 76, r. 59.
2005. Chicago. Fr. Matthew M. Ford, presb., a. 83, r. 63.
23. Vir. Feria III hebd. XXIX per annum (I Psalt.).
De ea. Vel:
Alb. S. Ioannis de Capestrano P.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 2, 12-22; Ps 84, 9ab-10. 11-12. 13-14.
Ev Lc 12, 35-38.
230
TEMPUS PER ANNUM
ANNIVERSARIA
1984. Roma. Fr. Camillo M. Bartolomei, presb., a. 86, r. 68.
1985. Wheeling. Fr. Tibor M. Furák, presb., a. 59, r. 38.
2007. Portland. Fr. Louis M. Breton, presb., a. 85, r. 64.
24. Vir. Feria IV hebd. XXIX per annum (I Psalt.).
De ea. Vel:
Alb. S. Antonii M. Claret E., O.S.S.M.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 3, 2-12; Ps Is 12, 2-3. 4bcd. 5-6.
Ev Lc 12, 39-48.
ANNIVERSARIA
1997. Mtubatuba. Fr. Malachy M. Skelton, presb., a. 63, r. 44.
25. Alb. Feria V hebd. XXIX per annum (I Psalt.).
B. Ioannis Angeli Porro, presbyteri O.N., memoria.
MISSA memoriae.
L 1 Eph 3, 14-21; Ps 32, 1-2. 4-5. 11-12. 18-19.
Ev Lc 12, 49-53.
ANNIVERSARIA
2007. Borgorose. Fr. Mauro M. De Sanctis, presb., a. 71, r. 50.
26. Vir. Feria VI hebd. XXIX per annum (I Psalt.).
De ea.
OCTOBER 2012
231
ANNIVERSARIA
1974. Winfield. Fr. Clement M. Hanley, presb., a. 61, r. 42.
1976. Rovato. Fr. Giuseppe M. Gallo, a. 67, r. 38.
27. Alb. Sabb. hebd. XXIX per annum (I Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Eph 4, 7-16; Ps 121, 1-2. 3-4a. 4b-5.
Ev Lc 13, 1-9.
Vel:
Una e Missis CMBMV Temp. per annum, praesertim
form. n. 39: Sancta Maria, regina et mater misericordiae.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1974. Siracusa. Fr. Ambrogio M. Rugginenti, presb., a. 68, r. 44.
1989. Goma (Zaïre). Fr. Camille M. Homan, presb., a. 66, r. 47.
28. Vir. DOM. XXX PER ANNUM (Hebd. II Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Ier 31, 7-9; Ps 125, 1-2ab. 2cd-3. 4-5. 6.
L 2 Hebr 5, 1-6.
Ev Mc 10, 46-52.
MISSA ad libitum (cf. p. XVIII). Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Simonis et Iudae App. festum omittitur.
L 1 Eph 4, 1-6; Ps 23, 1-2. 3-4ab. 5-6. II VESPERAE dominicae. – Cp. post II Vp. dom.
Ev Lc 12, 54-59.
232
TEMPUS PER ANNUM
ANNIVERSARIA
1977. Milano. Fr. Luigi M. Biotto, a. 61, r. 42.
1990. Turvo. Fr. Girolamo M. Amigoni, presb., a. 73, r. 53.
2002. Negrar. Fr. Valentino M. Ravagnolo, a. 90, r. 64.
29. Vir. Feria II hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 4, 32 – 5, 8; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 13, 10-17.
1964.
1967.
1975.
1983.
1999.
ANNIVERSARIA
Vicenza. Fr. Angelo M. Saggin, presb., a. 72, r. 43.
Montréal. Fr. Bonfilius M. Dubois, presb., a. 56, r. 37.
Spello. Fr. Urbano M. Bataloni, presb., a. 60, r. 44.
London. Fr. Francis M. McEnerney, presb., a. 87, r. 68.
Wien. Fr. Hugo M. Körbel, presb., a. 76, r. 58.
30. Vir. Feria III hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 5, 21-33; Ps 127, 1-2. 3. 4-5.
Ev Lc 13, 18-21.
ANNIVERSARIA
1962. Arco. Fr. Tarcisio M. Sgarabotto, presb., a. 65, r. 46.
1978. Ottawa. Fr. Pérégrin M. Chénier, a. 68, r. 44.
2007. Marina di Massa. Fr. Sebastiano M. Ferrari, presb., a. 92,
r. 76.
OCTOBER 2012
233
31. Vir. Feria IV hebd. XXX per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Eph 6, 1-9; Ps 144, 10-11. 12-13ab. 13cd-14.
Ev Lc 13, 22-30.
I VESPERAE soll. Omnium Sanctorum. – Cp. post I
Vp. dom.
ANNIVERSARIA
1976. Roma. Fr. Alfonso M. Gallina, a. 67, r. 46.
NOVEMBER 2012
NOVEMBER 2012
1. Alb. Feria V. OMNIUM SANCTORUM, sollemnitas.
– Ad H. m. ant. pr. cum psalmodia complementari.
© MISSA pr., Gloria, lect. pr., Credo, pf. pr.
L 1 Apoc 7, 2-4. 9-14; Ps 23, 1-2. 3-4ab. 5-6.
L 2 1 Io 3, 1-3.
Ev Mt 5, 1-12a.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
Celebratio Vesperarum defunctorum post II Vesperas diei
1 nov., quae pro pietate fidelium peragi consuevit, conti-
nuari potest, una cum aliis piis exercitiis forsitan consue-
tudine traditis, tamquam peculiare pietatis obsequium.
Plenaria indulgentia, animabus in Purgatorio detentis tan-
tummodo applicabilis, conceditur christifideli qui 1) sin-
gulis diebus, a primo usque ad octavum novembris, coe-
meterium devote visitaverit et, vel mente tantum, pro
defunctis exoraverit; 2) die Commemorationis omnium
fidelium defunctorum (vel, de consensu Ordinarii, die
Dominico antecedenti aut subsequenti aut die sollemnita-
tis Omnium Sanctorum) ecclesiam aut oratorium pie visi-
taverit ibique recitaverit Pater et Credo.
Partialis indulgentia, animabus in Purgatorio detentis tan-
tummodo applicabilis, conceditur christifideli qui, 1) coe-
meterium devote visitaverit et, vel mente tantum, pro
defunctis exoraverit; 2) Laudes vel Vesperas Officii defuncto-
rum, vel invocationem Requiem aeternam devote recitaverit
(Enchiridion Indulgentiarum, ed. 1999, concessio n. 29).
235
ANNIVERSARIA
1992. Montréal. Fr. François M. Bertrand, presb., a. 81, r. 58.
1993. Chicago. Fr. Thomas M. Keenan, presb., a. 82, r. 63.
2. Viol. vel Nig. Feria VI. IN COMM. OMNIUM FIDE-
LIUM DEFUNCTORUM. Off. ut in Com. et Pr.
MISSA pr., pf. def.
Lectiones seligendae sunt ex iis quae in lectionario defunc-
torum proponuntur.
Ex Constitutione Apostolica Benedicti Pp. XV (10 aug.
1915), hodie licet omnibus sacerdotibus tres Missas cele-
brare aut concelebrare, dummodo celebrationes diversis
temporibus fiant; ea tamen lege, ut unam e tribus cui-
cumque maluerint applicare et pro ea stipem percipere
queant; teneantur vero, nulla stipe percepta, applicare alteram
Missam in suffragium omnium fidelium defunctorum, ter-
tiam ad mentem Summi Pontificis.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, excepta Missa
exsequiali.
ANNIVERSARIA
1964. Avellaneda. Fr. Victorio M. Cordero, a. 72, r. 30.
1966. Arco. Fr. Alessio M. Zanotto, a. 53, r. 18.
1996. Pesaro. Fr. Tarcisio M. Ceciliani, presb., a. 81, r. 63.
3. Alb. Sabb. hebd. XXX per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
236
TEMPUS PER ANNUM
L 1 Phil 1, 18b-26; Ps 41, 2. 3. 5bcd.
Ev Lc 14, 1. 7-11.
Vel:
Una e Missis CMBMV Temp. per annum, praeser-
tim form. n. 31: Beata Maria Virgo, fons salutis.
NOVEMBER 2012
237
L 1 Phil 2, 1-4; Ps 130, 1. 2. 3.
Ev Lc 14, 12-14.
ANNIVERSARIA
1975. Roma. Fr. Vincenzo M. Buffon, presb., a. 61, r. 45.
2009. Marina di Massa. Fr. Lino M. Dalle Lucche, presb., a. 96,
r. 73.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1985. Firenze. Fr. Roberto M. Mancuso, presb., a. 28, r. 8.
6. Vir. Feria III hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
4. Vir. DOM. XXXI PER ANNUM (Hebd. III Psalt.).
De ea.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Deut 6, 2-6; Ps 17, 2-3a. 3bc-4. 47 et 51ab.
L 2 Hebr 7, 23-28.
Ev Mc 12, 28b-34.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Caroli Borromeo E. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1974.
1982.
1987.
2006.
ANNIVERSARIA
Trapani. Fr. Giuseppe M. Mazziotta, a. 60, r. 32.
Ancona. Fr. Ivano M. Fabbri, a. 30, r. 9.
São Paolo. Fr. Denis M. McSwiney, presb., a. 35, r. 13.
Negrar. Fr. Vincenzo M. Zanotto, presb., a. 84, r. 65.
5. Vir. Feria II hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 2, 5-11; Ps 21, 26b-27. 28-30a. 31-32.
Ev Lc 14, 15-24.
ANNIVERSARIA
1968. Portland. Fr. Augustine M. Riesenmy, presb., a. 88, r. 59.
7. Vir. Feria IV hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 2, 12-18; Ps 26, 1. 4. 13-14.
Ev Lc 14, 25-33.
ANNIVERSARIA
1996. Pesaro. Fr. Domenico M. Nicolai, presb., a. 60, r. 41.
8. Vir. Feria V hebd. XXXI per annum (III Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Phil 3, 3-8a; Ps 104, 2-3. 4-5. 6-7.
Ev Lc 15, 1-10.
238
TEMPUS PER ANNUM
In Uruguay:
7. I VESPERAE soll. – Cp. post I Vp. dom.
8. Alb. Feria V. «PURISIMA VIRGEN DE LOS TREINTA
Y TRES, PATRONA PRINCIPAL DE LA REPUBLICA
ORIENTAL DEL URUGUAY», sollemnitas. – Ad H. m.
ant. pr. cum psalmodia complementari.
Missa pr., Gloria, lect. pr., Credo, pf. pr.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
II VESPERAE soll. – Cp. post II Vp. dom.
NOVEMBER 2012
1971.
1987.
1988.
1994.
1996.
2003.
2010.
239
ANNIVERSARIA
Joliet. Fr. Vincent M. Scheltinga, presb., a. 71, r. 51.
Pesaro. Fr. Bruno M. Torelli, presb., a. 66, r. 49.
Nola. Fr. Mariano M. Casoria, presb., a. 73, r. 55.
Avellaneda. Fr. Ruggero M. Scortegagna, a. 79, r. 58.
Roma. Fr. Alberto M. Tuccimei, presb., a. 66, r. 6.
Montréal. Fr. Étienne M. Gagnon, presb., a. 83, r. 62.
Vicenza. Fr. Costanzo M. Simoni, presb., a. 87, r. 67.
10. Alb. Sabb. hebd. XXXI per annum (III Psalt.).
S. Leonis Magnis Pp. D., memoria.
MISSA memoriae.
L 1 Phil 4, 10-19; Ps 111, 1-2. 5-6. 8a et 9.
Ev Lc 16, 9-15.
ANNIVERSARIA ANNIVERSARIA
1971. Nepi. Fr. Nazareno M. Mecarocci, a. 80, r. 39. 1974. Innsbruck. Fr. Bonajunkta M. Schönauer, a. 66, r. 46.
1999. Siteki. Fr. Augustine M. Magongo, presb., a. 45, r. 23. 2000. Nepi. Fr. Tommaso M. Brigotti, presb., a. 79, r. 63.
2008. Genova. Fr. Bruno M. Reverberi, presb., a. 88, r. 70. 2006. Ronzano. Fr. Bruno M. Quercetti, presb., a. 71, r. 50.
9. Alb. Feria VI. IN DEDICATIONE BASILICAE 11. Vir. DOM. XXXII PER ANNUM (Hebd. IV Psalt.).
LATERANENSIS, festum. – Ad H. m. ant. et pss. De ea.
feriae VI hebd. III.
MISSA de festo, Gloria, lect. pr., pf. pr.
L 1 Ez 47, 1-2. 8-9. 12 vel 1 Cor 3, 9c-11. 16-17;
Ps 45, 2-3. 5-6. 8-9.
Ev Io 2, 13-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 1 Reg 17, 10-16; Ps 145, 7. 8-9a. 9bc-10.
L 2 Hebr 9, 24-28.
Ev Mc 12, 38-44 vel 12, 41-44.
Prohibentur Missae defunctorum, excepta exsequiali.
S. Martini Turonensis E. memoria omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
240
TEMPUS PER ANNUM
12. Rub. Feria II hebd. XXXII per annum (IV Psalt.).
S. Iosaphat E. M., memoria.
MISSA memoriae.
L 1 Tit 1, 1-9; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 17, 1-6.
DIES MISSIONIS
Missio Ingwavuma in regione Zululand, die 12 novem-
bris 1963 in Praefecturam apostolicam erecta, hodie
Diem Missionis celebrat.
Fratres et sorores Ordinis nostri in celebratione
Liturgiae Horarum necnon Sacrificii eucharistici
Deum enixe exorent ut operam missionariorum con-
firmet et Ecclesiae, quae est in illa regione, foveat
incrementum.
ANNIVERSARIA
1966. Mestre. Fr. Lino M. Pedot, presb., a. 54, r. 38.
2002. Pestrino-Verona. Fr. Davino M. Trento, presb., a. 70, r. 50.
13. Vir. Feria III hebd. XXXII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Tit 2, 1-8. 11-14; Ps 36, 3-4. 18 et 23. 27 et 29.
Ev Lc 17, 7-10.
14. Vir. Feria IV hebd. XXXII per annum (IV Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
NOVEMBER 2012
241
L 1 Tit 3, 1-7; Ps 22, 1-3a. 3b-4. 5. 6.
Ev Lc 17, 11-19.
ANNIVERSARIA
1972. Saluzzo. Fr. Giorgio M. Capello, presb., a. 67, r. 51.
1994. Wien. Fr. Philipp M. Thaler, presb., a. 66, r. 45.
2003. Genova. Fr. Lorenzo M. Borio, presb., a. 87, r. 69.
15. Vir. Feria V hebd. XXXII per annum (IV Psalt.).
De ea. Vel:
Alb. S. Alberti Magni E. D.
MISSA ad libitum (cf. p. XVIII).
L 1 Phm 7-20; Ps 145, 7. 8-9a. 9bc-10.
Ev Lc 17, 20-25.
ANNIVERSARIA
1976. Caracas. Fr. Enrico M. Filippin, presb., a. 67, r. 48.
1987. Saluzzo. Fr. Gioacchino M. Pappini, a. 75, r. 48.
1988. Córdoba. Fr. Rafael M. Nadales Bonilla, presb., a. 61, r. 38.
16. Alb. Feria VI. OMNIUM SANCTORUM O.N.,
festum. – Ad H. m. ant. et pss. feriae VI hebd. IV.
MISSA pr., Gloria, lect. pr., pf. pr.
L 1 1 Cor 12, 4-13 vel Apoc 7, 13-17; Ps 99, 2. 3. 4. 5.
Ev Lc 12, 22-32.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
Ss. Margaritae Scotiae et Gertrudis V. memoriae omittuntur.
ANNIVERSARIA
1979. Orense. Fr. Gioacchino M. Montà, presb., a. 55, r. 38.
2002. Sainte-Foy. Fr. Anselme M. Desjardins, presb., a. 85, r. 67.
242
243
TEMPUS PER ANNUM NOVEMBER 2012
17. Viol. vel Nig. Sabb. IN COMMEMORATIONE 18. Vir. DOM. XXXIII PER ANNUM (Hebd. I Psalt.).
OMNIUM FRATRUM, SORORUM, PROPIN- De ea.
QUORUM BENEFACTORUMQUE O.N. DE-
FUNCTORUM.
Officium pr.
MISSA pr., lect. pr., pf. pr.
L 1 Rom 14, 7-9; Ps 114, 3-4. 5-6; 115, 15-16.
Ev Mt 25, 31-46.
Adhibeatur PE cum praefatione variabili.
Prohibentur omnes aliae celebrationes, excepta Missa
exsequiali.
S. Elisabeth Hungariae Rel. memoria omittitur.
I VESPERAE dom. – Cp. post I Vp. dom.
Ubi debita facultate impetrata, haec Commemoratio in
aliam diem transfertur.
17. Alb. Sabb. hebd. XXXII per annum (IV Psalt.).
S. Elisabeth Hungariae Rel., memoria.
MISSA memoriae.
L 1 3 Io 5-8; Ps 111, 1-2. 3-4. 5-6.
Ev Lc 18, 1-8.
I VESPERAE dom. – Cp. post I Vp. dom.
© MISSA pr., Gloria, Credo, pf. dom. per annum.
L 1 Dan 12, 1-3; Ps 15, 5 et 8. 9-10. 11.
L 2 Hebr 10, 11-14. 18.
Ev Mc 13, 24-32.
Prohibentur Missae defunctorum, excepta exsequiali.
In Dedicatione basilicarum Ss. Petri et Pauli App. memoria
omittitur.
II VESPERAE dominicae. – Cp. post II Vp. dom.
1992.
1993.
2006.
2009.
ANNIVERSARIA
Roma. Fr. Giovanni M. Catena, presb., a. 73, r. 57.
Avellino. Fr. Alessio M. Crispo, presb., a. 79, r. 63.
Manchester. Fr. Kevin M. Donaghey, preb., a. 72, r. 53.
Roma. Fr. Giovanni M. Marini, presb., a. 87, r. 68.
19. Vir. Feria II hebd. XXXIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 1, 1-4; 2, 1-5a; Ps 1, 1-2. 3. 4 et 6.
Ev Lc 18, 35-43.
20. Vir. Feria III hebd. XXXIII per annum (I Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
ANNIVERSARIA
2002. Gutenstein. Fr. Albert M. Guggenberger, presb., a. 92, r. 74.
L 1 Apoc 3, 1-6. 14-22; Ps 14, 2-3ab. 3cd-4ab. 5.
Ev Lc 19, 1-10.
244
TEMPUS PER ANNUM
NOVEMBER 2012
DIES CONGREGATIONIS
1963.
1963.
1986.
1996.
2000.
2009.
DIES MONIALUM O.S.M.
Congregatio Sororum cui est titulus Serve di Maria
Ss. Addolorata (Firenze), hanc diem, qua, anno 1873,
M. Iuliana Signorini (1815-1873), Congregationis
Fundatrix, ad caelestem patriam migravit, tamquam
Diem Congregationis celebrat. Anno 1876 die 27
martii Congregatio Ordini nostro aggregata est.
Omnes Servi et Servae sanctae Mariae in celebratio-
ne Laudum et Vesperarum necnon Sacrificii euchari-
stici Deo gratias agant et pro bono atque incremen-
to Instituti fraternas effundant preces.
245
Ex constituto Ecclesiae, quod antiquam respicit tra-
ditionem tum Orientis tum Occidentis, memoria
Praesentationis B. Mariae Virginis celebratur ut dies
«Pro orantibus».
Hac die ergo pro Monialibus Ordinis nostri (Madrid,
Mislata, Sagunto [Hispania], Arco, Carpenedo di
Mestre, Montecchio, Pesaro, Roma, Sant’Angelo in
Vado, Verona [Italia], München [Germania], Celaya
[México], Nampula, Lichinga, Chokwe [Moçambique])
quae cotidie pro tota Servorum Familia Deum exorant,
supplices effundamus preces.
ANNIVERSARIA
Ottawa. Fr. Ubald M. Furlan, presb., a. 41, r. 16.
Ottawa. Fr. André M. Lalancette, presb., a. 35, r. 17.
Bologna. Fr. Gerardo M. Maestrami, presb., a. 58, r. 42.
Guadalajara. Fr. Marcos M. Romero Díaz, presb., a. 60,
r. 37.
Oruro. Fr. Alfonso M. Massignani, presb., a. 79, r. 61.
Civita Castellana. Fr. Roberto M. Fagioli, presb., a. 91,
r. 74.
21. Alb. Feria IV hebd. XXXIII per annum (I Psalt.).
In Praesentatione B. Mariae V., memoria.
MISSA memoriae, lect. pr., pf. B. Mariae V.
L 1 Zac 2, 14-17; Ps Lc 1, 46-47. 48-49. 50-51. 52-53.
54-55.
Ev Mt 12, 46-50.
ANNIVERSARIA
2003. Dundee. Fr. Nicholas M. Martin, presb., a. 59, r. 41.
2008. Portland. Fr. Patrick M. McNamara, presb., a. 88, r. 65.
22. Rub. Feria V hebd. XXXIII per annum (I Psalt.).
S. Ceciliae V. M., memoria.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 5, 1-10; Ps 149, 1-2. 3-4. 5-6a et 9b.
Ev Lc 19, 41-44.
ANNIVERSARIA
1984. Roma. Fr. Gabriele M. Berardi, presb., a. 72, r. 54.
1985. Berkeley. Fr. Neal M. Flanagan, presb., a. 65, r. 47.
2001. Siteki. Fr. Thomas Mdolomba M. Zwane, presb., a. 36,
r. 12.
NOVEMBER 2012
CCC
ANNUS AB OBITU ARCANGELAE BIONDINI, MONIALIS
SERVAE MARIAE, MONASTERII OPPIDI ARCI FUNDATRICIS
247
23. Vir. Feria VI hebd. XXXIII per annum (I Psalt.).
De ea. Vel:
Rub. S. Clementis I Pp. M. Vel:
Alb. S. Columbani Abb.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 10, 8-11; Ps 118, 14. 24. 72. 103. 111. 131.
Ev Lc 19, 45-48.
Anno 1712, die 23 novembris, Arci, in dioecesi tridentina, obiit Arcangela
Biondini, monialis serva Mariae. Anno 1655, in Monasterium Servarum
Mariae oppidi Burani (Venetiis) ingressa est ibique commorata est multos
per annos, fungens quoque munere antistitae. Anno 1689 in oppidum
Arcum (dioeceseos Tridentinae) se contulit atque monaterium condidit,
cuius Contitutiones probatae sunt anno 1699 a Innocentio XII (+1700).
Arcangelae Biondini complures scripta spiritualia exstant, in quibus iussu
episcopi Blasii Fragiorgi (+1707) patris spiritualis, aliqua facta quae mysti-
ce experta erat enarravit.
Il 23 novembre 1712 morì ad Arco (Trento) suor Arcangela Biondini,
monaca serva di Maria. Essa era entrata nel 1655 nel monastero delle
Serve di Maria di Burano (Venezia) dove rimase molte anni ricoprendo
l’ufficio di abbadessa. Nel 1689 si trasferì ad Arco (Trento) per fondarvi
un monastero, le cui Costituzioni furono approvate nel 1699 dal papa
Innocenzo XII (+1700). Di Arcangela Biondini si conservano molti scrit-
ti spirituali, in cui, per ordine del vescovo Biagio Fragiorgi (+1707), suo
direttore spirituale, narrò alcune esperienze mistiche da lei vissute.
On 23 November 1712, Sister Arcangela Biondini, a Servite nun, died at
Arco (Trento). In 1655 she entered the Servite monastery of Burano (Venice)
where she remained for many years serving as abbess. In 1689 she moved to
Arco (Trento) to found a monastery whose Constitutions were approved by
Pope Innocent XII(+1700). Many of Arcangela Biondini’s spiritual writings
still exist, including some in which, at the order of Bishop Biagio Fragiorgi
(+1707), her spiritual director, she narrated several mystical experiences.
1983.
1988.
1996.
2008.
2010.
ANNIVERSARIA
Wien. Fr. Innozenz M. Krub, presb., a. 83, r. 63.
Milano. Fr. Matteo M. Beretta, a. 73, r. 50.
Tirano. Fr. Ferdinando M. Malva, presb., a. 84, r. 65.
San Marino. Fr. Tarcisio M. Turchetti, presb., a. 88, r. 70.
Perth. Fr. Francis M. Christie, presb. a. 83, r. 60.
24. Rub. Sabb. hebd. XXXIII per annum (I Psalt.).
Ss. Andreae Dung-Lac P. et Soc. Mm., memoria.
MISSA memoriae.
L 1 Apoc 11, 4-12; Ps 143, 1. 2. 9-10.
Ev Lc 20, 27-40.
I VESPERAE dom. – Cp. post I Vp. dom.
ANNIVERSARIA
1972. Vicenza. Fr. Fulvio M. Mondin, presb., a. 59, r. 39.
1973. Innsbruck. Fr. Ambros M. Dangel, presb., a. 82, r. 64.
1996. Livorno. Fr. Filippo M. Grigioni, presb., a. 75, r. 49.
25. Alb. Dominica. D. N. IESU CHRISTI UNIVER-
SORUM REGIS, sollemnitas. – Ad H. m. ant. pr.
cum psalmodia dom. hebd. II.
248
TEMPUS PER ANNUM
© MISSA pr., Gloria, Credo, pf. pr.
L 1 Dan 7, 13-14; Ps 92, 1ab. 1c-2. 5.
L 2 Apoc 1, 5-8.
Ev Io 18, 33b-37.
Adhibeatur PE cum praefatione variabili.
Prohibentur aliae celebrationes, excepta exsequiali.
S. Catharinae de Alexandria V.M. memoria omittitur.
II VESPERAE soll. – Cp. post II Vp. dom.
ANNIVERSARIA
1965. Padova. Fr. Alfonso M. Galarce Ayala, a. 28, r. 1.
1969. Oderzo. Fr. Mariano M. Mattiussi, a. 62, r. 38.
2000. Denver. Fr. Roger M. Manning, presb., a. 81, r. 61.
26. Vir. Feria II hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 14, 1-3. 4b-5; Ps 23, 1-2. 3-4ab. 5-6.
Ev Lc 21, 1-4.
27. Vir. Feria III hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 14, 14-19; Ps 95, 10. 11-12. 13.
Ev Lc 21, 5-11.
ANNIVERSARIA
2005. Innsbruck. Fr. Lukas M. Huber, presb., a. 63, r. 43.
28. Vir. Feria IV hebd. XXXIV per annum (II Psalt.).
De ea.
NOVEMBER 2012
249
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 15, 1-4; Ps 97, 1. 2-3ab. 7-8. 9.
Ev Lc 21, 12-19.
ANNIVERSARIA
1974. Montevideo. Fr. Giovanni M. Gonzo, presb., a. 60, r. 41.
29. Vir. Feria V hebd. XXXIV per annum (II Psalt.).
De ea.
MISSA ad libitum (cf. p. XVIII).
L 1 Apoc 18, 1-2. 21-23; 19, 1-3. 9a; Ps 99, 2. 3. 4. 5.
Ev Lc 21, 20-28.
ANNIVERSARIA
1985. Poschiavo. Fr. Giuseppe M. Ferin, presb., a. 77, r. 59.
30. Rub. Feria VI. S. ANDREAE AP., festum. – Ad H.
m. ant. de temp. et pss. feriæ VI, hebd. II.
De ea.
© MISSA pr., Gloria, lect. pr., pf. App.
L 1 Rom 10, 9-18; Ps 18, 2-3. 4-5.
Ev Mt 4, 18-22.
Adhibeatur PE cum praefatione variabili.
Prohibentur Missae defunctorum, excepta exsequiali.
ANNIVERSARIA
Langegg. Fr. Ignaz M. Millik, presb., a. 91, r. 72.
Saviano. Fr. Girolamo M. Russo, presb., a. 85, r. 67.
Montréal. Fr. Armand M. Gaudreau, presb., a. 65, r. 43.
Gelsenkirchen-Buer. Fr. Gabriel M. Kurzenhäuser, presb.,
a. 62, r. 38.
2010. Viareggio. Fr. Luigi M. De Vittorio, presb., a. 80, r. 63.
1968.
1970.
1992.
2001.
DECEMBER 2012
TEMPUS ADVENTUS
1. Alb. Sabb. hebd. XXXIV per annum (II Psalt.).
De S. Maria in sabb., memoria.
MISSA memoriae.
L 1 Apoc 22, 1-7; Ps 94, 1-2. 3-5. 6-7.
Ev Lc 21, 34-36.
DECEMBER 2012
02. Dominica
03. Feria II
04. Feria III
Vel: 05. Feria IV
Una e missis CMBMV Temp. per annum, praesertim 06. Feria V
form. n. 46: Beata Maria Virgo, ianua caeli.
ANNIVERSARIA 07. Feria VI
1976. El Paso. Fr. Tarcisio M. Bressan, a. 62, r. 43. 08. Sabbato
2001. México. Fr. Giovannangelo M. Gasperini Tomasel, presb.,
a. 85, r. 64.
Explicit tempus per annum.
A sequenti dominica prima Adventus sumitur Lectiona-
rium festivum, Anno C.
N.B. – Utilitatis causa praebentur, paginis sequentibus,
indicationes fundamentales pro celebrationibus usque ad
diem 31 decembris 2012 occurrentibus.
09. Dominica
10. Feria II
11. Feria III
12. Feria IV
13. Feria V
14. Feria VI
15. Sabbato
16. Dominica
17. Feria II
18. Feria III
De Dominica I Adventus.
S. Francisci Xavier P., memoria.
De feria Adventus. Vel:
S. Ioannis Damasceni P. D.
De feria Adventus.
De feria Adventus. Vel:
S. Nicolai E.
S. Ambrosii E. D., memoria.
In Conceptione Immaculata
B. Mariae V., sollemnitas.
De Dominica II Adventus.
De feria Adventus. Vel:
B. Hieronymi de Sancto Angelo
in Vado Presb. O.N.
De feria Adventus. Vel:
S. Damasi I Pp.
De feria Adventus. Vel:
B. Mariae Virginis de Guadalupe.
S. Luciae V. M., memoria.
S. Ioannis a Cruce, memoria.
De feria Adventus. Vel:
B. Bonaventurae de Pistorio P. O.N.
De Dominica III Adventus.
De feria Adventus.
De feria Adventus.
19. Feria IV
20. Feria V
21. Feria VI
22. Sabbato
23. Dominica
24. Feria II
De feria Adventus.
De feria Adventus.
De feria Adventus.
Comm. S. Petri Canisii P. D.
De feria Adventus.
De Dominica IV Adventus.
De feria Adventus.
TEMPUS NATIVITATIS
DECEMBER 2012
24. Feria II
25. Feria III
26. Feria IV
27. Feria V
28. Feria VI
29. Sabbato
30. Dominica
31. Feria II
Vespere:
MISSA Vigiliaris de Nativitate Domini.
In Nativitate Domini, sollemnitas.
S. Stephani Protomart., festum
S. Ioannis Ap. et Evang., festum.
S. Innocentium Mart., festum.
De V die infra octavam Nativ.
Comm. S. Thomae Becket.
S. Familiae Iesu, Mariae et Ioseph, festum
De VII die infra octavam Nativ.
Comm. S. Silvestri I Pp.
CALENDARIUM PERPETUUM
ORDINIS FRATRUM SERVORUM
BEATÆ MARIÆ VIRGINIS
IANUARIUS
12 S. ANTONII MARIÆ PUCCI, PRESBYTERI O.N.,
15 B. Iacobi de Villa, Eleemosynarii nuncupati *
FEBRUARIUS
3 B. Ioachimi Senensis, religiosi O.N.
17 SS. SEPTEM PATRUM FUNDATORUM O.N.
19 B. Elisabeth Picenardi, virginis O.N.
MARTIUS
19 S. IOSEPH, SPONSI BEATÆ MARIÆ VIRGINIS,
O.N. PATRONUS SECUNDARIUS
Feria VI post dominicam V Quadragesimæ:
B. MARIÆ VIRGINIS IUXTA CRUCEM
4
8
11
12
30
MAIUS
S. PEREGRINI LAZIOSI, RELIGIOSI O.N.
B. Mariæ Virginis gratiæ Matris ac Mediatricis
B. Benincasæ, religiosi O.N.
B. Francisci Senensis, presbyteri O.N.
B. Iacobi Philippi Bertoni, presbyteri O.N.
IUNIUS
19 S. M. IULIANÆ FALCONIERI, VIRGINIS O.N.
(Pro Monialibus et Sororibus:
27 B. Thomæ de Urbe Veteri, religiosi O.N.
IULIUS
1 B. Ferdinandi Mariae Baccilieri, presbyteri, Fundatoris
Servarum Mariae Galeazzae
(Pro sororibus Servis Mariae Galeazzae:
4 B. Ubaldi de Burgo Sancti Sepulcri, presbyteri O.N.
13 S. Cleliæ Barbieri, virginis, Fundatricis
Minimarum B.M.V. Perdolentis,
(Pro Sororibus Minimis B. Mariae V. Perdolentis:
* Quando non indicatur gradus celebrationis, fit memoria ad libitum
Festum
Memoria
Sollemnitas
Memoria
Sollemnitas
Festum
Festum
Memoria
Memoria
Festum
Sollemnitas)
Festum)
Memoria
Sollemnitas)
AUGUSTUS
23 S.P.N. PHILIPPI BENIZI, O.N. PROPAGATORIS INSIGNIS, PRESBYTERI
28 S. AUGUSTINI, EPISCOPI ET ECCLESIÆ DOCTORIS ATQUE
LEGISLATORIS NOSTRI
31 B. Andreæ de Burgo Sancti Sepulcri, religiosi O.N.
SEPTEMBER
1 B. Ioannæ de Florentia, virginis O.N.
(Pro Monialibus et Sororibus:
5 B. Mariae Magdalenae Starace, Virg. O.N., Fundatricis
Congregationis Sororum Servarum Mariae a Compassione
(Pro sororibus Servis Mariae a Compassione:
6 B. Bonaventuræ de Foro Livii, presbyteri O.N.
15 B. MARIÆ VIRGINIS PERDOLENTIS,
O.N. PATRONÆ PRINCIPALIS
22 In Dedicatione Basilicæ sacri Conventus Montis Senarii
OCTOBER
3 B. M. Guadalupe Ricart Olmos, virginis et martyre O.N.
(Pro Monialibus:
25 B. Ioannis Angeli Porro, presbyteri O.N.
Festum
Festum
Memoria)
Festum)
Memoria
Sollemnitas
Memoria
Memoria
Festum)
Memoria
NOVEMBER
16 OMNIUM SANCTORUM O.N.
17 IN COMMEMORATIONE OMNIUM FRATRUM, SORORUM,
PROPINQUORUM BENEFACTORUMQUE O.N. DEFUNCTORUM 1
Festum
DECEMBER
10 B. Hieronymi de Sancto Angelo in Vado, presbyteri O.N.
15 B. Bonaventuræ de Pistorio, presbyteri O.N.
MISSA DE S. MARIA IN SABBATO celebratur:
- Tempore Adventus usque ad diem 16 decembris inclusive, ut memoria obliga-
toria, nisi alia memoria obligatoria occurrat;
- Tempore Nativitatis, ut memoria ad libitum, nisi memoria obligatoria occurat;
- Tempore Paschali, ut memoria ad libitum, nisi memoria obligatoria occurrat;
- Tempore per Annum, ut memoria obligatoria, nisi alia memoria obligatoria
occurrat.
1 Nisi Provincia, iusta de causa, debita facultate impetrata, alium diem statuerit.
INDEX
Explicatio abbreviationum …………………………………. III
Pro Calendario anni liturgici 2010-2011 ………………..V
Tabula dierum liturgicorum ……………………………… VIII
De Anno Liturgico et de Calendario…………………….. XI
De Celebratione Eucharistica……………………………… XII
Tabula missis ritualibus …………………………………….. XV
De Liturgia Horarum ………………………………………. XX
Tempus Adventus ……………………………………………….. 1
Tempus Nativitatis ……………………………………………. 17
Tempus per annum (ante Quadragesimam) ………….. 33
Tempus Quadragesimae …………………………………….. 57
Hebdomada Sancta ……………………………………………. 83
Triduum Paschale ……………………………………………… 90
Tempus Paschale ……………………………………………….. 96
Tempus per annum (post Tempus Paschale) ………… 135
Calendarium perpetuum O.S.M. ………………………. 253
FINITO DI STAMPARE PER
I TIPI DELL’ISTITUTO ARTI
GRAFICHE MENGARELLI
R O M A

S A B A T O
XXIX OTTOBRE MMXI
NELLA MEMORIA DI
S A N T A M A R I A
I B
N
S
A
A
T
O

12

riogrande |
aidoCopro |
zokafric |
Unblog.fr | Créer un blog | Annuaire | Signaler un abus | l'actue des starlette
| Pont Tracy-Lanoraie
| texia1904